CAZyme Information: MGYG000000044_01704

Basic Information

• Species: Parabacteroides merdae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides merdae
• CAZyme ID: MGYG000000044_01704
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	MGYG000000044_3|CGC10	36404.61	4.973

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000044	4300426	Isolate	United Kingdom	Europe

• Gene Location: Start: 439621; End: 440592 Strand: +

Full Sequence      

MENSPVSYKPTGFIGGAGHGCIFTAGSENYWKAATNSISVRHMFERRVSFYPSGFDKDGY
LFTNTYLGDYPMFLPGGKEQIAGEYQPGWMLLSYGKKVSVSSSLEGYPAENIVDEDARTA
WVAQSNRDMEWAQVDLQRLSSIHAIQVNFDEYGANQKGAVSGVYQSYLIYASVNGEDWSL
VVDYGTKKTDTPHDYIEFEEPFKARYIKLQNKEYMVSENFSVRDLRIFGKGQGSTPRAVN
DFTVERDEADPCKARLCWEAVPDAQGYIVRYGIAGDKLYNNFQVMGENTLEIGSLNKGVA
YYFTIDAYNENGITRTSRIKVCR

Enzyme Prediction     

No EC number prediction in MGYG000000044_01704.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	101	213	1.5e-23	0.7983870967741935

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08982	GH43-like	9.83e-52	1	102	207	308	Glycosyl hydrolase family 43 protein; uncharacterized. This glycosyl hydrolase family 43 (GH43)-like subfamily includes uncharacterized enzymes similar to those with beta-1,4-xylosidase (xylan 1,4-beta-xylosidase; EC 3.2.1.37), beta-1,3-xylosidase (EC 3.2.1.-), alpha-L-arabinofuranosidase (EC 3.2.1.55), arabinanase (EC 3.2.1.99), xylanase (EC 3.2.1.8), endo-alpha-L-arabinanase and galactan 1,3-beta-galactosidase (EC 3.2.1.145) activities. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many of the enzymes in this family display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
pfam00754	F5_F8_type_C	4.37e-18	97	223	1	124	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	4.58e-13	97	214	13	131	Substituted updates: Jan 31, 2002
smart00231	FA58C	2.39e-06	101	209	16	121	Coagulation factor 5/8 C-terminal domain, discoidin domain. Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.
smart00060	FN3	2.61e-04	236	313	1	82	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT49472.1	1.73e-245	1	323	23	345
QIA09145.1	2.88e-94	4	319	261	575
QEC64753.1	1.37e-93	1	319	264	583
QEM08017.1	1.78e-93	1	319	263	580
QTE42808.1	1.78e-93	1	319	263	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2L9L_A	8.02e-07	74	209	18	144	NMRStructure of the Mouse MFG-E8 C2 Domain [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70490	5.72e-06	107	209	305	409	Lactadherin OS=Rattus norvegicus OX=10116 GN=Mfge8 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000044_01704.