# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM43/fasta_for_each_cluster/cluster_71.txt # target HMM database: merged_hmms/CBM43.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM43/CBM43_cluster_71.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: XLU57390.1|CBM43 [L=231] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-31 94.2 7.3 4.4e-31 93.7 7.3 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.7 7.3 4.4e-31 4.4e-31 2 82 .. 24 106 .. 23 107 .. 0.93 Alignments for each domain: == domain 1 score: 93.7 bits; conditional E-value: 4.4e-31 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdps..tgsC 82 Cv+kd+v +++lq+a+dyaCg+gadCt+i ++g+cy+pnt+k+h++ya+nsY+qk+++++++CdF+gaAt++ t p ++sC XLU57390.1|CBM43 24 CVCKDGVGDQALQKAIDYACGAGADCTPILQNGPCYQPNTIKDHCNYAVNSYFQKKGQAQGSCDFSGAATTSPTAPPtsSSSC 106 **********************************************************************9988765114566 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (231 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 36.24 // Query: XLT94147.1|CBM43 [L=230] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-31 94.2 7.3 4.4e-31 93.7 7.3 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.7 7.3 4.4e-31 4.4e-31 2 82 .. 23 105 .. 22 106 .. 0.93 Alignments for each domain: == domain 1 score: 93.7 bits; conditional E-value: 4.4e-31 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdps..tgsC 82 Cv+kd+v +++lq+a+dyaCg+gadCt+i ++g+cy+pnt+k+h++ya+nsY+qk+++++++CdF+gaAt++ t p ++sC XLT94147.1|CBM43 23 CVCKDGVGDQALQKAIDYACGAGADCTPILQNGPCYQPNTIKDHCNYAVNSYFQKKGQAQGSCDFSGAATTSPTAPPtsSSSC 105 **********************************************************************9988765114566 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (230 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 37.87 // Query: WCJ22123.1|CBM43 [L=207] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-30 91.1 4.7 4.2e-30 90.5 4.7 1.4 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.5 4.7 4.2e-30 4.2e-30 2 78 .. 23 99 .. 22 117 .. 0.95 Alignments for each domain: == domain 1 score: 90.5 bits; conditional E-value: 4.2e-30 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdps 78 C++kdsv +++lq+a+dyaCg+gadCt+i ++g+c++pnt+k+h+sya+nsY+q++++ ++CdF+++A+++++ p+ WCJ22123.1|CBM43 23 CICKDSVGDQQLQKAIDYACGAGADCTPILQNGACFQPNTIKDHCSYAVNSYFQRKGQGVGTCDFSQTAVTSNAPPA 99 **********************************************************************9998775 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (207 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 46.39 // Query: XLT44082.1|CBM43 [L=205] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-31 93.0 6.9 1.1e-30 92.4 6.9 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.4 6.9 1.1e-30 1.1e-30 1 82 [. 23 103 .. 23 104 .. 0.97 Alignments for each domain: == domain 1 score: 92.4 bits; conditional E-value: 1.1e-30 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsC 82 wCv+kd+ s++ lq++ldyaCg+gadC+++++gg+c++pnt++ah++ya+nsY+qk++++++aC+F+g+At++++dps++ C XLT44082.1|CBM43 23 WCVCKDG-SDAMLQKTLDYACGAGADCNPLHQGGPCFQPNTVRAHCNYAVNSYFQKKGQAQGACEFAGTATTVTSDPSASGC 103 9****87.6789********************************************************************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (205 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 53.77 // Query: XLT52965.1|CBM43 [L=199] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-31 92.7 10.6 1.3e-30 92.2 10.6 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.2 10.6 1.3e-30 1.3e-30 2 81 .. 22 101 .. 21 104 .. 0.96 Alignments for each domain: == domain 1 score: 92.2 bits; conditional E-value: 1.3e-30 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgs 81 C++kd+v +++lq+a+dyaCg+gadC+ai ++g+cy+pnt+k+h++ya+nsYyq++++++++CdF+gaA+++++ pst+s XLT52965.1|CBM43 22 CLCKDGVGDQALQKAIDYACGNGADCSAILQNGACYQPNTVKDHCNYAVNSYYQRKGNAQDSCDFSGAASTSQNPPSTSS 101 **************************************************************************999763 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (199 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 55.19 // Query: XLS58233.1|CBM43 [L=230] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-31 94.2 7.3 4.4e-31 93.7 7.3 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.7 7.3 4.4e-31 4.4e-31 2 82 .. 