# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM41/fasta_for_each_cluster/cluster_4.txt # target HMM database: merged_hmms/CBM41.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM41/CBM41_cluster_4.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: AGP97586.1|CBM41|CBM48|GH13_13 [L=1472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-20 60.6 0.9 1.1e-20 60.6 0.9 3.1 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.6 0.9 1.1e-20 1.1e-20 1 99 [. 119 239 .. 119 241 .. 0.86 2 ? -3.7 0.0 1 1 69 95 .. 408 432 .. 394 434 .. 0.63 3 ? -2.9 0.2 0.63 0.63 33 68 .. 1165 1201 .. 1150 1218 .. 0.67 4 ? -3.2 0.0 0.81 0.81 14 40 .. 1274 1294 .. 1270 1313 .. 0.64 Alignments for each domain: == domain 1 score: 60.6 bits; conditional E-value: 1.1e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi AGP97586.1|CBM41|CBM48|GH13_13 119 NQAVLYYNRaavdadnsnNDPAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 196 688999**999998888788899*************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ AGP97586.1|CBM41|CBM48|GH13_13 197 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 239 ***87778888888*****999977788888899999999875 PP == domain 2 score: -3.7 bits; conditional E-value: 1 CBM41.hmm 69 kkdlggDrkidllkdgsaevwlvsgde 95 +k l +++d+ d+++ vw +gd AGP97586.1|CBM41|CBM48|GH13_13 408 NKTL--SQRLDMVRDDTSGVWRYEGDM 432 3332..355666667788999999886 PP == domain 3 score: -2.9 bits; conditional E-value: 0.63 CBM41.hmm 33 wggaleftgkDdyGayadvklk.egaskigfivrkgd 68 +g++++t + + G+++ +k++ e+ s+++f +g+ AGP97586.1|CBM41|CBM48|GH13_13 1165 GDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAADGE 1201 3777888888888888888887357788888666664 PP == domain 4 score: -3.2 bits; conditional E-value: 0.81 CBM41.hmm 14 ydgwglwtWgddveaepsdwggaleft 40 y+g +++t+ +dve g +ef+ AGP97586.1|CBM41|CBM48|GH13_13 1274 YQGGRVYTFSRDVE------PGTYEFK 1294 88899999999996......3444442 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1472 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 109.98 // Query: QRH02117.1|CBM41|CBM48|GH13_13 [L=1440] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-22 64.0 4.1 1.9e-21 63.0 0.1 2.8 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.0 0.1 1.9e-21 1.9e-21 1 101 [. 89 212 .. 89 213 .. 0.86 2 ? 0.9 0.7 0.042 0.042 12 62 .. 910 965 .. 905 969 .. 0.72 Alignments for each domain: == domain 1 score: 63.0 bits; conditional E-value: 1.9e-21 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+g++l+tW++d++ ++p dw + +ef+g D+ yGay+ ++lkeg+ ++ +fi QRH02117.1|CBM41|CBM48|GH13_13 89 NEAVIYYNRpkdadnspNDPVYNGYRLHTWNNDTCdaYAPPfdssDWANGHEFDGIDPnYGAYWILNLKEGYgECGNFI 167 6799*****9998888777889*************8644445666**888********************99568**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 ++ g ++k+lg gD k++l++ + + ++ +g ++v+++p QRH02117.1|CBM41|CBM48|GH13_13 168 IHVGtegSGKALGdGDFKMPLKQddeKFVRMNFTLHGTPSVFEYP 212 **977779999999*******997777778889999999999876 PP == domain 2 score: 0.9 bits; conditional E-value: 0.042 CBM41.hmm 12 gdydgwglwtWgddveaepsdwggalef..tgkDdyGayadvklkega....skigf 62 ++yd+ +++ + d+++++++w+ l+ ++++++ +a +++++++ s+igf QRH02117.1|CBM41|CBM48|GH13_13 910 NSYDSGDWFNYV-DFTQSGNNWNVGLPLaqDNQGNWNTIAGISANPNTaasaSEIGF 965 678888888888.55356669988888855779999999999999754344467776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1440 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 130.74 // Query: QYX63663.1|CBM41|CBM48|GH13_13 [L=1440] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.7e-21 60.9 1.9 8.7e-21 60.9 1.9 2.8 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.9 1.9 8.7e-21 8.7e-21 1 101 [. 90 213 .. 90 214 .. 0.87 2 ? -1.1 0.7 0.17 0.17 12 57 .. 910 956 .. 905 964 .. 0.69 Alignments for each domain: == domain 1 score: 60.9 bits; conditional E-value: 8.7e-21 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve...aeps....dwggaleftgkDd.yGayadvklkega.skigf 62 n+++++Y+r ++++y +++l+tW+d+++ a+ dw + ++f+g D+ yGay+ ++lkeg+ + +f QYX63663.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRikdknntaSNAEYPKYKLHTWNDEKCdayAA-PfdtsDWANGHPFDGIDPnYGAYWILNLKEGYgACANF 167 68999****999999877799**********999986322.23556**888********************99458*** PP CBM41.hmm 63 ivrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 iv+ g ++k+lg ++ +++l + + + ++ +g+++vy++p QYX63663.1|CBM41|CBM48|GH13_13 168 IVHAGtddAGKALGkNNLTMSLVQddaTYVRVNFTIHGESDVYEYP 213 ***987778899999*******99888899999**********987 PP == domain 2 score: -1.1 bits; conditional E-value: 0.17 CBM41.hmm 12 gdydgwglwtWgddveaepsdwggalef..tgkDdyGayadvklkega 57 ++yd+ +++ + d+++++++w+ l+ ++ ++ ++a ++++++a QYX63663.1|CBM41|CBM48|GH13_13 910 NSYDSGDWFNYV-DFTYNSNNWNVGLPLaqDNSSKWTQIAGISANPNA 956 678888888887.55355558988888843446668888888888765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1440 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 132.88 // Query: BBO27638.1|CBM41|CBM48|GH13_13 [L=1459] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-19 54.9 0.2 6.3e-19 54.9 0.2 3.6 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 54.9 0.2 6.3e-19 6.3e-19 2 99 .. 104 227 .. 103 229 .. 0.84 2 ? 2.8 0.0 0.011 0.011 55 96 .. 383 421 .. 371 426 .. 0.81 3 ? -3.0 0.3 0.69 0.69 13 49 .. 919 956 .. 915 969 .. 0.63 4 ? -3.1 0.1 0.74 0.74 31 57 .. 1141 1167 .. 1129 1188 .. 0.62 Alignments for each domain: == domain 1 score: 54.9 bits; conditional E-value: 6.3e-19 CBM41.hmm 2 tvrvhYkr.........adgdydgwglwtWgddve....aeps.dwggaleftgkDd.yGayadvklkega.....ski 60 +++++Y+r d+ y+gw+l+tW++d++ + dw + + +g D+ yGay+ ++lk+g + BBO27638.1|CBM41|CBM48|GH13_13 104 QAVLYYNRagvgatnspGDSAYEGWKLHTWNNDACdayaDG-DtDWANGRAISGIDPnYGAYWVLELKPGVagtpgACH 181 68899999999999988889***************864223.26**777999****************9766767779* PP CBM41.hmm 61 gfivrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 +fi++kg ++k++g +D k +l++ + ++ ++ sg ++v++ BBO27638.1|CBM41|CBM48|GH13_13 182 NFIIHKGtddAGKEMGgSDFKGKLDQddeKFTRMNFTLSGVPTVFE 227 ******8777788888899999998877777888999999999875 PP == domain 2 score: 2.8 bits; conditional E-value: 0.011 CBM41.hmm 55 egaskigfivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 ++a++++++v +++k+ +Dr+ l+ ++ vw+ +gd + BBO27638.1|CBM41|CBM48|GH13_13 383 PTATTVNLLVYNDNKTL--ADRHAMTLN-TESGVWVYNGDMS 421 56789999999888776..788877777.799*******986 PP == domain 3 score: -3.0 bits; conditional E-value: 0.69 CBM41.hmm 13 dydgwglwtWgddveaeps.dwggaleftgkDd..yGaya 49 +yd+ +++ + d+ + ++ +w+ l+ ++k + +G++ BBO27638.1|CBM41|CBM48|GH13_13 919 SYDSGDWFNFV-DF-TMQTnNWNVGLPLAEKNEarWGEMG 956 67777777777.55.4445589888888553332577665 PP == domain 4 score: -3.1 bits; conditional E-value: 0.74 CBM41.hmm 31 sdwggaleftgkDdyGayadvklkega 57 s+wg+++ef+ +++ ++a+ +l++g+ BBO27638.1|CBM41|CBM48|GH13_13 1141 SEWGTSVEFAYQGNGIYTATSTLTAGT 1167 367777777666665555555555444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1459 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 141.07 // Query: ANB27329.1|CBM41|CBM48|GH13_13 [L=1449] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-20 59.8 3.5 3.8e-20 58.8 2.0 2.5 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.8 2.0 3.8e-20 3.8e-20 1 101 [. 96 218 .. 96 219 .. 0.86 2 ? -3.7 0.0 1 1 68 95 .. 384 409 .. 374 411 .. 