CAZyme Information: MGYG000000046_01466

Basic Information

• Species: Megasphaera stantonii
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera stantonii
• CAZyme ID: MGYG000000046_01466
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
521	MGYG000000046_11|CGC1	58781.07	8.6149

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000046	2558124	Isolate	United Kingdom	Europe

• Gene Location: Start: 46773; End: 48338 Strand: -

Full Sequence      

MECLHRSEERLLNAAPAVAPNLLQRLLDDIGYVPILLAAAVLVCFTGNALIKITDPVESN
YALTAMEMLQSGDYVSPRIFGNYWYDKPVLFYWEIMAAFSLFGTTEFAARFFPSVFGLIG
VVMAYGFASRLYDKKTGFVAALVLVTSLEYFYLSHAVITDMTLFVFFSATLMLFYLAYSE
GRPRLYYGAYACAALAVLTKGPVGLVLPGLIIVLFLLWRRDFKSIFLHIKLGSGLLLFFV
IAGLWYVPMYVMHGGDFISQFIGVHNVLRATVSEHPRDNVWYYYTAVFLLGFFPWVFTLP
LAAKKYKPVHKLRACLRTGGFAGLRRMADSLSMKEQFLVTWAVVVFVFYQCMATKYMTYT
FPYMIPVAIAFAAYLRHHKRLVAVLTTVGVTFYLIVTLFVAVPLCREASAYDAAQAVQRM
ADGRTCVAVYGGRYPVSLAYYSGYDAKRLKWADEIEDSLPGGINWNAKNIMPFMAIEDLA
QHDHVVLLVHENEDANFHKAGIPGDWVGVKKAGRWLIYENQ

Enzyme Prediction     

No EC number prediction in MGYG000000046_01466.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	33	405	3e-98	0.6462962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	3.06e-45	26	402	4	363	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.82e-27	56	380	31	338	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	9.61e-21	86	238	1	154	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	5.48e-10	58	253	32	240	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	6.21e-09	81	401	56	402	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXL22207.1	0.0	1	521	1	521
AVO27725.1	2.32e-209	18	520	11	508
ALG42265.1	2.51e-206	18	520	1	498
AVO74995.1	2.52e-206	18	520	11	508
CCC74317.1	2.52e-206	18	520	11	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.74e-23	31	362	32	351	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	1.34e-23	56	297	28	264	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
O67601	4.26e-22	47	399	19	328	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
A0KGY4	1.38e-21	55	373	27	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A1JPM4	1.89e-21	55	374	31	333	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
A4SQX1	3.29e-21	55	373	27	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999991	0.000047	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
31	53
107	129
150	172
187	218
225	247
281	303
337	354
358	375
382	404