23 105 .. 22 106 .. 0.93 Alignments for each domain: == domain 1 score: 93.7 bits; conditional E-value: 4.4e-31 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdps..tgsC 82 Cv+kd+v +++lq+a+dyaCg+gadCt+i ++g+cy+pnt+k+h++ya+nsY+qk+++++++CdF+gaAt++ t p ++sC XLS58233.1|CBM43 23 CVCKDGVGDQALQKAIDYACGAGADCTPILQNGPCYQPNTIKDHCNYAVNSYFQKKGQAQGSCDFSGAATTSPTAPPtsSSSC 105 **********************************************************************9988765114566 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (230 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 65.08 // Query: XLS53122.1|CBM43 [L=199] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-31 92.7 10.6 1.3e-30 92.2 10.6 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.2 10.6 1.3e-30 1.3e-30 2 81 .. 22 101 .. 21 104 .. 0.96 Alignments for each domain: == domain 1 score: 92.2 bits; conditional E-value: 1.3e-30 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgs 81 C++kd+v +++lq+a+dyaCg+gadC+ai ++g+cy+pnt+k+h++ya+nsYyq++++++++CdF+gaA+++++ pst+s XLS53122.1|CBM43 22 CLCKDGVGDQALQKAIDYACGNGADCSAILQNGACYQPNTVKDHCNYAVNSYYQRKGNAQDSCDFSGAASTSQNPPSTSS 101 **************************************************************************999763 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (199 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 58.23 // Query: XLR52483.1|CBM43 [L=209] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-31 92.9 6.9 1.1e-30 92.4 6.9 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.4 6.9 1.1e-30 1.1e-30 1 82 [. 23 103 .. 23 104 .. 0.97 Alignments for each domain: == domain 1 score: 92.4 bits; conditional E-value: 1.1e-30 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsC 82 wCv+kd+ s++ lq++ldyaCg+gadC+++++gg+c++pnt++ah++ya+nsY+qk++++++aC+F+g+At++++dps++ C XLR52483.1|CBM43 23 WCVCKDG-SDAMLQKTLDYACGAGADCNPLHQGGPCFQPNTVRAHCNYAVNSYFQKKGQAQGACEFAGTATTVTSDPSASGC 103 9****87.6789********************************************************************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (209 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 59.18 // Query: WZY98179.1|CBM43 [L=186] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-34 102.8 4.4 9.8e-34 102.2 4.4 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 102.2 4.4 9.8e-34 9.8e-34 1 82 [. 22 103 .. 22 104 .. 0.99 Alignments for each domain: == domain 1 score: 102.2 bits; conditional E-value: 9.8e-34 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsC 82 wCv+++++se+ lq++ldyaCg+gadC +i+++g+c++pnt+k+h+sya+ns++qk+++++++CdF+g+At++++dps++sC WZY98179.1|CBM43 22 WCVCREGLSEAMLQKTLDYACGAGADCGPIHQNGPCFNPNTVKSHCSYAVNSFFQKKGQSPGTCDFAGTATVSASDPSYTSC 103 9********************************************************************************* PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (186 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 52.39 // Query: XLR08162.1|CBM43 [L=205] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-31 93.0 6.9 1.1e-30 92.4 6.9 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.4 6.9 1.1e-30 1.1e-30 1 82 [. 23 103 .. 23 104 .. 0.97 Alignments for each domain: == domain 1 score: 92.4 bits; conditional E-value: 1.1e-30 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsC 82 wCv+kd+ s++ lq++ldyaCg+gadC+++++gg+c++pnt++ah++ya+nsY+qk++++++aC+F+g+At++++dps++ C XLR08162.1|CBM43 23 WCVCKDG-SDAMLQKTLDYACGAGADCNPLHQGGPCFQPNTVRAHCNYAVNSYFQKKGQAQGACEFAGTATTVTSDPSASGC 103 9****87.6789********************************************************************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (205 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 57.83 // Query: XLU42842.1|CBM43 [L=205] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-31 93.0 6.9 1.1e-30 92.4 6.9 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.4 6.9 1.1e-30 1.1e-30 1 82 [. 23 103 .. 23 104 .. 0.97 Alignments for each domain: == domain 1 score: 92.4 bits; conditional E-value: 1.1e-30 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsC 82 wCv+kd+ s++ lq++ldyaCg+gadC+++++gg+c++pnt++ah++ya+nsY+qk++++++aC+F+g+At++++dps++ C XLU42842.1|CBM43 23 WCVCKDG-SDAMLQKTLDYACGAGADCNPLHQGGPCFQPNTVRAHCNYAVNSYFQKKGQAQGACEFAGTATTVTSDPSASGC 103 9****87.6789********************************************************************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (205 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 59.11 // Query: XLT58902.1|CBM43 [L=230] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-31 94.2 7.3 4.4e-31 93.7 7.3 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.7 7.3 4.4e-31 4.4e-31 2 82 .. 