0.66 Alignments for each domain: == domain 1 score: 58.8 bits; conditional E-value: 3.8e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve..aeps..dwggaleftgkDd.yGayadvklkega.skigfiv 64 n+++++Y+r +d y+gw+l+tW++d + +++s dw + + tg D+ yGay+ ++lk++ ++ +fi+ ANB27329.1|CBM41|CBM48|GH13_13 96 NQAVLYYNRaavdadnstNDPVYEGWRLHTWNNDECdaYADSdtDWANGRQHTGIDPnYGAYWVLDLKNDFdDCHNFII 174 688999***88888887777889*************98445556**666777****99**********998458***** PP CBM41.hmm 65 rkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 + g ++k+lg +D + +l + + + ++ sg+++++++p ANB27329.1|CBM41|CBM48|GH13_13 175 HLGtddAGKELGgSDFQASLVQdddTYVRMNFTLSGEPTLFEYP 218 *876678899999***999999888899999******9999886 PP == domain 2 score: -3.7 bits; conditional E-value: 1 CBM41.hmm 68 dkkdlggDrkidllkdgsaevwlvsgde 95 d+k l + ++++ d + +w ++gd ANB27329.1|CBM41|CBM48|GH13_13 384 DNKTLANRYSMTR--DTVTGIWQFEGDM 409 5555555555555..4589999999986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1449 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 150.45 // Query: AUL74353.1|CBM41|CBM48|GH13_13 [L=1434] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-21 62.1 0.1 3.7e-21 62.1 0.1 3.2 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.1 0.1 3.7e-21 3.7e-21 2 101 .. 90 205 .. 89 206 .. 0.87 2 ? -0.1 0.2 0.086 0.086 22 82 .. 292 357 .. 280 380 .. 0.71 3 ? -3.1 0.3 0.75 0.75 22 58 .. 912 952 .. 901 955 .. 0.56 Alignments for each domain: == domain 1 score: 62.1 bits; conditional E-value: 3.7e-21 CBM41.hmm 2 tvrvhYkr.adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfivrkg...d 68 ++++ Y+r ad++y+g++l+ W++dv+ ++p dw + +e +g D+ yGay+ ++lkeg+ ++ +fiv+ g + AUL74353.1|CBM41|CBM48|GH13_13 90 EAVLFYNRlADDNYEGYRLHSWNNDVCdaYAPPfdtsDWANGHEYDGIDPnYGAYWIINLKEGYnECANFIVHIGtegS 168 57899***6779***************8644445666**777999****************988357******976679 PP CBM41.hmm 69 kkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 +k++g D +++l + + ++ ++ +g+++v+++p AUL74353.1|CBM41|CBM48|GH13_13 169 GKAFGdVDLTMPLMQddeKFQRMNFTIHGEPSVFEYP 205 999999*******99888889999*********9986 PP == domain 2 score: -0.1 bits; conditional E-value: 0.086 CBM41.hmm 22 Wgddveaepsdw.ggaleftgkDdyGayadvklkegaskigfivrkgdkkd......lg.gDrkidllk 82 W+ d ++++ +++l ++g D+ G+ + ++ ++a+ + + ++g++++ ++ g+ +id++ AUL74353.1|CBM41|CBM48|GH13_13 292 WDAD---AAKQLiKQQLVVAGYDSEGKLLEATFVQTAKALDALYTQGEDDAneallgVNyGNNTIDVTV 357 4322...3346668899999*********************9999984444346666444666666654 PP == domain 3 score: -3.1 bits; conditional E-value: 0.75 CBM41.hmm 22 Wgddve.aeps.dwggalef..tgkDdyGayadvklkegas 58 W + v+ ++++ +w+ l+ ++++++ +++ ++++++a+ AUL74353.1|CBM41|CBM48|GH13_13 912 WFNAVDlTKENnNWNIGLPNaeKNQEKWSEIMPISANADAQ 952 44455553333477444444234466677777777777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1434 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 141.42 // Query: UAA37637.1|CBM41|CBM48|GH13_13 [L=1392] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-25 76.0 0.0 8.1e-25 73.8 0.0 2.3 1 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.8 0.0 8.1e-25 8.1e-25 1 101 [. 70 176 .. 70 177 .. 0.90 Alignments for each domain: == domain 1 score: 73.8 bits; conditional E-value: 8.1e-25 CBM41.hmm 1 ntvrvhYkradgdydgwglwtWgddve....aepsdwggaleftgkDd.yGayadvklkegas.kigfivrkg.dkkdl 72 n++++ Y+r+d++y+gw l++W++d + aep++w + ++g D+ yG y+ ++l eg+s +++fiv++ kd+ UAA37637.1|CBM41|CBM48|GH13_13 70 NEAIIFYNRSDANYEGWVLHLWNNDNCpntvAEPTNWPEGPSVAGVDPvYGGYFIIPLMEGYSdCMNFIVHDAaGVKDI 148 6789**********************998766888**777888****************988537*******8899998 PP CBM41.hmm 73 g.gDrkidllkdgsaevwlvsgdekvytsp 101 + +D +++l+ gs+ vw+ sg ++v+t+p UAA37637.1|CBM41|CBM48|GH13_13 149 SqQDLMMNLT--GSRMVWTLSGVNEVFTEP 176 8899999994..6**************997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1392 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.64 // Query: AFU99116.1|CBM41|CBM48|GH13_13 [L=1445] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-15 43.5 1.1 2.2e-15 43.5 1.1 2.3 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.5 1.1 2.2e-15 2.2e-15 2 83 .. 88 187 .. 87 203 .. 0.82 2 ? -3.7 0.6 1 1 13 44 .. 909 939 .. 905 954 .. 0.56 Alignments for each domain: == domain 1 score: 43.5 bits; conditional E-value: 2.2e-15 CBM41.hmm 2 tvrvhYkrad..gdydgwglwtWgddvea............epsdw.ggalef.tgkDd.yGayadvklkegaskigfi 63 +++++++r+ + y +w l++W+ + ++ +p++w +g+ +g D+ yGay+ +++++ +++ + i AFU99116.1|CBM41|CBM48|GH13_13 88 EAVIYFNRQHidQAYGDWVLHLWN-SGCTggwasqvtatdtAPTNWpDGPSVNgAGVDPiYGAYWVLNIQDASTCGNWI 165 689*****76669***********.6674467788988877777**9776554599*********************** PP CBM41.hmm 64 vrkgdkkdlggDrkidllk..d 83 v++++++++++D++++l+ + AFU99116.1|CBM41|CBM48|GH13_13 166 VHNTAGDNQTNDYSLSLSGntK 187 **************99976433 PP == domain 2 score: -3.7 bits; conditional E-value: 1 CBM41.hmm 13 dydgwglwtWgddveaeps.dwggaleftgkDd 44 yd +++ + d+ ++++ +w ++ ++ D+ AFU99116.1|CBM41|CBM48|GH13_13 909 TYDAGDWYNYV-DF-TQNTnNWAIGMPLDRGDT 939 55555666665.44.333336655555555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1445 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 154.25 // Query: ABL98498.1|CBM41|CBM48|GH13_13 [L=1441] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-22 64.5 0.1 6.3e-22 64.5 0.1 2.7 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.5 0.1 6.3e-22 6.3e-22 1 101 [. 89 212 .. 89 213 .. 0.86 2 ? -0.8 0.7 0.14 0.14 12 62 .. 910 965 .. 905 968 .. 0.67 Alignments for each domain: == domain 1 score: 64.5 bits; conditional E-value: 6.3e-22 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d ydg++l+tW++d++ ++p dw + +ef+g D+ yGay+ ++lkeg+ ++ +fi ABL98498.1|CBM41|CBM48|GH13_13 89 NEAVIYYNRpkdadnspNDPVYDGYRLHTWNNDTCdaYAPPfdssDWANGHEFDGIDPnYGAYWILNLKEGYgECGNFI 167 6799*****9998888777889*************8644445666**888********************99568**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 ++ g ++k+lg gD k++l++ + + ++ +g ++v+++p ABL98498.1|CBM41|CBM48|GH13_13 168 IHVGtegSGKALGdGDFKMPLKQddeKFVRMNFTLHGTPSVFEYP 212 **977779999999*******997777778889999999999876 PP == domain 2 score: -0.8 bits; conditional E-value: 0.14 CBM41.hmm 12 gdydgwglwtWgddveaepsdwggalef..tgkDdyGayadvklkega....skigf 62 ++yd+ +++ + d+++++++w+ l+ ++++++ + +++++++ s+igf ABL98498.1|CBM41|CBM48|GH13_13 910 NSYDSGDWFNYV-DFTQSGNNWNVGLPLaqDNQGNWNTITGISANPNTaasaSEIGF 965 678888888888.55345669987787744668888888888888644344356666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1441 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 151.53 // Query: QJR82932.1|CBM41|CBM48|GH13_13 [L=1445] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-22 64.2 0.9 5.7e-21 61.5 0.9 2.6 1 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.5 0.9 5.7e-21 5.7e-21 3 98 .. 92 209 .. 90 212 .. 0.82 Alignments for each domain: == domain 1 score: 61.5 bits; conditional E-value: 5.7e-21 CBM41.hmm 3 vrvhYkr.........adgdydgwglwtWgddve....aepsdwggaleftgkDd.yGayadvklkega.skigfivrk 66 ++++++r +d y+gw+l+tW++d + +++sdw + ++tg D+ yGay+ ++lke++ s+ +fiv+k QJR82932.1|CBM41|CBM48|GH13_13 92 AVLYFNRasvdadnsaNDPAYEGWRLHTWNNDECdayaDADSDWANGRQPTGIDPnYGAYWVLELKENYgSCHNFIVHK 170 567777777766666678899*************97533555**777999****************999678******* PP CBM41.hmm 67 g...dkkdlg.gDrkidllk...dgsaevwlvsgdekvy 98 g ++k+lg gD + +l++ + ++ ++ sg+++++ QJR82932.1|CBM41|CBM48|GH13_13 171 GtddAGKELGgGDFQGSLIQddeKYTRMNFTLSGEATIF 209 877788889989999998887778888899999998886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1445 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 161.57 // Query: AFS37359.1|CBM41|CBM48|GH13_13 [L=1472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-20 59.5 1.2 2.3e-20 59.5 1.2 3.7 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.5 1.2 2.3e-20 2.3e-20 1 98 [. 119 238 .. 119 241 .. 0.84 2 ? -0.2 0.0 0.093 0.093 57 96 .. 397 433 .. 384 437 .. 0.77 3 ? -2.2 0.2 0.39 0.39 31 68 .. 1162 1201 .. 1147 1219 .. 0.67 4 ? -3.8 0.0 1 1 14 39 .. 1274 1293 .. 1271 1312 .. 