# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM43/fasta_for_each_cluster/cluster_43.txt # target HMM database: merged_hmms/CBM43.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM43/CBM43_cluster_43.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: VDC58686.1|CBM43|GH17 [L=467] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-29 87.2 0.1 7.2e-29 86.6 0.1 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 86.6 0.1 7.2e-29 7.2e-29 1 83 [] 379 461 .. 379 461 .. 0.99 Alignments for each domain: == domain 1 score: 86.6 bits; conditional E-value: 7.2e-29 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsCk 83 wCv k+++++e+lq ++dy+Cg g dC++i ++g+c+ pnt++ah +ya+n +yq+ +r++ +CdF+ ++ +ts dps+g+C+ VDC58686.1|CBM43|GH17 379 WCVTKSGAETEALQRNIDYVCGLGLDCEPIIEDGPCFLPNTVEAHSAYAMNLFYQTMGRHEFDCDFDKTGEITSIDPSYGDCQ 461 9*********************************************************************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (467 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.57 // Query: AED93290.1|CBM43|GH17 [L=458] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-30 92.1 0.5 2e-30 91.6 0.5 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.6 0.5 2e-30 2e-30 1 83 [] 372 454 .. 372 454 .. 0.99 Alignments for each domain: == domain 1 score: 91.6 bits; conditional E-value: 2e-30 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsCk 83 wCv k+++++ +lq ++dy+Cg g dC++i++gg cy pnt+kah ya+n Yyq+ ++++ +CdF++++ +t+ dps+g+C+ AED93290.1|CBM43|GH17 372 WCVTKAGAETVALQRNIDYVCGLGLDCRPINEGGLCYLPNTVKAHSKYAMNLYYQTMEKHEFDCDFDNTGEITTIDPSYGNCE 454 9*********************************************************************************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (458 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.31 // Query: AAZ74761.1|CBM43|GH17 [L=228] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (228 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 111.76 // Query: CAA2623106.1|CBM43|GH17 [L=397] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-27 80.7 0.0 7.8e-27 80.1 0.0 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 80.1 0.0 7.8e-27 7.8e-27 6 83 .] 316 394 .. 313 394 .. 0.97 Alignments for each domain: == domain 1 score: 80.1 bits; conditional E-value: 7.8e-27 CBM43.hmm 6 dsvseeelqaaldyaCge.gadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsCk 83 ++++e++lq+++d++Cg+ g++C ai +gg+c+ p+tl+aha++a+n++yq+ r++saCdF++++ +t +dps+gsCk CAA2623106.1|CBM43|GH17 316 PNTDEKSLQENIDFVCGRgGMECMAIRPGGACFLPDTLQAHAAFAMNAFYQAVARSPSACDFGQTGLVTLEDPSYGSCK 394 7899**************889*********************************************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (397 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.96 // Query: ACG43184.1|CBM43|GH17 [L=450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-32 97.3 0.5 4.8e-32 96.8 0.5 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.8 0.5 4.8e-32 4.8e-32 1 83 [] 365 448 .. 365 448 .. 0.99 Alignments for each domain: == domain 1 score: 96.8 bits; conditional E-value: 4.8e-32 CBM43.hmm 1 wCvakdsvseeelqaaldyaCge.gadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsCk 83 wCv +++++e lq+++d+aCg+ g+dCtai +gg cy+p+t++aha+ya+n Y+q++++++ +CdF++++++t++dps+g Ck ACG43184.1|CBM43|GH17 365 WCVPEPAADEMVLQENIDFACGQkGVDCTAIRPGGVCYEPDTVQAHAAYAMNLYFQANGQHAFDCDFGQTGIVTTADPSYGGCK 448 9*********************988**********************************************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (450 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.96 // Query: CAJ86292.1|CBM43|GH17 [L=1216] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-31 93.2 0.7 6e-31 93.2 0.7 2.7 2 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.3 0.11 0.11 20 58 .. 288 328 .. 279 335 .. 0.73 2 ! 93.2 0.7 6e-31 6e-31 1 83 [] 1131 1214 .. 