23 105 .. 22 106 .. 0.93 Alignments for each domain: == domain 1 score: 93.7 bits; conditional E-value: 4.4e-31 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdps..tgsC 82 Cv+kd+v +++lq+a+dyaCg+gadCt+i ++g+cy+pnt+k+h++ya+nsY+qk+++++++CdF+gaAt++ t p ++sC XLT58902.1|CBM43 23 CVCKDGVGDQALQKAIDYACGAGADCTPILQNGPCYQPNTIKDHCNYAVNSYFQKKGQAQGSCDFSGAATTSPTAPPtsSSSC 105 **********************************************************************9988765114566 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (230 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.73 // Query: XLS93629.1|CBM43 [L=231] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-31 94.2 7.3 4.4e-31 93.7 7.3 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.7 7.3 4.4e-31 4.4e-31 2 82 .. 24 106 .. 23 107 .. 0.93 Alignments for each domain: == domain 1 score: 93.7 bits; conditional E-value: 4.4e-31 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdps..tgsC 82 Cv+kd+v +++lq+a+dyaCg+gadCt+i ++g+cy+pnt+k+h++ya+nsY+qk+++++++CdF+gaAt++ t p ++sC XLS93629.1|CBM43 24 CVCKDGVGDQALQKAIDYACGAGADCTPILQNGPCYQPNTIKDHCNYAVNSYFQKKGQAQGSCDFSGAATTSPTAPPtsSSSC 106 **********************************************************************9988765114566 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (231 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.01 // Query: WZZ10959.1|CBM43 [L=185] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-33 100.4 6.8 4.7e-33 100.0 6.8 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.0 6.8 4.7e-33 4.7e-33 1 82 [. 21 102 .. 21 103 .. 0.99 Alignments for each domain: == domain 1 score: 100.0 bits; conditional E-value: 4.7e-33 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsC 82 wCv+++++se+ lq++ldyaCg+gadC +i+++g+c++pnt+k+h+sya+ns++qk+++++++CdF+g+At++++dps+++C WZZ10959.1|CBM43 21 WCVCREGLSEAMLQKTLDYACGAGADCGPIHQNGPCFNPNTVKSHCSYAVNSFFQKKRQSQGTCDFAGTATVSASDPSYTTC 102 9********************************************************************************* PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (185 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 56.03 // Query: XLS78908.1|CBM43 [L=205] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-31 93.0 6.9 1.1e-30 92.4 6.9 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.4 6.9 1.1e-30 1.1e-30 1 82 [. 23 103 .. 23 104 .. 0.97 Alignments for each domain: == domain 1 score: 92.4 bits; conditional E-value: 1.1e-30 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsC 82 wCv+kd+ s++ lq++ldyaCg+gadC+++++gg+c++pnt++ah++ya+nsY+qk++++++aC+F+g+At++++dps++ C XLS78908.1|CBM43 23 WCVCKDG-SDAMLQKTLDYACGAGADCNPLHQGGPCFQPNTVRAHCNYAVNSYFQKKGQAQGACEFAGTATTVTSDPSASGC 103 9****87.6789********************************************************************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (205 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 57.32 // Query: WCJ35848.1|CBM43 [L=209] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-31 92.8 4.8 1.3e-30 92.2 4.8 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.2 4.8 1.3e-30 1.3e-30 1 83 [] 24 105 .. 24 105 .. 0.98 Alignments for each domain: == domain 1 score: 92.2 bits; conditional E-value: 1.3e-30 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsCk 83 wCv+k+ + e++lq++ldyaCg+gadC +i+++g+c++pn+++ah+sya+ns++qk+++++++CdF+g+A+ +++dps+++C+ WCJ35848.1|CBM43 24 WCVCKE-LPEATLQKTLDYACGAGADCGPIHSNGPCFQPNNVRAHCSYAVNSFFQKKGQSQGSCDFAGTAVPSTSDPSRATCS 105 9***95.8999***********************************************************************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (209 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 58.71 // Query: XLR23309.1|CBM43 [L=231] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-31 94.2 7.3 4.4e-31 93.7 7.3 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.7 7.3 4.4e-31 4.4e-31 2 82 .. 24 106 .. 23 107 .. 