0.66 Alignments for each domain: == domain 1 score: 59.5 bits; conditional E-value: 2.3e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d+ y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi AFS37359.1|CBM41|CBM48|GH13_13 119 NQAVLYYNRaavdadnssNDAAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 196 68899****999999998899***************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvy 98 ++kg ++k++g gD + +l + + + ++ sg+++++ AFS37359.1|CBM41|CBM48|GH13_13 197 IHKGtddAGKEMGgGDFQGSLVQddeTFVRMNFTLSGEATIF 238 ***877778888889999888886666677778888888776 PP == domain 2 score: -0.2 bits; conditional E-value: 0.093 CBM41.hmm 57 askigfivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 as++ +++ +++k+ ++id+ d+++ vw ++gd + AFS37359.1|CBM41|CBM48|GH13_13 397 ASNVDLLIYNDNKTL---SQRIDMVRDDTSGVWRHEGDMS 433 566777776665554...578999999999*******986 PP == domain 3 score: -2.2 bits; conditional E-value: 0.39 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgd 68 + +g++++t + + G+++ +k++ e+ s+++f +g+ AFS37359.1|CBM41|CBM48|GH13_13 1162 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAADGE 1201 3233777888888888888888887357788888766664 PP == domain 4 score: -3.8 bits; conditional E-value: 1 CBM41.hmm 14 ydgwglwtWgddveaepsdwggalef 39 y+g +++t+ +dve g +ef AFS37359.1|CBM41|CBM48|GH13_13 1274 YQGGRIYTFSRDVE------PGTYEF 1293 88889999999996......444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1472 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 146.16 // Query: AGP89770.1|CBM41|CBM48|GH13_13 [L=1472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-21 61.6 1.0 5e-21 61.6 1.0 3.5 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.6 1.0 5e-21 5e-21 1 99 [. 119 239 .. 119 241 .. 0.87 2 ? -0.2 0.0 0.093 0.093 57 96 .. 397 433 .. 384 437 .. 0.77 3 ? -2.2 0.2 0.37 0.37 31 69 .. 1162 1202 .. 1146 1219 .. 0.67 Alignments for each domain: == domain 1 score: 61.6 bits; conditional E-value: 5e-21 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d+ y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi AGP89770.1|CBM41|CBM48|GH13_13 119 NQAVLYYNRaavdadnssNDAAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 196 68899****999999998899***************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ AGP89770.1|CBM41|CBM48|GH13_13 197 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 239 ***87778888888*****999977788888899999999875 PP == domain 2 score: -0.2 bits; conditional E-value: 0.093 CBM41.hmm 57 askigfivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 as++ +++ +++k+ ++id+ d+++ vw ++gd + AGP89770.1|CBM41|CBM48|GH13_13 397 ASNVDLLIYNDNKTL---SQRIDMVRDDTSGVWRHEGDMS 433 566777776665554...578999999999*******986 PP == domain 3 score: -2.2 bits; conditional E-value: 0.37 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgdk 69 + +g++++t + + G+++ +k++ e+ s+++f +g++ AGP89770.1|CBM41|CBM48|GH13_13 1162 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAADGEE 1202 33347788888888888888888873577888887666644 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1472 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.37 // Query: BCO21936.1|CBM41|CBM48|GH13_13 [L=1359] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-24 70.5 0.1 3.7e-23 68.5 0.1 2.1 1 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.5 0.1 3.7e-23 3.7e-23 1 100 [. 137 246 .. 137 247 .. 0.87 Alignments for each domain: == domain 1 score: 68.5 bits; conditional E-value: 3.7e-23 CBM41.hmm 1 ntvrvhYkradgdydgwglwtWgddve...aeps.......dwggaleftgkDd.yGayadvklkegaskigfivrkgd 68 n++ v Y+r+dg+ydgwgl++W+ +++ a+p+ +w ++++ +g + yGay+ +++++ga + +fiv+kg+ BCO21936.1|CBM41|CBM48|GH13_13 137 NQIAVFYNREDGQYDGWGLHLWNGQACgnyAAPTtqsshfsNWPDPYPADGVHPeYGAYYILTVEPGAACYNFIVHKGN 215 6899*******************9999875333334468889*********5555************************ PP CBM41.hmm 69 kkdlg.gDrkidllkdgsaevwlvsgdekvyts 100 +k+lg +D +++ +++++++g +++ ++ BCO21936.1|CBM41|CBM48|GH13_13 216 DKALGdADSRFEPEY--GNQAFTFNGFPELWYT 246 ***999******966..99***99998887665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1359 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 174.95 // Query: AAZ25986.1|CBM41|CBM48|GH13_13 [L=1429] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-20 59.0 0.2 3.4e-20 59.0 0.2 2.7 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.0 0.2 3.4e-20 3.4e-20 2 101 .. 91 205 .. 90 206 .. 0.88 2 ? -3.7 0.0 1 1 79 95 .. 383 399 .. 363 401 .. 0.70 3 ? -3.8 0.1 1 1 38 67 .. 812 841 .. 802 845 .. 0.83 Alignments for each domain: == domain 1 score: 59.0 bits; conditional E-value: 3.4e-20 CBM41.hmm 2 tvrvhYkradgdydgwglwtWgddve...aeps...dwggaleftgkDd.yGayadvklkega.skigfivrkg...dk 69 ++ + Y+radg+y++++++ W++ + a++s +w++ l+ tg D+ yGay+ ++lk+++ ++ +fi++kg ++ AAZ25986.1|CBM41|CBM48|GH13_13 91 QALLFYNRADGEYSDYKMHNWNSAECdayAADSlapSWDNGLAHTGVDPvYGAYWLLNLKDDHnECGHFIIHKGtddAG 169 67899*****************888887545558999*888999****************97725799*****877788 PP CBM41.hmm 70 kdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 k++g gD k++l + + ++ +++sg ++++++p AAZ25986.1|CBM41|CBM48|GH13_13 170 KEFGgGDFKMPLFQddeTYQRMNFTFSGVASIFEYP 205 88999*******9988899999********999886 PP == domain 2 score: -3.7 bits; conditional E-value: 1 CBM41.hmm 79 dllkdgsaevwlvsgde 95 d+++d ++ vw gd+ AAZ25986.1|CBM41|CBM48|GH13_13 383 DMTEDSMTGVWSYTGDA 399 44557799999999987 PP == domain 3 score: -3.8 bits; conditional E-value: 1 CBM41.hmm 38 eftgkDdyGayadvklkegaskigfivrkg 67 +f+g+D G a + +k+ a+ i+++ +++ AAZ25986.1|CBM41|CBM48|GH13_13 812 TFKGTDVVGSSAGMYAKDPADIINYVSKHD 841 689999999999999999999999987766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1429 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 152.01 // Query: QBG37839.1|CBM41|CBM48|GH13_13 [L=1393] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-25 75.2 2.2 3e-25 75.2 2.2 3.2 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.2 2.2 3e-25 3e-25 2 100 .. 139 246 .. 138 248 .. 0.85 2 ? -0.9 0.2 0.16 0.16 30 76 .. 941 990 .. 932 999 .. 0.64 3 ? -2.5 0.5 0.49 0.49 15 42 .. 1287 1314 .. 1277 1346 .. 0.68 Alignments for each domain: == domain 1 score: 75.2 bits; conditional E-value: 3e-25 CBM41.hmm 2 tvrvhYkradgdydgwglwtWgddve..a......epsdw.ggaleftgkDd.yGayadvklkega.skigfivrkgdk 69 ++++ Y+r+d++ydgw l++W+++ + + ++dw +g+++ +g D+ yGay+ ++lk+++ ++ +fiv+kgd+ QBG37839.1|CBM41|CBM48|GH13_13 139 QLVIFYNRPDANYDGWILHLWNNNECdsYadfasdGGTDWaTGQAQ-SGIDTnYGAYWLIDLKADYsDCANFIVHKGDE 216 689*******************9999752455443444**777666.898888**********988357********** PP CBM41.hmm 70 kdlg.gDrkidllkdgsaevwlvsgdekvyts 100 kdlg D+k dl+ g + +w+ sg +++y++ QBG37839.1|CBM41|CBM48|GH13_13 217 KDLGgIDHKADLS--GDRMIWTLSGIDELYSQ 246 ****99*****95..599************86 PP == domain 2 score: -0.9 bits; conditional E-value: 0.16 CBM41.hmm 30 psdwggaleftgkDdyGayadvklkega....skigfivrkgdkkdlggDr 76 + dw ++++ft++ + + + ++l++++ s+ig ++ +++++ + +D QBG37839.1|CBM41|CBM48|GH13_13 941 AGDWFNKVDFTKQRNNWHV-GLPLAQDNegkwSTIGSLIADNQTTVFANDI 990 3389777999887775553.4555543334457888888888777766665 PP == domain 3 score: -2.5 bits; conditional E-value: 0.49 CBM41.hmm 15 dgwglwtWgddveaeps.dwggaleftgk 42 + ++l++ g+++ ++++ +++g+++f+ QBG37839.1|CBM41|CBM48|GH13_13 1287 EAYRLHYKGNNT-YQAVaNFDGDMQFKLA 1314 556677777666.5555455777777443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1393 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 140.71 // Query: BBW90104.1|CBM41|CBM48|GH13_13 [L=1332] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-21 62.2 0.1 3.5e-21 62.2 0.1 3.3 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.2 0.1 3.5e-21 3.5e-21 2 101 .. 90 205 .. 89 206 .. 0.87 2 ? -0.5 0.4 0.11 0.11 22 82 .. 292 357 .. 276 380 .. 0.70 3 ? -3.0 0.3 0.69 0.69 22 58 .. 912 952 .. 901 955 .. 0.56 4 ? -2.0 0.0 0.34 0.34 13 61 .. 1245 1266 .. 1221 1310 .. 