1131 1214 .. 0.99 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.11 CBM43.hmm 20 aCge.gadCtaiqaggt.cyspntlkahasyafnsYyqkqk 58 +C+ a C++ +++++ c ++ ++ +s +fns ++ + CAJ86292.1|CBM43|GH17 288 LCEGnIAPCSSSSEQKEdCSLKQSKTSILSCVFNSPFNIFE 328 67763578988877766477777888899999999887666 PP == domain 2 score: 93.2 bits; conditional E-value: 6e-31 CBM43.hmm 1 wCvakdsvseeelqaaldyaCge.gadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsCk 83 wCv k++++e +lq ++d++Cg+ g+dC ai agg+cy+pn+++aha++a+n Y+q++++++ +CdF++++++t+ dps++sCk CAJ86292.1|CBM43|GH17 1131 WCVPKPAADEVALQVNIDFVCGQgGIDCGAIRAGGSCYDPNNVQAHAAFAMNLYFQSNGQHEFDCDFGQTGVITTVDPSYKSCK 1214 9**********************889*********************************************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1216 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 153.28 // Query: AAZ74752.1|CBM43|GH17 [L=228] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (228 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 122.55 // Query: NP_001031936.1|CBM43|GH17 [L=458] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-30 92.1 0.5 2e-30 91.6 0.5 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.6 0.5 2e-30 2e-30 1 83 [] 372 454 .. 372 454 .. 0.99 Alignments for each domain: == domain 1 score: 91.6 bits; conditional E-value: 2e-30 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsCk 83 wCv k+++++ +lq ++dy+Cg g dC++i++gg cy pnt+kah ya+n Yyq+ ++++ +CdF++++ +t+ dps+g+C+ NP_001031936.1|CBM43|GH17 372 WCVTKAGAETVALQRNIDYVCGLGLDCRPINEGGLCYLPNTVKAHSKYAMNLYYQTMEKHEFDCDFDNTGEITTIDPSYGNCE 454 9*********************************************************************************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (458 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.45 // Query: BBG98402.1|CBM43|GH17 [L=965] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-28 84.5 0.0 6.7e-28 83.5 0.0 1.5 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.5 0.0 6.7e-28 6.7e-28 1 79 [. 439 517 .. 439 519 .. 0.98 Alignments for each domain: == domain 1 score: 83.5 bits; conditional E-value: 6.7e-28 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpst 79 wC+ k+ ++ e+lq ++dy+Cg g +C +i++gg+c+ pnt++aha+ya+n+Y+q+ +r++ +C+F+g++ +t+ dps+ BBG98402.1|CBM43|GH17 439 WCLPKRRADAEALQRNIDYVCGLGLNCGPIKQGGPCFMPNTVRAHAAYAMNRYFQAMGRNGYDCEFEGTGATTAVDPSE 517 9***************************************************************************996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (965 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 154.46 // Query: AAZ74762.1|CBM43|GH17 [L=228] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (228 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 125.37 // Query: CAA7399079.1|CBM43|GH17 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-30 89.7 0.1 1.2e-29 89.1 0.1 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.1 0.1 1.2e-29 1.2e-29 1 83 [] 358 441 .. 358 441 .. 0.99 Alignments for each domain: == domain 1 score: 89.1 bits; conditional E-value: 1.2e-29 CBM43.hmm 1 wCvakdsvseeelqaaldyaCge.gadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsCk 83 wC+ k++++e++lq+++d++Cg+ g++C ai +gg+c+ p+tl+aha++a+n++yq+ +++saCdF++++ +t +dps+gsCk CAA7399079.1|CBM43|GH17 358 WCLPKPNTDEKSLQENIDFVCGRgGMECMAIRPGGACFLPDTLQAHAAFAMNAFYQAAAHSPSACDFGQTGLVTLEDPSYGSCK 441 9**********************889*********************************************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.57 // Query: CAG1850152.1|CBM43|GH17 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-29 88.4 0.0 2.9e-29 87.8 0.0 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.8 0.0 2.9e-29 2.9e-29 1 82 [. 367 448 .. 367 449 .. 