0.93 Alignments for each domain: == domain 1 score: 93.7 bits; conditional E-value: 4.4e-31 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdps..tgsC 82 Cv+kd+v +++lq+a+dyaCg+gadCt+i ++g+cy+pnt+k+h++ya+nsY+qk+++++++CdF+gaAt++ t p ++sC XLR23309.1|CBM43 24 CVCKDGVGDQALQKAIDYACGAGADCTPILQNGPCYQPNTIKDHCNYAVNSYFQKKGQAQGSCDFSGAATTSPTAPPtsSSSC 106 **********************************************************************9988765114566 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (231 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.41 // Query: XLR65480.1|CBM43 [L=231] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-31 94.2 7.3 4.4e-31 93.7 7.3 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.7 7.3 4.4e-31 4.4e-31 2 82 .. 24 106 .. 23 107 .. 0.93 Alignments for each domain: == domain 1 score: 93.7 bits; conditional E-value: 4.4e-31 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdps..tgsC 82 Cv+kd+v +++lq+a+dyaCg+gadCt+i ++g+cy+pnt+k+h++ya+nsY+qk+++++++CdF+gaAt++ t p ++sC XLR65480.1|CBM43 24 CVCKDGVGDQALQKAIDYACGAGADCTPILQNGPCYQPNTIKDHCNYAVNSYFQKKGQAQGSCDFSGAATTSPTAPPtsSSSC 106 **********************************************************************9988765114566 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (231 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.40 // Query: XLR59436.1|CBM43 [L=199] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-31 92.7 10.6 1.3e-30 92.2 10.6 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.2 10.6 1.3e-30 1.3e-30 2 81 .. 22 101 .. 21 104 .. 0.96 Alignments for each domain: == domain 1 score: 92.2 bits; conditional E-value: 1.3e-30 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgs 81 C++kd+v +++lq+a+dyaCg+gadC+ai ++g+cy+pnt+k+h++ya+nsYyq++++++++CdF+gaA+++++ pst+s XLR59436.1|CBM43 22 CLCKDGVGDQALQKAIDYACGNGADCSAILQNGACYQPNTVKDHCNYAVNSYYQRKGNAQDSCDFSGAASTSQNPPSTSS 101 **************************************************************************999763 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (199 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 58.43 // Query: XLS46338.1|CBM43 [L=209] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-31 92.9 6.9 1.1e-30 92.4 6.9 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.4 6.9 1.1e-30 1.1e-30 1 82 [. 23 103 .. 23 104 .. 0.97 Alignments for each domain: == domain 1 score: 92.4 bits; conditional E-value: 1.1e-30 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsC 82 wCv+kd+ s++ lq++ldyaCg+gadC+++++gg+c++pnt++ah++ya+nsY+qk++++++aC+F+g+At++++dps++ C XLS46338.1|CBM43 23 WCVCKDG-SDAMLQKTLDYACGAGADCNPLHQGGPCFQPNTVRAHCNYAVNSYFQKKGQAQGACEFAGTATTVTSDPSASGC 103 9****87.6789********************************************************************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (209 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 60.88 // Query: XLT81551.1|CBM43 [L=209] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-31 92.9 6.9 1.1e-30 92.4 6.9 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.4 6.9 1.1e-30 1.1e-30 1 82 [. 23 103 .. 23 104 .. 0.97 Alignments for each domain: == domain 1 score: 92.4 bits; conditional E-value: 1.1e-30 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsC 82 wCv+kd+ s++ lq++ldyaCg+gadC+++++gg+c++pnt++ah++ya+nsY+qk++++++aC+F+g+At++++dps++ C XLT81551.1|CBM43 23 WCVCKDG-SDAMLQKTLDYACGAGADCNPLHQGGPCFQPNTVRAHCNYAVNSYFQKKGQAQGACEFAGTATTVTSDPSASGC 103 9****87.6789********************************************************************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (209 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 61.53 // Query: XLT88546.1|CBM43 [L=199] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-31 92.7 10.6 1.3e-30 92.2 10.6 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.2 10.6 1.3e-30 1.3e-30 2 81 .. 22 101 .. 21 104 .. 0.96 Alignments for each domain: == domain 1 score: 92.2 bits; conditional E-value: 1.3e-30 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgs 81 C++kd+v +++lq+a+dyaCg+gadC+ai ++g+cy+pnt+k+h++ya+nsYyq++++++++CdF+gaA+++++ pst+s XLT88546.1|CBM43 22 CLCKDGVGDQALQKAIDYACGNGADCSAILQNGACYQPNTVKDHCNYAVNSYYQRKGNAQDSCDFSGAASTSQNPPSTSS 101 **************************************************************************999763 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (199 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 55.60 // Query: XLU51140.1|CBM43 [L=199] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-31 92.7 10.6 1.3e-30 92.2 10.6 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.2 10.6 1.3e-30 1.3e-30 2 81 .. 