0.64 Alignments for each domain: == domain 1 score: 62.2 bits; conditional E-value: 3.5e-21 CBM41.hmm 2 tvrvhYkr.adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfivrkg...d 68 ++++ Y+r ad++y+g++l+ W++dv+ ++p dw + +e +g D+ yGay+ ++lkeg+ ++ +fiv+ g + BBW90104.1|CBM41|CBM48|GH13_13 90 EAVLFYNRlADDNYEGYRLHSWNNDVCdaYAPPfdtsDWANGHEYDGIDPnYGAYWIIDLKEGYnECANFIVHIGtegS 168 57899***6779***************8644445666**777999****************988357******976679 PP CBM41.hmm 69 kkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 +k++g D +++l + + ++ ++ +g+++v+++p BBW90104.1|CBM41|CBM48|GH13_13 169 GKAFGdVDLTMPLMQddeKFQRMNFTIHGEPSVFEYP 205 999999*******99888889999*********9986 PP == domain 2 score: -0.5 bits; conditional E-value: 0.11 CBM41.hmm 22 Wgddveaepsdw.ggaleftgkDdyGayadvklkegaskigfivrkgdkkd......lg.gDrkidllk 82 W+ d ++++ +++l ++g D+ G+ + ++ ++a+ + + ++g++++ ++ g+ +id++ BBW90104.1|CBM41|CBM48|GH13_13 292 WDAD---AAKQLiKQQLVVAGYDADGKLLEATFVQTAKALDALYTQGEDDAneallgVNyGNNTIDVTV 357 4322...3456668999999*******************999999984444346666444666666654 PP == domain 3 score: -3.0 bits; conditional E-value: 0.69 CBM41.hmm 22 Wgddve.aeps.dwggalef..tgkDdyGayadvklkegas 58 W + v+ ++++ +w+ l+ ++++++ +++ ++++++a+ BBW90104.1|CBM41|CBM48|GH13_13 912 WFNAVDlTKENnNWNIGLPNaeKNQEKWSEIMPISANADAQ 952 44455553333477444444234466677777777777665 PP == domain 4 score: -2.0 bits; conditional E-value: 0.34 CBM41.hmm 13 dydgwglwtWgddveaepsdwggaleftgkDdyGayadvklkegaskig 61 y+g gl+t+ ++ +++++ + BBW90104.1|CBM41|CBM48|GH13_13 1245 TYTGDGLYTFSKQL---------------------------SAQSDAYE 1266 45555666665443...........................33222222 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1332 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 123.00 // Query: AMJ84729.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-20 60.6 0.9 1e-20 60.6 0.9 3.1 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.6 0.9 1e-20 1e-20 1 99 [. 90 210 .. 90 212 .. 0.86 2 ? -3.7 0.0 1 1 69 95 .. 379 403 .. 365 405 .. 0.63 3 ? -2.9 0.2 0.62 0.62 33 68 .. 1136 1172 .. 1121 1189 .. 0.67 4 ? -3.2 0.0 0.79 0.79 14 40 .. 1245 1265 .. 1241 1284 .. 0.64 Alignments for each domain: == domain 1 score: 60.6 bits; conditional E-value: 1e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi AMJ84729.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRaavdadnsnNDPAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 167 688999**999998888788899*************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ AMJ84729.1|CBM41|CBM48|GH13_13 168 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 210 ***87778888888*****999977788888899999999875 PP == domain 2 score: -3.7 bits; conditional E-value: 1 CBM41.hmm 69 kkdlggDrkidllkdgsaevwlvsgde 95 +k l +++d+ d+++ vw +gd AMJ84729.1|CBM41|CBM48|GH13_13 379 NKTL--SQRLDMVRDDTSGVWRYEGDM 403 3332..355666667788999999886 PP == domain 3 score: -2.9 bits; conditional E-value: 0.62 CBM41.hmm 33 wggaleftgkDdyGayadvklk.egaskigfivrkgd 68 +g++++t + + G+++ +k++ e+ s+++f +g+ AMJ84729.1|CBM41|CBM48|GH13_13 1136 GDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAADGE 1172 3777888888888888888887357788888666664 PP == domain 4 score: -3.2 bits; conditional E-value: 0.79 CBM41.hmm 14 ydgwglwtWgddveaepsdwggaleft 40 y+g +++t+ +dve g +ef+ AMJ84729.1|CBM41|CBM48|GH13_13 1245 YQGGRVYTFSRDVE------PGTYEFK 1265 88899999999996......3444442 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 135.92 // Query: QPG07119.1|CBM41|CBM48|GH13_13 [L=1333] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-24 70.6 1.6 1.6e-23 69.7 0.1 2.4 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.7 0.1 1.6e-23 1.6e-23 1 101 [. 112 222 .. 112 223 .. 0.87 2 ? -2.9 0.2 0.64 0.64 32 46 .. 930 944 .. 921 973 .. 0.57 Alignments for each domain: == domain 1 score: 69.7 bits; conditional E-value: 1.6e-23 CBM41.hmm 1 ntvrvhYkradgdydgwglwtWgddve..a....eps....dwggaleftgkDd.yGayadvklkegaskigfivrkgd 68 n++ v Y r+dg+ydgwgl++W+ +++ + ++s +w ++++ +g + yGay+ +++++ga++ +fiv+kg+ QPG07119.1|CBM41|CBM48|GH13_13 112 NQIAVFYSREDGQYDGWGLHLWNGQACgnYapatTQStyfsNWADPYPADGVHPeYGAYYILSVEPGAECYNFIVHKGN 190 6899*******************9999873444422268989*********5555************************ PP CBM41.hmm 69 kkdlg.gDrkidllkdgsaevwlvsgdekvytsp 101 +k+lg gD +++ +++++++g +++ ++p QPG07119.1|CBM41|CBM48|GH13_13 191 DKALGgGDSRFEPEF--GNQAFTFNGHPELWYTP 222 ***999******966..99*******99988765 PP == domain 2 score: -2.9 bits; conditional E-value: 0.64 CBM41.hmm 32 dwggaleftgkDdyG 46 dw ++++ft++++ + QPG07119.1|CBM41|CBM48|GH13_13 930 DWFNKVDFTKTESNW 944 554446665554433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1333 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 140.01 // Query: ATG59471.1|CBM41|CBM48|GH13_13 [L=1434] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-21 62.0 0.1 3.8e-21 62.0 0.1 3.3 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.0 0.1 3.8e-21 3.8e-21 2 101 .. 90 205 .. 89 206 .. 0.87 2 ? -0.9 0.3 0.15 0.15 22 80 .. 292 355 .. 277 379 .. 0.69 3 ? -3.1 0.3 0.75 0.75 22 58 .. 912 952 .. 901 955 .. 0.56 4 ? -3.8 0.0 1 1 13 34 .. 1240 1255 .. 1237 1274 .. 0.64 Alignments for each domain: == domain 1 score: 62.0 bits; conditional E-value: 3.8e-21 CBM41.hmm 2 tvrvhYkr.adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfivrkg...d 68 ++++ Y+r ad++y+g++l+ W++dv+ ++p dw + +e +g D+ yGay+ ++lkeg+ ++ +fiv+ g + ATG59471.1|CBM41|CBM48|GH13_13 90 EAVLFYNRlADDNYEGYRLHSWNNDVCdaYAPPfdtsDWANGHEYDGIDPnYGAYWIIDLKEGYnECANFIVHIGtegS 168 57899***6779***************8644445666**777999****************988357******976679 PP CBM41.hmm 69 kkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 +k++g D +++l + + ++ ++ +g+++v+++p ATG59471.1|CBM41|CBM48|GH13_13 169 GKAFGdVDLTMPLMQddeKFQRMNFTIHGEPSVFEYP 205 999999*******99888889999*********9986 PP == domain 2 score: -0.9 bits; conditional E-value: 0.15 CBM41.hmm 22 Wgddveaepsdw.ggaleftgkDdyGayadvklkegaskigfivrkgdkkd......lg.gDrkidl 80 W+ d ++++ +++l ++g D+ G+ + ++ ++a+ + + ++g++++ ++ g+ +id+ ATG59471.1|CBM41|CBM48|GH13_13 292 WDAD---AAKQLiKQQLVVAGYDADGKLLEATFVQTAKALDALYTQGEDDAneallgVNyGNNTIDV 355 4322...3456668999999*****************999999999844442456554445555555 PP == domain 3 score: -3.1 bits; conditional E-value: 0.75 CBM41.hmm 22 Wgddve.aeps.dwggalef..tgkDdyGayadvklkegas 58 W + v+ ++++ +w+ l+ ++++++ +++ ++++++a+ ATG59471.1|CBM41|CBM48|GH13_13 912 WFNAVDlTKENnNWNIGLPNaeKNQEKWSEIMPISANADAQ 952 44455553333477444444234466677777777777665 PP == domain 4 score: -3.8 bits; conditional E-value: 1 CBM41.hmm 13 dydgwglwtWgddveaepsdwg 34 +y+g g++t+ + + ATG59471.1|CBM41|CBM48|GH13_13 1240 SYKGKGIYTFTKTPS------A 1255 699999999985553......2 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1434 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 135.71 // Query: QEY14202.1|CBM41|CBM48|GH13_13 [L=1477] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-09 24.3 1.0 1e-08 22.1 0.2 2.6 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.1 0.2 1e-08 1e-08 12 97 .. 94 206 .. 88 210 .. 0.72 2 ? -2.2 0.0 0.38 0.38 32 47 .. 934 950 .. 925 981 .. 0.58 Alignments for each domain: == domain 1 score: 22.1 bits; conditional E-value: 1e-08 CBM41.hmm 12 gdydgwglwtWgddvea......................eps...dwggaleftgkDd.yGayadvklkegaskigfiv 64 + ++++l++W++ + + ++ + ++D+ yGay+ ++++e ++ +fiv QEY14202.1|CBM41|CBM48|GH13_13 94 AAFAKYNLHLWQSCG-NgwadsvtdgsnttyaipttwpnG-PgiaSKNEGEAGVRHDPyYGAYFVIPVSEAGTCGNFIV 170 556789999997444.234467888888877765555531.123222333333678998******************** PP CBM41.hmm 65 rkgdkkdlggDrkidllk...dgsaevwlvsgdekv 97 ++ ++ ++++D +++++ d + +w+ + +++ QEY14202.1|CBM41|CBM48|GH13_13 171 KTPNTPNQTADLSLNIKRdggDYDRMAWVIVNTDNM 206 ***************988888888888887666655 PP == domain 2 score: -2.2 bits; conditional E-value: 0.38 CBM41.hmm 32 dwggaleftgkDd.yGa 47 dw ++++ft++ + +G+ QEY14202.1|CBM41|CBM48|GH13_13 934 DWFNKVDFTKQSNnWGV 950 55444555544332443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1477 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 74.08 // Query: AZQ83953.1|CBM41|CBM48|GH13_13 [L=1365] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-23 70.0 0.2 1.2e-23 70.0 0.2 2.8 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 70.0 0.2 1.2e-23 1.2e-23 2 101 .. 