CAZyme Information: MGYG000000008_00191

Basic Information

• Species: Lactobacillus johnsonii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus johnsonii
• CAZyme ID: MGYG000000008_00191
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
233	MGYG000000008_1|CGC2	27155.04	9.0294

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000008	1971706	Isolate	United Kingdom	Europe

• Gene Location: Start: 196440; End: 197141 Strand: -

Full Sequence      

MIPKKIHYIWVGNNPKSSLIEECIATWKNKLPDYEIIEWNENNFNVHENKYIEQAYEAKK
WAFVSDYIRVRVIYEQGGIYLDTDVRVLKKLDPLLNNRAFIGFENNDYLSAAIFGAEMNH
PFMKDILNYYNNRDFTFDKNDQMAGVNSISVTDILKENYGLKIGNKEQILKDGVHVYSDG
LLCNPSKNSYSIHLFTGTWIDGKQSLKQRIVTDLKRKISSPKQAGIYQKLIRK

Enzyme Prediction     

No EC number prediction in MGYG000000008_00191.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	97	2.2e-25	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.22e-22	1	203	81	283	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	2.81e-12	23	95	7	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.91e-07	19	138	64	200	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB93795.1	3.57e-174	1	233	1	233
AZZ68068.1	3.57e-174	1	233	1	233
AOG26122.1	3.57e-174	1	233	1	233
QXL47328.1	3.57e-174	1	233	1	233
AHA97816.1	1.46e-173	1	233	1	233

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10323	4.82e-10	2	127	57	185	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
P38287	1.62e-06	1	127	61	190	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
O14084	1.94e-06	2	136	64	208	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
Q5ZU30	8.73e-06	2	85	28	137	Subversion of eukaryotic traffic protein A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=setA PE=1 SV=1
P33300	9.63e-06	1	122	54	178	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000008_00191.