0.99 Alignments for each domain: == domain 1 score: 87.8 bits; conditional E-value: 2.9e-29 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsC 82 wC+ k++++ lq++++y+Cg+g+dCt+iq+gg cy p+t+ aha++ +n+Yyq+ +r++ +CdF+ ++++t+ dps+gsC CAG1850152.1|CBM43|GH17 367 WCIPKPNTDVLLLQQNVEYVCGQGIDCTPIQSGGVCYFPDTVPAHAAFLMNEYYQTFGRNAFDCDFGRTGMITAIDPSYGSC 448 9********************************************************************************* PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 103.28 // Query: AAZ74753.1|CBM43|GH17 [L=228] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (228 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 152.11 // Query: AAZ74763.1|CBM43|GH17 [L=228] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (228 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 151.26 // Query: AED93291.1|CBM43|GH17 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-28 85.9 0.1 1.8e-28 85.3 0.1 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 85.3 0.1 1.8e-28 1.8e-28 1 79 [. 372 450 .. 372 452 .] 0.98 Alignments for each domain: == domain 1 score: 85.3 bits; conditional E-value: 1.8e-28 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpst 79 wCv k+++++ +lq ++dy+Cg g dC++i++gg cy pnt+kah ya+n Yyq+ ++++ +CdF++++ +t+ dps AED93291.1|CBM43|GH17 372 WCVTKAGAETVALQRNIDYVCGLGLDCRPINEGGLCYLPNTVKAHSKYAMNLYYQTMEKHEFDCDFDNTGEITTIDPSM 450 9****************************************************************************96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.63 // Query: BAS91683.1|CBM43|GH17 [L=451] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-29 89.3 0.2 1.6e-29 88.7 0.2 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.7 0.2 1.6e-29 1.6e-29 1 79 [. 366 445 .. 366 447 .. 0.98 Alignments for each domain: == domain 1 score: 88.7 bits; conditional E-value: 1.6e-29 CBM43.hmm 1 wCvakdsvseeelqaaldyaCge.gadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpst 79 wCv k++++e +lq ++d++Cg+ g+dC ai agg+cy+pn+++aha++a+n Y+q++++++ +CdF++++++t+ dps+ BAS91683.1|CBM43|GH17 366 WCVPKPAADEVALQVNIDFVCGQgGIDCGAIRAGGSCYDPNNVQAHAAFAMNLYFQSNGQHEFDCDFGQTGVITTVDPSK 445 9**********************889***************************************************985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (451 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 109.19 // Query: AAZ74760.1|CBM43|GH17 [L=228] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (228 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 147.01 // Query: CAB4107510.1|CBM43|GH17 [L=393] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-29 88.7 0.4 2.3e-29 88.2 0.4 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.2 0.4 2.3e-29 2.3e-29 1 83 [] 310 392 .. 310 392 .. 0.99 Alignments for each domain: == domain 1 score: 88.2 bits; conditional E-value: 2.3e-29 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsCk 83 wC+ ++++s+e lq ++dy+Cg g dC++i++gg c+ p++++aha+ya+n Yyq+++r++ +CdF+ ++ +ts++p +g+Ck CAB4107510.1|CBM43|GH17 310 WCIPRSGASDEVLQMNIDYVCGLGFDCQPISKGGRCFYPDSVRAHAAYAMNVYYQATGRHDYDCDFRSTGAITSSNPGYGRCK 392 9*********************************************************************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (393 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.38 // Query: AAZ74759.1|CBM43|GH17 [L=228] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (228 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 132.62 // Query: AAZ74755.1|CBM43|GH17 [L=228] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (228 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 137.58 // Query: AAZ74751.1|CBM43|GH17 [L=228] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (228 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 130.18 // Query: AAZ74757.1|CBM43|GH17 [L=228] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (228 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 150.96 // Query: AAZ74764.1|CBM43|GH17 [L=228] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (228 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 148.27 // Query: CAG7860205.1|CBM43|GH17 [L=800] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-26 78.5 0.0 5.2e-26 77.4 0.0 1.5 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 77.4 0.0 5.2e-26 5.2e-26 1 78 [. 