145 257 .. 144 258 .. 0.89 2 ? -3.7 0.1 1 1 32 47 .. 958 973 .. 950 1005 .. 0.56 3 ? -0.5 0.1 0.11 0.11 20 53 .. 1150 1180 .. 1142 1192 .. 0.71 Alignments for each domain: == domain 1 score: 70.0 bits; conditional E-value: 1.2e-23 CBM41.hmm 2 tvrvhYkradgdydgwglwtWgddve...aeps.......dwggaleftgkDd.yGayadvklkegaskigfivrkgdk 69 ++ + Y+radg+ydgwgl++W+ + + a+p+ +w +++++g + yG y+ +++++ga++ +fi++kg++ AZQ83953.1|CBM41|CBM48|GH13_13 145 QIAIFYQRADGNYDGWGLHLWNGEGCgnyASPTtdsahfnQWPSPYPVDGVHPeYGGYYILSVEPGADCYNFIIHKGND 223 7899******************99999753333455778889********5555************************* PP CBM41.hmm 70 kdlg.gDrkidllk.dgsaevwlvsgdekvytsp 101 k+lg ++ +++ +k ++ +++++++g +++ ++p AZQ83953.1|CBM41|CBM48|GH13_13 224 KALGaNNSRFEPAKaTQGQQAFTFNGYPDIWYTP 257 ****9*******9999***********9998875 PP == domain 2 score: -3.7 bits; conditional E-value: 1 CBM41.hmm 32 dwggaleftgkDdyGa 47 dw + ++ft+ + + AZQ83953.1|CBM41|CBM48|GH13_13 958 DWFNRIDFTQAQSNWN 973 5655566666444333 PP == domain 3 score: -0.5 bits; conditional E-value: 0.11 CBM41.hmm 20 wtWgddveaepsdwggalef..tgkDdyGayadvkl 53 ++ g ++w+++l+f g+D+y ad++ AZQ83953.1|CBM41|CBM48|GH13_13 1150 YLRG-AM----NNWDTSLPFtyIGNDKYRLAADLTQ 1180 4444.33....389999***6567999999998875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1365 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 135.99 // Query: AMN13811.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-20 58.3 1.2 5.6e-20 58.3 1.2 3.7 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.3 1.2 5.6e-20 5.6e-20 1 98 [. 90 209 .. 90 212 .. 0.82 2 ? -0.1 0.0 0.088 0.088 57 96 .. 368 404 .. 355 409 .. 0.77 3 ? -1.4 0.2 0.22 0.22 31 73 .. 1133 1177 .. 1118 1194 .. 0.69 4 ? -3.8 0.0 1 1 14 39 .. 1245 1264 .. 1242 1283 .. 0.66 Alignments for each domain: == domain 1 score: 58.3 bits; conditional E-value: 5.6e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d+ y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi AMN13811.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRaavdadnssNDAAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 167 68899****999999998899***************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvy 98 ++kg ++k++g g+ + +l + + + ++ sg+++++ AMN13811.1|CBM41|CBM48|GH13_13 168 IHKGtddAGKEMGgGNFQGSLVQddeTFVRMNFTLSGEATIF 209 ***877777777778888777775556667777777777776 PP == domain 2 score: -0.1 bits; conditional E-value: 0.088 CBM41.hmm 57 askigfivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 as++ +++ +++k+ ++id+ d+++ vw ++gd + AMN13811.1|CBM41|CBM48|GH13_13 368 ASNVDLLIYNDNKTL---SQRIDMVRDDTSGVWRHEGDMS 404 566777776665554...578999999999*******986 PP == domain 3 score: -1.4 bits; conditional E-value: 0.22 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgdkkdlg 73 + +g++++t + + G+++ +k++ e+ s+++f +g++ ++ AMN13811.1|CBM41|CBM48|GH13_13 1133 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAADGEEGTVT 1177 333478888899999999999999735889999988887665554 PP == domain 4 score: -3.8 bits; conditional E-value: 1 CBM41.hmm 14 ydgwglwtWgddveaepsdwggalef 39 y+g +++t+ +dve g +ef AMN13811.1|CBM41|CBM48|GH13_13 1245 YQGGRIYTFSRDVE------PGTYEF 1264 88889999999996......444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 135.98 // Query: ATG76244.1|CBM41|CBM48|GH13_13 [L=1434] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-20 60.4 2.1 3.5e-20 58.9 0.1 2.9 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.9 0.1 3.5e-20 3.5e-20 1 99 [. 89 203 .. 89 205 .. 0.83 2 ? -1.7 0.3 0.27 0.27 16 71 .. 284 339 .. 280 378 .. 0.70 Alignments for each domain: == domain 1 score: 58.9 bits; conditional E-value: 3.5e-20 CBM41.hmm 1 ntvrvhYkr.adgdydgwglwtWgddve..a....epsdw.ggaleftgkDd.yGayadvklkega.skigfivrkg.. 67 n++++ Y+r +d++y+g++l+ W++dv+ ++sdw +g+++ +g D+ yGay+ +klk+++ ++ +fi++ g ATG76244.1|CBM41|CBM48|GH13_13 89 NEAILFYNRvTDANYEGYRLHSWNNDVCdaFappfDTSDWeNGHVH-DGIDPnYGAYWIIKLKADYnECANFIIHIGte 166 578899***889****************8633343444**777666.****99**********977357******9766 PP CBM41.hmm 68 .dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 d+k++g D +++l + + ++ ++ +g+++v++ ATG76244.1|CBM41|CBM48|GH13_13 167 gDGKAFGdVDLTMPLMQddeKFQRMNFTLHGEPSVFE 203 78899999******99987777888999999998875 PP == domain 2 score: -1.7 bits; conditional E-value: 0.27 CBM41.hmm 16 gwglwtWgddveaepsdw.ggaleftgkDdyGayadvklkegaskigfivrkgdkkd 71 +w+ + + d+ +++++ +++l ++g D G+ + ++ ++a+ + + +++++++ ATG76244.1|CBM41|CBM48|GH13_13 284 DWTAYQGNWDA-EAAKQLiKQQLLVAGFDVDGKLLEASYVQTAKALDALYTQNENDA 339 56666655444.455566688888888999999999988888888888888775444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1434 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 141.17 // Query: AGP85632.1|CBM41|CBM48|GH13_13 [L=1472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-21 61.6 1.0 5e-21 61.6 1.0 3.5 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.6 1.0 5e-21 5e-21 1 99 [. 119 239 .. 119 241 .. 0.87 2 ? -0.2 0.0 0.093 0.093 57 96 .. 397 433 .. 384 437 .. 0.77 3 ? -2.2 0.2 0.37 0.37 31 69 .. 1162 1202 .. 1146 1219 .. 0.67 Alignments for each domain: == domain 1 score: 61.6 bits; conditional E-value: 5e-21 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d+ y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi AGP85632.1|CBM41|CBM48|GH13_13 119 NQAVLYYNRaavdadnssNDAAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 196 68899****999999998899***************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ AGP85632.1|CBM41|CBM48|GH13_13 197 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 239 ***87778888888*****999977788888899999999875 PP == domain 2 score: -0.2 bits; conditional E-value: 0.093 CBM41.hmm 57 askigfivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 as++ +++ +++k+ ++id+ d+++ vw ++gd + AGP85632.1|CBM41|CBM48|GH13_13 397 ASNVDLLIYNDNKTL---SQRIDMVRDDTSGVWRHEGDMS 433 566777776665554...578999999999*******986 PP == domain 3 score: -2.2 bits; conditional E-value: 0.37 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgdk 69 + +g++++t + + G+++ +k++ e+ s+++f +g++ AGP85632.1|CBM41|CBM48|GH13_13 1162 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAADGEE 1202 33347788888888888888888873577888887666644 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1472 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 136.22 // Query: AQP99571.1|CBM41|CBM48|GH13_13 [L=1434] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-21 61.0 2.1 1e-19 57.4 0.0 3.3 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 57.4 0.0 1e-19 1e-19 1 99 [. 89 203 .. 89 205 .. 0.83 2 ? 0.9 0.5 0.041 0.041 15 74 .. 283 342 .. 276 379 .. 0.76 Alignments for each domain: == domain 1 score: 57.4 bits; conditional E-value: 1e-19 CBM41.hmm 1 ntvrvhYkr.adgdydgwglwtWgddve..a....epsdw.ggaleftgkDd.yGayadvklkega.skigfivrkg.. 67 n++++ Y+r +d++y+g++l+ W++dv+ ++sdw +g+++ +g D+ yGay+ +klk+g+ ++ +fi++ g AQP99571.1|CBM41|CBM48|GH13_13 89 NEAILFYNRvTDANYEGYRLHSWNNDVCdaFappfDTSDWaDGHVH-DGIDPnYGAYWVIKLKAGYsECANFIIHIGte 166 578899***889****************8633343444**777666.****99**********988357******9877 PP CBM41.hmm 68 .dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++k++g D +++l + + ++ ++ +g+++v++ AQP99571.1|CBM41|CBM48|GH13_13 167 sTGKAFGdVDLTMPLMQddeKFQRMNFTLHGEPSVFE 203 778888889****999987777888999999988875 PP == domain 2 score: 0.9 bits; conditional E-value: 0.041 CBM41.hmm 15 dgwglwtWgddveaepsdw.ggaleftgkDdyGayadvklkegaskigfivrkgdkkdlgg 74 ++w+ + + d+ +++++ +++l ++g D+ G+ + ++ ++a+ + + +++++++ ++ AQP99571.1|CBM41|CBM48|GH13_13 283 SDWTAYQGNWDT-EAAKQLiKQQLLVAGFDTDGKLLEASYVQTAKALDALYTQNENDANEA 342 567777766555.4566777999999*******************9999999985555332 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1434 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 146.87 // Query: AWL11060.1|CBM41|CBM48|GH13_13 [L=1445] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-19 57.1 0.9 7.7e-19 54.6 0.2 2.7 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 54.6 0.2 7.7e-19 7.7e-19 1 99 [. 