# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM47/fasta_for_each_cluster/cluster_30.txt # target HMM database: merged_hmms/CBM47.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM47/CBM47_cluster_30.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: QDO27386.1|CBM13|CBM47|GH141 [L=896] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-17 49.0 0.0 9e-17 47.4 0.0 1.8 1 CBM47.hmm Domain annotation for each model (and alignments): >> CBM47.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.4 0.0 9e-17 9e-17 3 115 .. 619 727 .. 616 734 .. 0.82 Alignments for each domain: == domain 1 score: 47.4 bits; conditional E-value: 9e-17 CBM47.hmm 3 qssty.eegaaaravDgnkdgnfnsgscshTkeesnpWWqvDLgkeykvdkvvItnrtdcc.kerlsnaeIrvgnsnenng 81 +ss+ + aa+avD + + + s T+++s++WWqvDLg+ y++ + +t r+d +e ++eIr +n+++ + QDO27386.1|CBM13|CBM47|GH141 619 SSSVFgSGWSAANAVDNDSS-----TGWSPTASDSSAWWQVDLGQAYQLGQFSLTTRQDLDqSETRGKFEIRASNDPSFGT 694 5566677789******9974.....578*******************************995666678*********9965 PP CBM47.hmm 82 klnplcgtitdgaegetltvkckkgmegRYVrvq 115 ++ ++t t + +tlt +++ + + RYVrv QDO27386.1|CBM13|CBM47|GH141 695 YTVLGRQTDT-LPLASTLTGNVDVRQKFRYVRVA 727 5444444433.77888888888779*******97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (896 residues searched) Target model(s): 1 (128 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.97 // Query: QDO17263.1|CBM13|CBM47|GH141 [L=896] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-17 49.0 0.0 9e-17 47.4 0.0 1.8 1 CBM47.hmm Domain annotation for each model (and alignments): >> CBM47.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.4 0.0 9e-17 9e-17 3 115 .. 619 727 .. 616 734 .. 0.82 Alignments for each domain: == domain 1 score: 47.4 bits; conditional E-value: 9e-17 CBM47.hmm 3 qssty.eegaaaravDgnkdgnfnsgscshTkeesnpWWqvDLgkeykvdkvvItnrtdcc.kerlsnaeIrvgnsnenng 81 +ss+ + aa+avD + + + s T+++s++WWqvDLg+ y++ + +t r+d +e ++eIr +n+++ + QDO17263.1|CBM13|CBM47|GH141 619 SSSVFgSGWSAANAVDNDSS-----TGWSPTASDSSAWWQVDLGQAYQLGQFSLTTRQDLDqSETRGKFEIRASNDPSFGT 694 5566677789******9974.....578*******************************995666678*********9965 PP CBM47.hmm 82 klnplcgtitdgaegetltvkckkgmegRYVrvq 115 ++ ++t t + +tlt +++ + + RYVrv QDO17263.1|CBM13|CBM47|GH141 695 YTVLGRQTDT-LPLASTLTGNVDVRQKFRYVRVA 727 5444444433.77888888888779*******97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (896 residues searched) Target model(s): 1 (128 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 127.20 // Query: QDO05834.1|CBM13|CBM47|GH141 [L=896] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-17 49.0 0.0 9e-17 47.4 0.0 1.8 1 CBM47.hmm Domain annotation for each model (and alignments): >> CBM47.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.4 0.0 9e-17 9e-17 3 115 .. 619 727 .. 616 734 .. 0.82 Alignments for each domain: == domain 1 score: 47.4 bits; conditional E-value: 9e-17 CBM47.hmm 3 qssty.eegaaaravDgnkdgnfnsgscshTkeesnpWWqvDLgkeykvdkvvItnrtdcc.kerlsnaeIrvgnsnenng 81 +ss+ + aa+avD + + + s T+++s++WWqvDLg+ y++ + +t r+d +e ++eIr +n+++ + QDO05834.1|CBM13|CBM47|GH141 619 SSSVFgSGWSAANAVDNDSS-----TGWSPTASDSSAWWQVDLGQAYQLGQFSLTTRQDLDqSETRGKFEIRASNDPSFGT 694 5566677789******9974.....578*******************************995666678*********9965 PP CBM47.hmm 82 klnplcgtitdgaegetltvkckkgmegRYVrvq 115 ++ ++t t + +tlt +++ + + RYVrv QDO05834.1|CBM13|CBM47|GH141 695 YTVLGRQTDT-LPLASTLTGNVDVRQKFRYVRVA 727 5444444433.77888888888779*******97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (896 residues searched) Target model(s): 1 (128 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 128.44 // Query: QDN84965.1|CBM13|CBM47|GH141 [L=896] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-17 49.0 0.0 9e-17 47.4 0.0 1.8 1 CBM47.hmm Domain annotation for each model (and alignments): >> CBM47.