CAZyme Information: MGYG000000044_00786

Basic Information

• Species: Parabacteroides merdae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides merdae
• CAZyme ID: MGYG000000044_00786
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
225		26464.6	9.8464

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000044	4300426	Isolate	United Kingdom	Europe

• Gene Location: Start: 921654; End: 922331 Strand: +

Full Sequence      

MPQMYLRQSPEKEMRNTILISLLLMLLPVSVSAQFYTITRESGILPTERQKESYNRARKD
VTEGKKNKMMAKDTLIVRLNNQKELDDNSRNSDRKASLKREQQKNVDDIIKAENQLPELT
IPNLYKEIIRNGILYPKIVLAQAILETGWFRSSVCRNKHNLFGLTNPRTGKYYEFNHWTE
SVRAYYTKVQYKYKGGNYLLWLDEMGYAEDPNYLVEIISILKMLL

Enzyme Prediction     

No EC number prediction in MGYG000000044_00786.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	126	223	5e-18	0.9296875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	4.38e-16	122	186	2	78	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
COG1705	FlgJ	3.19e-10	88	219	29	180	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	3.44e-10	134	222	28	137	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	6.72e-07	140	164	186	210	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK08581	PRK08581	5.80e-04	47	176	241	383	amidase domain-containing protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKA52216.1	3.93e-146	14	225	1	212
QUT98797.1	9.91e-124	14	224	1	211
QJR77087.1	3.39e-117	14	224	1	211
ALJ41751.1	3.39e-117	14	224	1	211
QUT57866.1	1.84e-99	70	224	1	155

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000801	0.998505	0.000201	0.000163	0.000156	0.000150

TMHMM  Annotations     

start	end
17	39