89 214 .. 89 216 .. 0.87 2 ? -1.1 0.0 0.18 0.18 30 78 .. 916 968 .. 908 983 .. 0.72 Alignments for each domain: == domain 1 score: 54.6 bits; conditional E-value: 7.7e-19 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve...aeps...dwggaleftgkDd.yGayadvklkega.....sk 59 n+++++Y+r +d y+g++l+tW++d + +++s +w++ le +g D+ yGay+ +klk+g + AWL11060.1|CBM41|CBM48|GH13_13 89 NEAVLYYNRpqdasnesDDPVYEGYRLHTWNNDECdayQAESiapSWDNGLEYDGIDPnYGAYWILKLKDGVagsegAC 167 678999***9998888777899*************97544558999*889*******************9666666568 PP CBM41.hmm 60 igfivrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 +fi++ g ++k++g gD+k++l++ d ++ w sg+++v++ AWL11060.1|CBM41|CBM48|GH13_13 168 GNFIIHIGtddAGKEMGgGDKKMPLAQddpDFTRMNWALSGEPDVFE 214 ******876678888888*******9999999999*******99986 PP == domain 2 score: -1.1 bits; conditional E-value: 0.18 CBM41.hmm 30 ps.dwggaleftgkDd.yGayadvklke..gaskigfivrkgdkkdlggDrki 78 +s dw + l+ft + + +G+ ++ ++ + ++ig i+ + +++ ++D ++ AWL11060.1|CBM41|CBM48|GH13_13 916 DSgDWFNRLDFTMQSNnFGVGLPLEQDNggNWETIGEILGDSNAQVSSSDIMF 968 34699888***876665*99988888874344789998888877766677666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1445 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 136.99 // Query: AJP43907.1|CBM41|CBM48|GH13_13 [L=1467] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-22 65.8 3.4 1.3e-21 63.5 1.3 3.4 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.5 1.3 1.3e-21 1.3e-21 1 101 [. 115 237 .. 115 238 .. 0.86 2 ? -1.4 0.0 0.21 0.21 74 96 .. 407 429 .. 390 433 .. 0.80 3 ? -2.1 0.0 0.35 0.35 48 77 .. 1407 1437 .. 1370 1446 .. 0.71 Alignments for each domain: == domain 1 score: 63.5 bits; conditional E-value: 1.3e-21 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d++ ++++dw +g + tg D+ yGay+ ++lkeg+ ++ +fi AJP43907.1|CBM41|CBM48|GH13_13 115 NQAVLYYNRaavdadnssNDPAYEGWRLHTWNNDTCdayaDADTDWaNG-RTHTGIDPnYGAYWILELKEGYgDCHNFI 192 688999***99999888888999*************97533555**666.666****99***********99568**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 ++kg ++k++g gD + +l + + + ++ sg+++++++p AJP43907.1|CBM41|CBM48|GH13_13 193 IHKGtddAGKEMGgGDFQASLVQdddTFVRMNFTLSGEPTLFEYP 237 ***87778888888*****99997778889999999999999876 PP == domain 2 score: -1.4 bits; conditional E-value: 0.21 CBM41.hmm 74 gDrkidllkdgsaevwlvsgdek 96 +++i++l d+ + vw +gd + AJP43907.1|CBM41|CBM48|GH13_13 407 LNQRIEMLRDDVSGVWRYEGDMS 429 58999***************986 PP == domain 3 score: -2.1 bits; conditional E-value: 0.35 CBM41.hmm 48 yadvklkegaskigfivrkgdkkdlg.gDrk 77 a+v+l + ++ ++ +v +g++k lg ++ + AJP43907.1|CBM41|CBM48|GH13_13 1407 WATVNLGNPNDAVSNLVVEGEAKTLGsSNNN 1437 4678888888889999999988886654443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1467 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.17 // Query: AGQ01839.1|CBM41|CBM48|GH13_13 [L=1472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-20 60.6 0.9 1.1e-20 60.6 0.9 3.1 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.6 0.9 1.1e-20 1.1e-20 1 99 [. 119 239 .. 119 241 .. 0.86 2 ? -3.7 0.0 1 1 69 95 .. 408 432 .. 394 434 .. 0.63 3 ? -2.9 0.2 0.63 0.63 33 68 .. 1165 1201 .. 1150 1218 .. 0.67 4 ? -3.2 0.0 0.81 0.81 14 40 .. 1274 1294 .. 1270 1313 .. 0.64 Alignments for each domain: == domain 1 score: 60.6 bits; conditional E-value: 1.1e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi AGQ01839.1|CBM41|CBM48|GH13_13 119 NQAVLYYNRaavdadnsnNDPAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 196 688999**999998888788899*************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ AGQ01839.1|CBM41|CBM48|GH13_13 197 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 239 ***87778888888*****999977788888899999999875 PP == domain 2 score: -3.7 bits; conditional E-value: 1 CBM41.hmm 69 kkdlggDrkidllkdgsaevwlvsgde 95 +k l +++d+ d+++ vw +gd AGQ01839.1|CBM41|CBM48|GH13_13 408 NKTL--SQRLDMVRDDTSGVWRYEGDM 432 3332..355666667788999999886 PP == domain 3 score: -2.9 bits; conditional E-value: 0.63 CBM41.hmm 33 wggaleftgkDdyGayadvklk.egaskigfivrkgd 68 +g++++t + + G+++ +k++ e+ s+++f +g+ AGQ01839.1|CBM41|CBM48|GH13_13 1165 GDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAADGE 1201 3777888888888888888887357788888666664 PP == domain 4 score: -3.2 bits; conditional E-value: 0.81 CBM41.hmm 14 ydgwglwtWgddveaepsdwggaleft 40 y+g +++t+ +dve g +ef+ AGQ01839.1|CBM41|CBM48|GH13_13 1274 YQGGRVYTFSRDVE------PGTYEFK 1294 88899999999996......3444442 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1472 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 137.19 // Query: QBF81998.1|CBM41|CBM48|GH13_13 [L=1446] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-18 52.4 1.1 3.8e-18 52.4 1.1 2.3 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 52.4 1.1 3.8e-18 3.8e-18 1 82 [. 89 190 .. 89 217 .. 0.81 2 ? -3.4 0.1 0.91 0.91 16 42 .. 920 945 .. 913 964 .. 0.48 Alignments for each domain: == domain 1 score: 52.4 bits; conditional E-value: 3.8e-18 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r ++ +y g++l+tW++d++ ++p dw + + +g D+ yGay+ ++lkeg+ ++ +fi QBF81998.1|CBM41|CBM48|GH13_13 89 NQAVLYYNRikdkdnsdSNPNYPGYKLHTWNNDACdaYAPPfdstDWANGHSYDGIDPnYGAYWILDLKEGHsECANFI 167 68999*****99999766689**************86444456669*777999****************988357**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk 82 v+ g ++k+lg +D k++l+ QBF81998.1|CBM41|CBM48|GH13_13 168 VHIGtegSGKALGdADLKMNLKP 190 **976679999999999999865 PP == domain 2 score: -3.4 bits; conditional E-value: 0.91 CBM41.hmm 16 gwglwtWgddveaeps.dwggaleftgk 42 + +++ + d+ + ++ +w+ l+ ++ QBF81998.1|CBM41|CBM48|GH13_13 920 SGDWFNYV-DF-TMETnNWNVGLPLAQD 945 44444444.33.2222355544444333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1446 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 141.06 // Query: AIF98912.1|CBM41|CBM48|GH13_13 [L=1442] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-23 70.2 1.3 1.3e-21 63.6 1.3 3.5 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.6 1.3 1.3e-21 1.3e-21 1 101 [. 90 212 .. 90 213 .. 0.86 2 ? 2.3 0.0 0.015 0.015 74 100 .. 382 408 .. 361 410 .. 0.82 Alignments for each domain: == domain 1 score: 63.6 bits; conditional E-value: 1.3e-21 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d++ ++++dw +g + tg D+ yGay+ ++lkeg+ ++ +fi AIF98912.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRaavdadnssNDPAYEGWRLHTWNNDTCdayaDADTDWaNG-RTHTGIDPnYGAYWILELKEGYgDCHNFI 167 688999***99999888888999*************97533555**666.666****99***********99568**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 ++kg ++k++g gD + +l + + + ++ sg+++++++p AIF98912.1|CBM41|CBM48|GH13_13 168 IHKGtddAGKEMGgGDFQASLVQdddTFVRMNFTLSGEPTLFEYP 212 ***87778888888*****99997778889999999999999876 PP == domain 2 score: 2.3 bits; conditional E-value: 0.015 CBM41.hmm 74 gDrkidllkdgsaevwlvsgdekvyts 100 +++i++l d+ + vw +gd ++y + AIF98912.1|CBM41|CBM48|GH13_13 382 LNQRIEMLRDDVSGVWRYEGDMSLYRQ 408 5899********************975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1442 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 138.45 // Query: CAL34055.1|CBM41|CBM48|GH13_13 [L=1440] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-20 60.5 1.9 1.1e-20 60.5 1.9 2.8 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.5 1.9 1.1e-20 1.1e-20 1 101 [. 90 213 .. 90 214 .. 0.87 2 ? -1.2 0.8 0.19 0.19 12 57 .. 