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.4 0.0 9e-17 9e-17 3 115 .. 619 727 .. 616 734 .. 0.82 Alignments for each domain: == domain 1 score: 47.4 bits; conditional E-value: 9e-17 CBM47.hmm 3 qssty.eegaaaravDgnkdgnfnsgscshTkeesnpWWqvDLgkeykvdkvvItnrtdcc.kerlsnaeIrvgnsnenng 81 +ss+ + aa+avD + + + s T+++s++WWqvDLg+ y++ + +t r+d +e ++eIr +n+++ + QDN84965.1|CBM13|CBM47|GH141 619 SSSVFgSGWSAANAVDNDSS-----TGWSPTASDSSAWWQVDLGQAYQLGQFSLTTRQDLDqSETRGKFEIRASNDPSFGT 694 5566677789******9974.....578*******************************995666678*********9965 PP CBM47.hmm 82 klnplcgtitdgaegetltvkckkgmegRYVrvq 115 ++ ++t t + +tlt +++ + + RYVrv QDN84965.1|CBM13|CBM47|GH141 695 YTVLGRQTDT-LPLASTLTGNVDVRQKFRYVRVA 727 5444444433.77888888888779*******97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (896 residues searched) Target model(s): 1 (128 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 128.68 // Query: QDN95541.1|CBM13|CBM47|GH141 [L=896] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-17 49.0 0.0 9e-17 47.4 0.0 1.8 1 CBM47.hmm Domain annotation for each model (and alignments): >> CBM47.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.4 0.0 9e-17 9e-17 3 115 .. 619 727 .. 616 734 .. 0.82 Alignments for each domain: == domain 1 score: 47.4 bits; conditional E-value: 9e-17 CBM47.hmm 3 qssty.eegaaaravDgnkdgnfnsgscshTkeesnpWWqvDLgkeykvdkvvItnrtdcc.kerlsnaeIrvgnsnenng 81 +ss+ + aa+avD + + + s T+++s++WWqvDLg+ y++ + +t r+d +e ++eIr +n+++ + QDN95541.1|CBM13|CBM47|GH141 619 SSSVFgSGWSAANAVDNDSS-----TGWSPTASDSSAWWQVDLGQAYQLGQFSLTTRQDLDqSETRGKFEIRASNDPSFGT 694 5566677789******9974.....578*******************************995666678*********9965 PP CBM47.hmm 82 klnplcgtitdgaegetltvkckkgmegRYVrvq 115 ++ ++t t + +tlt +++ + + RYVrv QDN95541.1|CBM13|CBM47|GH141 695 YTVLGRQTDT-LPLASTLTGNVDVRQKFRYVRVA 727 5444444433.77888888888779*******97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (896 residues searched) Target model(s): 1 (128 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 132.63 // Query: AZP23719.1|CBM13|CBM47|GH141 [L=896] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-16 47.2 0.0 3.1e-16 45.7 0.0 1.8 1 CBM47.hmm Domain annotation for each model (and alignments): >> CBM47.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 45.7 0.0 3.1e-16 3.1e-16 3 115 .. 619 727 .. 617 736 .. 0.81 Alignments for each domain: == domain 1 score: 45.7 bits; conditional E-value: 3.1e-16 CBM47.hmm 3 qssty.eegaaaravDgnkdgnfnsgscshTkeesnpWWqvDLgkeykvdkvvItnrtdcc.kerlsnaeIrvgnsnenng 81 ss+y + +aa+a+D n + + s T ++s++WWqvDLg+ +++ + +t r+d +e ++e+r +n+++ + AZP23719.1|CBM13|CBM47|GH141 619 ASSVYgSGTPAANANDNNGS-----TGWSPTGNDSSAWWQVDLGQAHQLGQFSLTTRQDLDqSETRGHFEVRASNDPSFAT 694 67888777899999999963.....678*******************************995666667*********9975 PP CBM47.hmm 82 klnplcgtitdgaegetltvkckkgmegRYVrvq 115 ++ ++t + + tlt +++ + + RYVrv AZP23719.1|CBM13|CBM47|GH141 695 YTVIGRQTDN-LPLAATLTGDIDVRQKFRYVRVA 727 5444444443.77777888888669*******97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (896 residues searched) Target model(s): 1 (128 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 122.51 // Query: QDN75355.1|CBM13|CBM47|GH141 [L=896] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-17 48.7 0.0 1.2e-16 47.0 0.0 1.8 1 CBM47.hmm Domain annotation for each model (and alignments): >> CBM47.