CAZyme Information: MGYG000000024_02118

Basic Information

• Species: Paraclostridium bifermentans
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Paraclostridium; Paraclostridium bifermentans
• CAZyme ID: MGYG000000024_02118
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
189		22100.52	8.5885

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000024	3641600	Isolate	United Kingdom	Europe

• Gene Location: Start: 2197064; End: 2197633 Strand: -

Full Sequence      

MNKKRYITIFIIFMLLVLGVISIRQKLVLKLLHPRLYEEYVETYSKEFSIDENLVYSIMK
VESKFNKNAISNKKAKGLMQISDITQKWAQDELKLGKVDIFDPETNIKIGCWYLSKLYKE
FNDLDLVIAAYNGGSGNVNKWLNDEAYSKDGNKLHEIPFNETKNYLGKVKENYIIYKSLY
GEEEANEKN

Enzyme Prediction     

No EC number prediction in MGYG000000024_02118.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	52	175	2.1e-31	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.59e-66	34	173	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.69e-45	32	179	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	5.15e-39	52	173	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	5.73e-37	37	186	139	293	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	1.03e-34	39	174	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEZ70692.1	4.43e-123	14	189	1	176
QYE98471.1	7.06e-107	1	189	1	189
CEK37012.1	2.87e-106	1	189	1	189
CEJ72538.1	2.87e-106	1	189	1	189
AUN15937.1	1.69e-101	9	189	2	182

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O1J_A	1.23e-14	37	181	420	564	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.23e-14	37	181	426	570	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.23e-14	37	181	430	574	Lytictransglycosylase in action [Neisseria meningitidis]
5MPQ_A	1.23e-14	37	181	416	560	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O29_A	1.24e-14	37	181	436	580	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	6.91e-14	34	185	477	634	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31608	1.77e-12	41	169	64	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P0AGC4	1.99e-12	34	180	477	625	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.99e-12	34	180	477	625	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
O31976	2.32e-12	37	173	1422	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.690067	0.292721	0.012663	0.000794	0.000568	0.003189

TMHMM  Annotations     

start	end
7	24