910 956 .. 905 964 .. 0.69 Alignments for each domain: == domain 1 score: 60.5 bits; conditional E-value: 1.1e-20 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve...aeps....dwggaleftgkDd.yGayadvklkega.skigf 62 n+++++Y+r ++++y +++l+tW+d+++ a+ dw++ ++f+g D+ yGay+ ++lkeg+ + +f CAL34055.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRikdknntaSNAEYPKYKLHTWNDEKCdayAA-PfdtsDWSNGHPFDGIDPnYGAYWILNLKEGYgACGNF 167 68999****999999877799**********999986322.23556**888********************99458*** PP CBM41.hmm 63 ivrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 iv+ g ++k+lg ++ +++l + + + ++ +g+++vy++p CAL34055.1|CBM41|CBM48|GH13_13 168 IVHAGtddAGKALGkNNLTMSLVQddaTYVRVNFTIHGESDVYEYP 213 ***987778899999*******99888899999**********987 PP == domain 2 score: -1.2 bits; conditional E-value: 0.19 CBM41.hmm 12 gdydgwglwtWgddveaepsdwggalef..tgkDdyGayadvklkega 57 ++yd+ +++ + d+++++++w+ l+ ++ ++ ++a ++++++a CAL34055.1|CBM41|CBM48|GH13_13 910 NSYDSGDWFNYV-DFTYNTNNWNVGLPLaqDNSSKWTQIAGISANPNA 956 678888888887.55355558988888843456668889888888765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1440 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 149.30 // Query: AEE23247.1|CBM41|CBM48|GH13_13 [L=1450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-18 52.8 0.1 1.3e-17 50.7 0.1 2.2 1 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 50.7 0.1 1.3e-17 1.3e-17 10 97 .. 107 211 .. 91 215 .. 0.82 Alignments for each domain: == domain 1 score: 50.7 bits; conditional E-value: 1.3e-17 CBM41.hmm 10 adgdydgwglwtWgddve....aepsdwggaleftgkDd.yGayadvklkega.....skigfivrkg...dkkdlg.g 74 +d+ y+g++l+tW++d++ ++++dw + e tg D+ yGay+ v+lk+g+ + +fi++ g ++k+lg g AEE23247.1|CBM41|CBM48|GH13_13 107 NDETYTGYRLHTWNNDTCdayaDADTDWANGREHTGIDPnYGAYWVVDLKPGYagtpgACGNFIIHIGtddAGKELGgG 185 6899**************97533555**666888*****9**********9887888779******876678899999* PP CBM41.hmm 75 Drkidllk...dgsaevwlvsgdekv 97 D k++l++ d + +++ g +++ AEE23247.1|CBM41|CBM48|GH13_13 186 DFKMPLSQddpDFARMNFTFTGVASI 211 ******99666556666666666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1450 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 152.14 // Query: QDG34867.1|CBM41|CBM48|GH13_13 [L=1472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-20 60.6 0.9 1.1e-20 60.6 0.9 3.5 6 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.6 0.9 1.1e-20 1.1e-20 1 99 [. 119 239 .. 119 241 .. 0.86 2 ? -3.7 0.0 1 1 69 95 .. 408 432 .. 394 434 .. 0.63 3 ? -4.0 0.8 1 1 13 42 .. 931 959 .. 927 970 .. 0.61 4 ? -1.7 0.1 0.27 0.27 31 70 .. 1162 1203 .. 1146 1222 .. 0.68 5 ? -2.6 0.0 0.52 0.52 13 45 .. 1273 1300 .. 1269 1311 .. 0.76 6 ? -3.9 0.1 1 1 32 57 .. 1377 1402 .. 1364 1422 .. 0.70 Alignments for each domain: == domain 1 score: 60.6 bits; conditional E-value: 1.1e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi QDG34867.1|CBM41|CBM48|GH13_13 119 NQAVLYYNRaavdadnsnNDPAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 196 688999**999998888788899*************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ QDG34867.1|CBM41|CBM48|GH13_13 197 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 239 ***87778888888*****999977788888899999999875 PP == domain 2 score: -3.7 bits; conditional E-value: 1 CBM41.hmm 69 kkdlggDrkidllkdgsaevwlvsgde 95 +k l +++d+ d+++ vw +gd QDG34867.1|CBM41|CBM48|GH13_13 408 NKTL--SQRLDMVRDDTSGVWRYEGDM 432 3332..355666667788999999886 PP == domain 3 score: -4.0 bits; conditional E-value: 1 CBM41.hmm 13 dydgwglwtWgddveaepsdwggaleftgk 42 yd+ +++ + d+++e+++w+ l+ ++ QDG34867.1|CBM41|CBM48|GH13_13 931 TYDSGDWFNYV-DFTYETNNWNVGLPLAQD 959 56666666666.443444477777777553 PP == domain 4 score: -1.7 bits; conditional E-value: 0.27 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgdkk 70 + +g++++t + + G+++ +k++ e+ s+++f +g++ QDG34867.1|CBM41|CBM48|GH13_13 1162 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAANGEEG 1203 333478888888888999999999735779999977777544 PP == domain 5 score: -2.6 bits; conditional E-value: 0.52 CBM41.hmm 13 dydgwglwtWgddveaepsdwggalef.tgkDdy 45 y+g +++t+++dve g++ef Dd+ QDG34867.1|CBM41|CBM48|GH13_13 1273 AYQGGRIYTFARDVE------PGSYEFkVASDDW 1300 5899999***99997......7777773335555 PP == domain 6 score: -3.9 bits; conditional E-value: 1 CBM41.hmm 32 dwggaleftgkDdyGayadvklkega 57 wg+ ft +++ ++ad++l++g+ QDG34867.1|CBM41|CBM48|GH13_13 1377 GWGAVDMFTYQGEGVYTADIELSAGS 1402 46666667888888888888888765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1472 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 125.95 // Query: QYK05561.1|CBM41|CBM48|GH13_13 [L=1441] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-22 64.5 0.1 6.3e-22 64.5 0.1 2.6 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.5 0.1 6.3e-22 6.3e-22 1 101 [. 89 212 .. 89 213 .. 0.86 2 ? -1.2 0.6 0.18 0.18 12 62 .. 910 965 .. 905 968 .. 0.65 Alignments for each domain: == domain 1 score: 64.5 bits; conditional E-value: 6.3e-22 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d ydg++l+tW++d++ ++p dw + +ef+g D+ yGay+ ++lkeg+ ++ +fi QYK05561.1|CBM41|CBM48|GH13_13 89 NEAVIYYNRpkdadnspNDPVYDGYRLHTWNNDTCdaYAPPfdssDWANGHEFDGIDPnYGAYWILNLKEGYgECGNFI 167 6799*****9998888777889*************8644445666**888********************99568**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 ++ g ++k+lg gD k++l++ + + ++ +g ++v+++p QYK05561.1|CBM41|CBM48|GH13_13 168 IHVGtegSGKALGdGDFKMPLKQddeKFVRMNFTLHGTPSVFEYP 212 **977779999999*******997777778889999999999876 PP == domain 2 score: -1.2 bits; conditional E-value: 0.18 CBM41.hmm 12 gdydgwglwtWgddveaepsdwggalef..tgkDdyGayadvklkega....skigf 62 ++yd+ +++ + d+++++++w+ l+ ++++++ + +++++++ s+igf QYK05561.1|CBM41|CBM48|GH13_13 910 NSYDSGDWFNYV-DFTQSGNNWNVGLPLaqDNQGNWNTISGISANPNTaasaSEIGF 965 678888888888.54345668977777744667778888888887643333355665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1441 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 138.81 // Query: QCU75576.1|CBM41|CBM48|GH13_13 [L=1433] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-21 62.2 0.1 3.4e-21 62.2 0.1 3.4 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.2 0.1 3.4e-21 3.4e-21 2 101 .. 90 205 .. 89 206 .. 0.87 2 ? -1.6 0.3 0.25 0.25 29 71 .. 296 339 .. 276 407 .. 0.70 3 ? -2.5 0.4 0.47 0.47 12 56 .. 905 950 .. 901 960 .. 0.62 4 ? -3.2 0.0 0.77 0.77 13 39 .. 1240 1260 .. 1236 1283 .. 0.62 Alignments for each domain: == domain 1 score: 62.2 bits; conditional E-value: 3.4e-21 CBM41.hmm 2 tvrvhYkr.adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfivrkg...d 68 ++++ Y+r ad++y+g++l+ W++dv+ ++p dw + +e +g D+ yGay+ ++lkeg+ ++ +fi++ g + QCU75576.1|CBM41|CBM48|GH13_13 90 EAVLFYNRlADDNYEGYRLHSWNNDVCdaYAPPfdtsDWANGHEYDGIDPnYGAYWIINLKEGYnECANFIIHIGtegS 168 57899***6779***************8644445666**777999****************988357******976679 PP CBM41.hmm 69 kkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 +k++g D +++l + + ++ ++ +g+++v+++p QCU75576.1|CBM41|CBM48|GH13_13 169 GKAFGdVDLTMPLMQddeTFQRMNFTIHGEPSVFEYP 205 999999*******9988889999**********9986 PP == domain 2 score: -1.6 bits; conditional E-value: 0.25 CBM41.hmm 29 epsdw.ggaleftgkDdyGayadvklkegaskigfivrkgdkkd 71 ++++ + +l +g D+ G + ++ ++a+ + + ++g++++ QCU75576.1|CBM41|CBM48|GH13_13 296 TAKTLiKSQLVIAGYDSEGTLLEASYVQTAKALDALYTQGEDDA 339 23355577788888888888888888888888888888874433 PP == domain 3 score: -2.5 bits; conditional E-value: 0.47 CBM41.hmm 12 gdydgwglwtWgddveaeps.dwggaleftgkDd..yGayadvklkeg 56 ++yd+ +++ + d+ ++++ +w+ l+ ++ + + +++ ++++ + QCU75576.1|CBM41|CBM48|GH13_13 905 NSYDSGDWFNFV-DF-TKDTnNWNIGLPLAQDNEvkWQEIMPISANTQ 950 677788888887.66.45666886667764433323777776666654 PP == domain 4 score: -3.2 bits; conditional E-value: 0.77 CBM41.hmm 13 dydgwglwtWgddveaepsdwggalef 39 +y+g g++t+ + + +++ef QCU75576.1|CBM41|CBM48|GH13_13 1240 SYKGKGIYTFTKTLS------AASYEF 1260 799999999995553......333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1433 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.04 // Query: ABD79824.1|CBM41|CBM48|GH13_13 [L=1432] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-17 50.8 0.2 8.6e-17 48.0 0.0 2.7 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 48.0 0.0 8.6e-17 8.6e-17 1 98 [. 