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.0 0.0 1.2e-16 1.2e-16 2 115 .. 618 727 .. 617 733 .. 0.83 Alignments for each domain: == domain 1 score: 47.0 bits; conditional E-value: 1.2e-16 CBM47.hmm 2 tqssty.eegaaaravDgnkdgnfnsgscshTkeesnpWWqvDLgkeykvdkvvItnrtdcc.kerlsnaeIrvgnsnenn 80 ++ss+y + aa+avD + + + s T+++ ++WWqvDLg+ y++ + +t r+d +e ++eIr +n+++ QDN75355.1|CBM13|CBM47|GH141 618 SSSSVYgSGWSAANAVDNDSS-----TGWSPTASDFSAWWQVDLGQAYQLGQFSLTTRQDLDqSETRGKFEIRASNDPSFG 693 6788998889********974.....578*******************************995666678*********996 PP CBM47.hmm 81 gklnplcgtitdgaegetltvkckkgmegRYVrvq 115 +++ ++t t + +tlt +++ + + RYVrv QDN75355.1|CBM13|CBM47|GH141 694 TYTVLGRQTDT-LPLASTLTGNVDVRQKFRYVRVA 727 55444444433.77888888888779*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (896 residues searched) Target model(s): 1 (128 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 145.50 // Query: XDQ67222.1|CBM13|CBM47|GH141 [L=896] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-17 50.0 0.9 2.6e-17 49.2 0.0 1.9 2 CBM47.hmm Domain annotation for each model (and alignments): >> CBM47.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.0 0.4 0.73 0.73 17 35 .. 568 586 .. 559 588 .. 0.65 2 ! 49.2 0.0 2.6e-17 2.6e-17 2 115 .. 618 727 .. 617 734 .. 0.85 Alignments for each domain: == domain 1 score: -4.0 bits; conditional E-value: 0.73 CBM47.hmm 17 DgnkdgnfnsgscshTkee 35 Dg ++n n ++++ T++ XDQ67222.1|CBM13|CBM47|GH141 568 DGFINQNRNGSNVTLTNNT 586 4444444444888888875 PP == domain 2 score: 49.2 bits; conditional E-value: 2.6e-17 CBM47.hmm 2 tqssty.eegaaaravDgnkdgnfnsgscshTkeesnpWWqvDLgkeykvdkvvItnrtdcc.kerlsnaeIrvgnsnenn 80 ++ss+y + +a++avD + + + s T ++s++WWqvDLg+ y++ + +t r+d +e n+e+r +n+++ XDQ67222.1|CBM13|CBM47|GH141 618 SSSSVYgSFTPASNAVDNDSS-----TGWSPTGSDSSAWWQVDLGQAYQLGQFSLTTRQDLDqSETRGNFEVRASNDPSFG 693 6789998889********974.....578*******************************986777789*********997 PP CBM47.hmm 81 gklnplcgtitdgaegetltvkckkgmegRYVrvq 115 +++ ++t t + tlt +++ + + RYVrv XDQ67222.1|CBM13|CBM47|GH141 694 SYTVLGRQTDT-LPLAATLTSNVDIRQKFRYVRVA 727 66555555555.77777888888669*******97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (896 residues searched) Target model(s): 1 (128 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 132.05 // Query: BBC38774.1|CBM13|CBM47|GH141 [L=1035] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-15 42.9 0.0 7.3e-15 41.2 0.0 1.9 1 CBM47.hmm Domain annotation for each model (and alignments): >> CBM47.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 41.2 0.0 7.3e-15 7.3e-15 4 115 .. 758 866 .. 755 873 .. 