CAZyme Information: MGYG000000024_00553

Basic Information

• Species: Paraclostridium bifermentans
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Paraclostridium; Paraclostridium bifermentans
• CAZyme ID: MGYG000000024_00553
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		42899.68	6.5236

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000024	3641600	Isolate	United Kingdom	Europe

• Gene Location: Start: 559049; End: 560191 Strand: +

Full Sequence      

MRNTNYYIFKIPILTFLIILVFFIFSKIFTTDSITNKKNIKSNIDYKIVEKIDKMTLDEK
IGQMILSGFNGTCFNKELNTLINDFKVGGVILFSRNIEDSKQLKKLTSDIIDKNQDIPLF
ISIDEEGGRVSRLPKDIKKFESSKSIGDRGDEKYAYENGRGIGGILKKYNINMNFAPVLD
IYSNPKNTVIGDRAFGDNEKVVSSMGIATMKGLKDENVIPVIKHFPGHGDTEVDSHLGLP
IVEKNLKQLNELELIPFNKAIENGVGAIMVSHILIKEIDDKYPATLSYNLINNILRNDMK
FENIVITDDMLMKAITDYISIEEASVKSIKAGTDIILIGSDVNKTESVIERIKLAVANNE
ISEERIDKSVYRILKQKETL

Enzyme Prediction     

No EC number prediction in MGYG000000024_00553.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	114	337	5.1e-58	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	8.01e-93	55	378	1	313	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	4.39e-90	56	374	1	314	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	5.95e-53	87	372	26	308	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.50e-13	48	377	38	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEZ70395.1	9.66e-183	1	380	1	379
AUS98755.1	1.03e-118	32	378	54	395
CDI50326.1	2.47e-118	33	378	31	380
AIY82623.1	4.44e-118	16	377	5	364
QZY57561.1	1.71e-117	30	377	33	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	1.29e-80	55	378	11	338	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.32e-76	31	377	24	393	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
4GYJ_A	8.09e-76	31	377	28	397	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3LK6_A	1.60e-75	52	377	13	367	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4ZM6_A	6.40e-54	57	378	9	338	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	7.24e-76	31	377	24	393	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	1.35e-57	72	380	49	383	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q0AF74	5.84e-44	71	353	12	297	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
Q1H075	1.17e-43	71	353	12	297	Beta-hexosaminidase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) OX=265072 GN=nagZ PE=3 SV=1
Q31G32	1.47e-42	87	352	36	304	Beta-hexosaminidase OS=Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2) OX=317025 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.933784	0.061256	0.001000	0.000166	0.000147	0.003670

TMHMM  Annotations     

start	end
7	29