CAZyme Information: MGYG000000039_02261

Basic Information

• Species: Faecalibacterium prausnitzii_H
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_H
• CAZyme ID: MGYG000000039_02261
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
315		33965.12	5.6714

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000039	2848022	Isolate	United Kingdom	Europe

• Gene Location: Start: 27723; End: 28670 Strand: +

Full Sequence      

MLNLTVAQDGSGNYASISEAVLAVPYELEAQITIGPGVYREKLVCEKRRITLRGAGADAT
RLVWGDGGRLPHPDGRSTHTFRSYTAFFSGEQLTVEDLTIENDAGPGSAVGQAVAAYVDS
ARAVFRRVKLLGNQDTLFCAPLPEKEREKDGFLGPRTFAPRRATAQYYQNCEIAGDIDFI
FGGADALFEQCTLRTVDNHIPHSYITAPSGPADGLGFVFWDCNFVSDCPAGTIYLGRPWR
PTGKTAVLDCRLGAHISPEGFVGWNDRTDTDLAQFVEAGSSGEGAAPRPAWVHAPSAADA
AALLARARKRCRPEL

Enzyme Prediction     

No EC number prediction in MGYG000000039_02261.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	4	302	1.1e-75	0.9618055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	2.73e-54	3	285	84	379	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	5.81e-48	3	285	1	266	Pectinesterase.
PLN02773	PLN02773	3.60e-45	4	291	7	278	pectinesterase
PLN02745	PLN02745	9.18e-36	3	286	286	552	Putative pectinesterase/pectinesterase inhibitor
PLN02682	PLN02682	4.79e-35	2	293	69	345	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA44050.1	6.06e-202	1	313	1	313
ATP00222.1	6.06e-202	1	313	1	313
CBK98674.1	7.34e-190	1	314	1	314
AXA81880.1	2.10e-189	1	314	1	314
AXB27671.1	1.98e-186	1	314	1	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.41e-28	3	285	4	269	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	1.41e-25	3	286	8	274	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	1.77e-23	3	286	32	336	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	6.73e-17	3	271	5	286	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1E_A	2.46e-15	4	284	11	265	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	9.60e-34	6	284	9	269	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q43062	4.61e-30	6	265	211	454	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
O49298	9.69e-29	3	285	250	508	Probable pectinesterase/pectinesterase inhibitor 6 OS=Arabidopsis thaliana OX=3702 GN=PME6 PE=2 SV=1
Q9LXK7	1.12e-28	6	285	217	479	Probable pectinesterase/pectinesterase inhibitor 32 OS=Arabidopsis thaliana OX=3702 GN=PME32 PE=2 SV=1
Q9SMY6	5.83e-28	3	286	296	566	Putative pectinesterase/pectinesterase inhibitor 45 OS=Arabidopsis thaliana OX=3702 GN=PME45 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000039_02261.