0.88 Alignments for each domain: == domain 1 score: 41.2 bits; conditional E-value: 7.3e-15 CBM47.hmm 4 ssty.eegaaaravDgnkdgnfnsgscshTkeesnpWWqvDLgkeykvdkvvItnrtdcc.kerlsnaeIrvgnsnenngk 82 ss+ + a+ +a+D + ++ s T +++++WWqvDL + y++ + t r+d +e sn+eIr +n+++ ++ BBC38774.1|CBM13|CBM47|GH141 758 SSVFnSGWAPPKANDNDPAT-----GWSPTGSDTSAWWQVDLDSAYQLGQFSFTTRQDIDqPETRSNFEIRGSNDPSFADY 833 55555556777888888765.....6799*****************************9879999*************999 PP CBM47.hmm 83 lnplcgtitdgaegetltvkckkgmegRYVrvq 115 + +++ + + ++tlt k++ + + RYVrv BBC38774.1|CBM13|CBM47|GH141 834 TVLGRQDAATLPYTSTLTAKIDARQKFRYVRVA 866 999999999999*********99********97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1035 residues searched) Target model(s): 1 (128 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 149.38 // Query: WOX07471.1|CBM13|CBM47|GH141 [L=894] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-16 47.1 0.0 3.4e-16 45.5 0.0 1.8 1 CBM47.hmm Domain annotation for each model (and alignments): >> CBM47.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 45.5 0.0 3.4e-16 3.4e-16 2 115 .. 615 725 .. 614 730 .. 0.93 Alignments for each domain: == domain 1 score: 45.5 bits; conditional E-value: 3.4e-16 CBM47.hmm 2 tqssty.eegaaaravDgnkdgnfnsgscshTkeesnpWWqvDLgkeykvdkvvItnrtdcc.kerlsnaeIrvgnsnenn 80 t ss+y ++ a+a+a+D + ++ s T +++++WWqvDLg+ y + + t r+d +e sn+eIr +n+++ WOX07471.1|CBM13|CBM47|GH141 615 TASSVYgSNWAPAKANDNDPAT-----GWSPTGSDTSAWWQVDLGSAYALGQFSFTTRQDIDqPETRSNFEIRGSNDPTFA 690 6799999999*********976.....7799*****************************9879999************** PP CBM47.hmm 81 gklnplcgtitdgaegetltvkckkgmegRYVrvq 115 +++ +++ t + + tlt k++ + + RY+rv WOX07471.1|CBM13|CBM47|GH141 691 DYTVLGRQDATVLPYNATLTAKIDARQKFRYIRVA 725 9999999999999999*******99********96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (894 residues searched) Target model(s): 1 (128 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 133.63 // Query: WSD83706.1|CBM13|CBM47|GH141 [L=896] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-18 51.5 0.0 1.7e-17 49.7 0.0 1.9 1 CBM47.hmm Domain annotation for each model (and alignments): >> CBM47.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.7 0.0 1.7e-17 1.7e-17 2 115 .. 618 727 .. 617 735 .. 0.84 Alignments for each domain: == domain 1 score: 49.7 bits; conditional E-value: 1.7e-17 CBM47.hmm 2 tqssty.eegaaaravDgnkdgnfnsgscshTkeesnpWWqvDLgkeykvdkvvItnrtdcc.kerlsnaeIrvgnsnenn 80 ++ss+y + +aa+avD n + + s T ++s++WWqvDLg+ y++ + +t r++ +e n+eIr +n+++ WSD83706.1|CBM13|CBM47|GH141 618 SSSSVYdSGTPAANAVDNNNS-----TGWSPTGSDSSAWWQVDLGQAYQLGQFSLTTRQNLDqSETRGNFEIRASNDPSFG 693 67889988899********74.....688*****************************88875777889*********998 PP CBM47.hmm 81 gklnplcgtitdgaegetltvkckkgmegRYVrvq 115 +++ +++ t + tlt +++ + + RYVrv WSD83706.1|CBM13|CBM47|GH141 694 SYTVLGRQRDT-LPLAATLTSNVDVRQQFRYVRVA 727 77666666665.556667777775599******97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (896 residues searched) Target model(s): 1 (128 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 136.45 // Query: XDQ24397.1|CBM13|CBM47|GH141 [L=896] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-16 47.1 0.8 2.2e-16 46.1 0.0 1.9 2 CBM47.hmm Domain annotation for each model (and alignments): >> CBM47.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.7 0.4 0.57 0.57 17 35 .. 568 586 .. 561 588 .. 0.68 2 ! 46.1 0.0 2.2e-16 2.2e-16 3 115 .. 619 727 .. 617 733 .. 