CAZyme Information: MGYG000000009_00969

Basic Information

• Species: Ligilactobacillus murinus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Ligilactobacillus; Ligilactobacillus murinus
• CAZyme ID: MGYG000000009_00969
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763	MGYG000000009_15|CGC2	81862.07	10.029

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000009	2219792	Isolate	United Kingdom	Europe

• Gene Location: Start: 31769; End: 34060 Strand: -

Full Sequence      

MKSRKERLENKKQQLLSENIKSVKKATTYIGTTVLMGTAGLVLSKVKAQADTVQIDQNTS
SNNNNENTSANSNNINDQNQVSTQTAQTQTQAQAASSSQEQSQVASASQAVPSSAAAPTV
NVSRTYPGNVQTFLNNIAGPAQQVAQQRGLYASLMIAQAALESGWGGSYLSTSAYNLFGV
KWSGSGAYIELPTQEFYNGSYHTIYDKFQRYSSYAESLNGYANVITTRFPKSTRANSANY
AIAAQNLRYGVYGTYATAPDYADKLIRVIQTYNLTAYDVGGTSVDTNQTPTNNNNNVDQT
QTSGNGTYTVKAGDSLYRIAKNHNISLQELKSLNNLNSDLIFAGQVLKVSGQVSSSQPST
NTNTSQNSNQTQTNGNGTYTLKAGDSLYRIAVNHNMSLQELKNLNNLSSNLIMPGQVLKV
SGQVSSSQPSTNTNTSQNSNQTQTNGNGTYTVKAGDSLYRIAVNHNMSLQELKNLNNLSS
NLIMPGQVLKVSGQVSSSQPSTNTNTSQNSNQTQTNGNGTYTVKAGDSLYRIAVNHNMSL
QELKNLNNLSSNLIMPGQVLKVSGQVSSSQPSTNTSQSSNQPQASGNGTYTVKAGDSLYR
IAVNHNMSLQELKNLNNLSSNLIMPGQVLKVSGQVSSSQSSTNTSQSSNQPQASVNGTYT
VKAGDSLWAIANSHKMTLNDLKRVNNLSSDLIYVGQTLKVTKGAVTTANKPNTQSNTNKT
YTVKAGDSLWRIASNNGTTVNQLKALNNLTSDMIYVGQNLKLK

Enzyme Prediction     

No EC number prediction in MGYG000000009_00969.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	141	274	6.9e-30	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	1.26e-92	130	562	150	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	1.50e-59	492	763	304	592	1,4-beta-N-acetylmuramoylhydrolase.
COG1705	FlgJ	8.77e-47	111	283	21	193	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	1.98e-28	125	277	3	144	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK05684	flgJ	5.22e-26	108	271	130	296	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWZ38490.1	0.0	1	763	1	761
AWZ40523.1	0.0	1	763	1	761
QIA89825.1	0.0	1	763	1	765
QHQ69680.1	0.0	1	763	1	761
QCQ03605.1	0.0	1	763	1	759

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	3.41e-18	131	278	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	1.07e-16	133	270	6	146	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.54e-16	133	270	6	146	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	4.43e-15	131	269	2	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	5.48e-15	131	269	3	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39046	4.71e-82	129	702	61	666	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
P37710	1.95e-75	105	700	163	736	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
O07532	1.98e-51	378	700	28	350	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
O31852	2.62e-44	520	758	28	264	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
A2RHZ5	2.42e-42	131	491	63	436	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.096502	0.897415	0.004461	0.000906	0.000371	0.000332

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000009_00969.