670 747 .. 670 751 .. 0.98 Alignments for each domain: == domain 1 score: 77.4 bits; conditional E-value: 5.2e-26 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdps 78 wCv k+++++e+lq ++dy+Cg g dC++i ++g+c+ pnt++ah +ya+n +yq+ +r++ +CdF+ ++ +ts dp CAG7860205.1|CBM43|GH17 670 WCVTKSGAETEALQRNIDYVCGLGLDCEPIIEDGPCFLPNTVEAHSAYAMNLFYQTMGRHEFDCDFDKTGEITSIDPR 747 9*************************************************************************9985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (800 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.24 // Query: AAZ74758.1|CBM43|GH17 [L=228] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (228 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 144.23 // Query: AAZ74756.1|CBM43|GH17 [L=228] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (228 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.16 // Query: AAZ74754.1|CBM43|GH17 [L=228] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (228 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 135.00 // Query: VDD28317.1|CBM43|GH17 [L=467] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-29 86.5 0.1 1.2e-28 85.9 0.1 1.3 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 85.9 0.1 1.2e-28 1.2e-28 1 83 [] 379 461 .. 379 461 .. 0.99 Alignments for each domain: == domain 1 score: 85.9 bits; conditional E-value: 1.2e-28 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsCk 83 wCv k+++++e+lq ++dy+Cg g dC++i +gg+c pnt++ah +ya+n +yq+ +r++ +CdF+ ++ +ts dps+g+C+ VDD28317.1|CBM43|GH17 379 WCVTKSGAETEALQRNIDYVCGLGLDCEPIIEGGPCILPNTVEAHSAYAMNLFYQTMGRHEFDCDFDKTGEITSIDPSYGDCQ 461 9*********************************************************************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (467 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 106.06 // Query: BAF02203.1|CBM43|GH17 [L=251] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-31 93.6 0.5 6.7e-31 93.1 0.5 1.2 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.1 0.5 6.7e-31 6.7e-31 1 83 [] 165 247 .. 165 247 .. 0.99 Alignments for each domain: == domain 1 score: 93.1 bits; conditional E-value: 6.7e-31 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsCk 83 wCv k+++++ +lq ++dy+Cg g dC++i++gg cy pnt+kah ya+n Yyq+ ++++ +CdF++++ +t+ dps+g+C+ BAF02203.1|CBM43|GH17 165 WCVTKAGAETVALQRNIDYVCGLGLDCRPINEGGLCYLPNTVKAHSKYAMNLYYQTMEKHEFDCDFDNTGEITTIDPSYGNCE 247 9*********************************************************************************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (251 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.17 // Query: CAE6118230.1|CBM43|GH17 [L=1125] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-30 90.7 0.3 7.1e-30 89.8 0.3 1.5 1 CBM43.hmm Domain annotation for each model (and alignments): >> CBM43.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.8 0.3 7.1e-30 7.1e-30 1 83 [] 1040 1122 .. 1040 1122 .. 0.99 Alignments for each domain: == domain 1 score: 89.8 bits; conditional E-value: 7.1e-30 CBM43.hmm 1 wCvakdsvseeelqaaldyaCgegadCtaiqaggtcyspntlkahasyafnsYyqkqkressaCdFkgaAtltstdpstgsCk 83 wCv k+++++ +lq ++dy+Cg g dC++i+++g c+ pnt+kah ya+n Yyq+ ++++ +CdF++++ +t+ dps+g+C+ CAE6118230.1|CBM43|GH17 1040 WCVTKPGADTVALQRNIDYVCGLGLDCRPINEDGLCFLPNTVKAHSEYAMNLYYQTMEKHEFNCDFDNTGEITTIDPSYGNCE 1122 9*********************************************************************************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1125 residues searched) Target model(s): 1 (83 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 151.42 // [ok]