0.83 Alignments for each domain: == domain 1 score: -3.7 bits; conditional E-value: 0.57 CBM47.hmm 17 DgnkdgnfnsgscshTkee 35 Dg ++n n +s++ T++ XDQ24397.1|CBM13|CBM47|GH141 568 DGFINQNRNGSSVTLTNNT 586 4444555555999999875 PP == domain 2 score: 46.1 bits; conditional E-value: 2.2e-16 CBM47.hmm 3 qssty.eegaaaravDgnkdgnfnsgscshTkeesnpWWqvDLgkeykvdkvvItnrtdcc.kerlsnaeIrvgnsnenng 81 +ss+ + a +avD + s+ s T +++++WWqvDLg++y++ + +t r+d +e ++e+r +n+++ + XDQ24397.1|CBM13|CBM47|GH141 619 SSSVFgSGWSAGNAVDNDG-----STGWSPTGSDASAWWQVDLGQTYQLGQLSLTTRQDLDqSETRGKFEVRASNDPSFGT 694 5566666788999999995.....35789******************************995666678*********9987 PP CBM47.hmm 82 klnplcgtitdgaegetltvkckkgmegRYVrvq 115 ++ ++t t + +tlt +++ + + RYVrv XDQ24397.1|CBM13|CBM47|GH141 695 YTVLGRQTET-LPLASTLTGNVDVRQKFRYVRVA 727 7777777776.67777888888669*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (896 residues searched) Target model(s): 1 (128 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 137.60 // Query: WBO61979.1|CBM13|CBM47|GH141 [L=896] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-17 49.2 0.0 8.1e-17 47.5 0.0 1.9 1 CBM47.hmm Domain annotation for each model (and alignments): >> CBM47.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.5 0.0 8.1e-17 8.1e-17 3 115 .. 619 727 .. 617 734 .. 0.85 Alignments for each domain: == domain 1 score: 47.5 bits; conditional E-value: 8.1e-17 CBM47.hmm 3 qssty.eegaaaravDgnkdgnfnsgscshTkeesnpWWqvDLgkeykvdkvvItnrtdcc.kerlsnaeIrvgnsnenng 81 ss++ ++ +aa+a+D n ++ s T +++++WWqvDLg+ y++ + +t r+d +e n+eIr +n+++ + WBO61979.1|CBM13|CBM47|GH141 619 ASSVNgSSWDAAKANDNNSAT-----GWSPTGSDTSAWWQVDLGQAYQLGQFSLTARQDLDqPETRGNFEIRASNDPSFGT 694 5666678899********865.....789******************************98688889**********9987 PP CBM47.hmm 82 klnplcgtitdgaegetltvkckkgmegRYVrvq 115 ++ + ++t t + +tlt +++ + + RYVrv WBO61979.1|CBM13|CBM47|GH141 695 YTVVGRQTST-LPLASTLTGNIDVRQKFRYVRVA 727 7777777777.66667777777669*******97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (896 residues searched) Target model(s): 1 (128 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 148.63 // Query: WYV87996.1|CBM13|CBM47|GH141 [L=896] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-17 50.1 1.1 2.3e-17 49.3 0.0 2.0 2 CBM47.hmm Domain annotation for each model (and alignments): >> CBM47.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.6 0.3 0.53 0.53 17 35 .. 568 586 .. 562 588 .. 0.81 2 ! 49.3 0.0 2.3e-17 2.3e-17 2 115 .. 618 727 .. 617 735 .. 0.86 Alignments for each domain: == domain 1 score: -3.6 bits; conditional E-value: 0.53 CBM47.hmm 17 DgnkdgnfnsgscshTkee 35 Dg +++n n ++++ T++ WYV87996.1|CBM13|CBM47|GH141 568 DGLVNQNGNGSNVTLTNNT 586 8888888888999999985 PP == domain 2 score: 49.3 bits; conditional E-value: 2.3e-17 CBM47.hmm 2 tqssty.eegaaaravDgnkdgnfnsgscshTkeesnpWWqvDLgkeykvdkvvItnrtdcc.kerlsnaeIrvgnsnenn 80 t+ss+y + +a++avD n + + s T ++s++WWqvDLg+ y++ + +t r+d +e n+e+r +n+++ WYV87996.1|CBM13|CBM47|GH141 618 TSSSVYgTGTEASKAVDNNGS-----TGWSPTGSDSSAWWQVDLGQAYQLGQFSLTTRQDLDqSETRGNFEVRASNDPSFA 693 7899999889*********64.....578*******************************986777789**********99 PP CBM47.hmm 81 gklnplcgtitdgaegetltvkckkgmegRYVrvq 115 +++ + ++t t + tlt +++ + + RYVrv WYV87996.1|CBM13|CBM47|GH141 694 TYTVVGRQTST-LPLAGTLTGDIDVRQTFRYVRVA 727 88777777777.5666677777765999*****97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (896 residues searched) Target model(s): 1 (128 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 138.12 // [ok]