22 101 .. 21 104 .. 0.96 Alignments for each domain: == domain 1 score: 92.2 bits; conditional E-value: 1.3e-30 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgs 81 C++kd+v +++lq+a+dyaCg+gadC+ai ++g+cy+pnt+k+h++ya+nsYyq++++++++CdF+gaA+++++ pst+s XLU51140.1|CBM43 22 CLCKDGVGDQALQKAIDYACGNGADCSAILQNGACYQPNTVKDHCNYAVNSYYQRKGNAQDSCDFSGAASTSQNPPSTSS 101 **************************************************************************999763 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (199 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 64.16 // Query: XLR16825.1|CBM43 [L=199] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-31 92.7 10.6 1.3e-30 92.2 10.6 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.2 10.6 1.3e-30 1.3e-30 2 81 .. 22 101 .. 21 104 .. 0.96 Alignments for each domain: == domain 1 score: 92.2 bits; conditional E-value: 1.3e-30 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgs 81 C++kd+v +++lq+a+dyaCg+gadC+ai ++g+cy+pnt+k+h++ya+nsYyq++++++++CdF+gaA+++++ pst+s XLR16825.1|CBM43 22 CLCKDGVGDQALQKAIDYACGNGADCSAILQNGACYQPNTVKDHCNYAVNSYYQRKGNAQDSCDFSGAASTSQNPPSTSS 101 **************************************************************************999763 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (199 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 63.77 // Query: XLS87632.1|CBM43 [L=199] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-31 92.7 10.6 1.3e-30 92.2 10.6 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.2 10.6 1.3e-30 1.3e-30 2 81 .. 22 101 .. 21 104 .. 0.96 Alignments for each domain: == domain 1 score: 92.2 bits; conditional E-value: 1.3e-30 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgs 81 C++kd+v +++lq+a+dyaCg+gadC+ai ++g+cy+pnt+k+h++ya+nsYyq++++++++CdF+gaA+++++ pst+s XLS87632.1|CBM43 22 CLCKDGVGDQALQKAIDYACGNGADCSAILQNGACYQPNTVKDHCNYAVNSYYQRKGNAQDSCDFSGAASTSQNPPSTSS 101 **************************************************************************999763 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (199 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 63.18 // Query: WZY76455.1|CBM43 [L=175] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-28 83.7 7.0 7.8e-28 83.3 7.0 1.1 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.3 7.0 7.8e-28 7.8e-28 2 79 .. 22 98 .. 21 99 .. 0.95 Alignments for each domain: == domain 1 score: 83.3 bits; conditional E-value: 7.8e-28 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpst 79 Cv+kd+ +e+ lq+a+dyaCg+gadCt+iq +g+cy+pnt+k+h++ a+nsYyqk+ +++++CdF+gaA+++s+ pst WZY76455.1|CBM43 22 CVCKDG-NEQVLQKAIDYACGAGADCTQIQLNGACYQPNTIKNHCDVAVNSYYQKKASSGATCDFNGAAVISSSPPST 98 999976.7889**************************************************************99985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (175 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 57.60 // Query: WZZ68455.1|CBM43 [L=680] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-27 80.2 10.7 6.9e-27 80.2 10.7 2.4 3 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 80.2 10.7 6.9e-27 6.9e-27 2 82 .. 22 102 .. 21 103 .. 0.93 2 ? -3.6 0.0 0.99 0.99 14 23 .. 109 118 .. 106 125 .. 0.78 3 ? -3.0 0.8 0.63 0.63 11 21 .. 577 587 .. 542 605 .. 0.65 Alignments for each domain: == domain 1 score: 80.2 bits; conditional E-value: 6.9e-27 CBM43.hmm 2 CvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstg.sC 82 Cv+kd+ +e+ lq+a+dyaCg+gadC++iq++g+c++pnt+k+h++ a+nsYyqk+ +++++CdF+gaA+++s+ pst+ sC WZZ68455.1|CBM43 22 CVCKDG-NEQVLQKAIDYACGAGADCSQIQQNGACFQPNTVKNHCDVAVNSYYQKKASSGATCDFNGAAVISSSPPSTAsSC 102 999976.6889***************************************************************99965266 PP == domain 2 score: -3.6 bits; conditional E-value: 0.99 CBM43.hmm 14 qaaldyaCge 23 + +dy C++ WZZ68455.1|CBM43 109 TEVFDYFCSS 118 67899***97 PP == domain 3 score: -3.0 bits; conditional E-value: 0.63 CBM43.hmm 11 eelqaaldyaC 21 ++ ++ +++C WZZ68455.1|CBM43 577 QQQKKRCSWLC 587 22233333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (680 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 114.16 // [ok]