90 202 .. 90 205 .. 0.84 2 ? -3.9 0.0 1 1 80 96 .. 382 398 .. 367 399 .. 0.69 3 ? -3.5 0.0 0.99 0.99 34 82 .. 490 540 .. 476 553 .. 0.65 Alignments for each domain: == domain 1 score: 48.0 bits; conditional E-value: 8.6e-17 CBM41.hmm 1 ntvrvhYkradgdydgwglwtWgddve...aeps...dwggaleftgkDd.yGayadvklkega.skigfivrkg...d 68 n++++ +++adgdy+g++l+ W+++++ ae+s +w++ l +g D+ yGay+ ++l eg+ ++ +fi++ g + ABD79824.1|CBM41|CBM48|GH13_13 90 NQAILFFNKADGDYEGYRLHNWNSETCnayAEGSlaaSWSNGLVHSGVDPvYGAYWLLDLVEGHdDCGHFIIHVGtddA 168 678999*********************97656669999*666777****************98835799****977678 PP CBM41.hmm 69 kkdlg.gDrkidllk...dgsaevwlvsgdekvy 98 +k++g gD ++l++ + ++ +++sg +v+ ABD79824.1|CBM41|CBM48|GH13_13 169 GKEMGgGDWIMPLAQddpKFTRMNFTFSGVGSVF 202 8888889999999988777778888888887776 PP == domain 2 score: -3.9 bits; conditional E-value: 1 CBM41.hmm 80 llkdgsaevwlvsgdek 96 +++d s+ +w + gd++ ABD79824.1|CBM41|CBM48|GH13_13 382 MNEDTSTGIWSFAGDSN 398 33456888999998875 PP == domain 3 score: -3.5 bits; conditional E-value: 0.99 CBM41.hmm 34 ggaleftgkDd.yGayadvklkegaskigfivrkg.dkkdlggDrkidllk 82 g+ l+ft++++ +y + +++g ++++++ ++ ++ + ++ ++i+l++ ABD79824.1|CBM41|CBM48|GH13_13 490 GKYLAFTETESnAVKYLQRMAESGVTHFHMLPANDiATVNEDESEQINLTS 540 666777776654677777777777788888888776555545666666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1432 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 137.90 // Query: APD99602.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-20 60.6 0.9 1e-20 60.6 0.9 3.3 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.6 0.9 1e-20 1e-20 1 99 [. 90 210 .. 90 212 .. 0.86 2 ? -1.7 0.1 0.26 0.26 31 70 .. 1133 1174 .. 1117 1193 .. 0.68 3 ? -2.5 0.0 0.49 0.49 13 45 .. 1244 1271 .. 1240 1283 .. 0.75 4 ? -3.9 0.1 1 1 32 57 .. 1348 1373 .. 1335 1393 .. 0.70 Alignments for each domain: == domain 1 score: 60.6 bits; conditional E-value: 1e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi APD99602.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRaavdadnsnNDPAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 167 688999**999998888788899*************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ APD99602.1|CBM41|CBM48|GH13_13 168 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 210 ***87778888888*****999977788888899999999875 PP == domain 2 score: -1.7 bits; conditional E-value: 0.26 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgdkk 70 + +g++++t + + G+++ +k++ e+ s+++f +g++ APD99602.1|CBM41|CBM48|GH13_13 1133 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAANGEEG 1174 333478888888888999999999735779999977777544 PP == domain 3 score: -2.5 bits; conditional E-value: 0.49 CBM41.hmm 13 dydgwglwtWgddveaepsdwggalef.tgkDdy 45 y+g +++t+++dve g++ef Dd+ APD99602.1|CBM41|CBM48|GH13_13 1244 AYQGGRIYTFARDVE------PGSYEFkVASDDW 1271 5899999***99997......7777773335555 PP == domain 4 score: -3.9 bits; conditional E-value: 1 CBM41.hmm 32 dwggaleftgkDdyGayadvklkega 57 wg+ ft +++ ++ad++l++g+ APD99602.1|CBM41|CBM48|GH13_13 1348 GWGAVDMFTYQGEGVYTADIELSAGS 1373 46666667888888888888888765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 131.09 // Query: QHJ10391.1|CBM41|CBM48|GH13_13 [L=1450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-18 51.9 0.2 1.9e-17 50.2 0.2 1.9 1 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 50.2 0.2 1.9e-17 1.9e-17 10 97 .. 107 211 .. 91 215 .. 0.82 Alignments for each domain: == domain 1 score: 50.2 bits; conditional E-value: 1.9e-17 CBM41.hmm 10 adgdydgwglwtWgddve....aepsdwggaleftgkDd.yGayadvklkega.....skigfivrkg...dkkdlg.g 74 +d+ y+g++l+tW++d++ ++++dw + e tg D+ yGay+ ++lk+++ + +fi++ g ++k+lg g QHJ10391.1|CBM41|CBM48|GH13_13 107 NDETYTGYRLHTWNNDACdayaDADTDWANGREHTGIDPnYGAYWVLELKPDYagttgACGNFIIHVGtddAGKELGgG 185 6899**************97533555**666888*****9**********9887877668******977778899999* PP CBM41.hmm 75 Drkidllk...dgsaevwlvsgdekv 97 D k++l++ d + +++ g +++ QHJ10391.1|CBM41|CBM48|GH13_13 186 DFKMPLSQddpDFARMNFTFTGVASI 211 ******99666556666666666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1450 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 145.61 // Query: ABG40459.1|CBM41|CBM48|GH13_13 [L=1450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-18 51.5 0.3 2.6e-17 49.7 0.3 1.9 1 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.7 0.3 2.6e-17 2.6e-17 10 82 .. 107 193 .. 92 213 .. 0.84 Alignments for each domain: == domain 1 score: 49.7 bits; conditional E-value: 2.6e-17 CBM41.hmm 10 adgdydgwglwtWgddve....aepsdwggaleftgkDd.yGayadvklkega.....skigfivrkg...dkkdlg.g 74 +d+ y+g++l+tW++d++ ++++dw + e tg D+ yGay+ ++lk+++ + +fi++ g ++k+lg g ABG40459.1|CBM41|CBM48|GH13_13 107 NDETYTGYRLHTWNNDTCdayaDADTDWANGREHTGIDPnYGAYWVLELKPDYagtlgACGNFIIHVGtddAGKELGgG 185 789***************97533555**666888*****9**********9887888779******977678899999* PP CBM41.hmm 75 Drkidllk 82 D +++l++ ABG40459.1|CBM41|CBM48|GH13_13 186 DFTMPLSQ 193 *****998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1450 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 147.99 // Query: ASP49858.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-22 66.3 2.3 4.9e-22 64.9 0.7 2.6 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.9 0.7 4.9e-22 4.9e-22 1 98 [. 90 202 .. 90 205 .. 0.87 2 ? -1.2 0.0 0.19 0.19 67 98 .. 371 400 .. 353 404 .. 0.72 Alignments for each domain: == domain 1 score: 64.9 bits; conditional E-value: 4.9e-22 CBM41.hmm 1 ntvrvhYkradgdydgwglwtWgddve...aeps...dwggaleftgkDd.yGayadvklkega.skigfivrkg...d 68 n+++++Y+r+d++y++++++ W+d ++ a++s +w++ l tg D+ yGay+ ++lkeg+ ++ +fiv+kg + ASP49858.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRTDENYAEYKVHNWNDTTCdayADDSiapSWDNGLSLTGIDPvYGAYWVFNLKEGYnECGNFIVHKGtddA 168 6899*******************888887434448899*889********************88357*******87778 PP CBM41.hmm 69 kkdlg.gDrkidllk...dgsaevwlvsgdekvy 98 +k++g g+ k++l + + ++ ++ sg+ +v+ ASP49858.1|CBM41|CBM48|GH13_13 169 GKEFGgGNFKMPLMQeneTYQRMNFTISGEGSVF 202 888999*******998888888999999998887 PP == domain 2 score: -1.2 bits; conditional E-value: 0.19 CBM41.hmm 67 gdkkdlggDrkidllkdgsaevwlvsgdekvy 98 +++k+l++ ++++ + + +w +gd+++ ASP49858.1|CBM41|CBM48|GH13_13 371 DSEKNLTATHQMSED--SATGIWSYQGDASLN 400 456666766666654..4899******99865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 153.15 // Query: QLE08094.1|CBM41|CBM48|GH13_13 [L=1438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-20 59.1 0.5 3.1e-20 59.1 0.5 3.6 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.1 0.5 3.1e-20 3.1e-20 2 101 .. 92 207 .. 91 208 .. 0.85 2 ? -2.3 0.3 0.42 0.42 16 67 .. 287 338 .. 283 361 .. 0.69 3 ! 3.8 0.5 0.0051 0.0051 12 60 .. 908 957 .. 903 967 .. 0.77 4 ? -3.1 0.0 0.73 0.73 14 45 .. 1244 1269 .. 1239 1311 .. 0.60 Alignments for each domain: == domain 1 score: 59.1 bits; conditional E-value: 3.1e-20 CBM41.hmm 2 tvrvhYkr.adgdydgwglwtWgddve..a.eps....dwggaleftgkDd.yGayadvklkega.skigfivrkg... 67 ++++ Y+r +d+ y+g++l+ W++d + + + dw + +e +g D+ yGay+ vklkeg+ ++ +fiv+ g QLE08094.1|CBM41|CBM48|GH13_13 92 EAILFYNRtSDDAYEGYRLHSWNNDDCdaYaA-PfdatDWANGHEYDGIDPnYGAYWIVKLKEGYnECANFIVHIGteg 169 57889*9945599**********999986232.23555**777999****************988357******97667 PP CBM41.hmm 68 dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 ++k++g D k++l + + ++ ++ +g+++v+++p QLE08094.1|CBM41|CBM48|GH13_13 170 SGKAFGdVDLKMPLMQddeKFQRMNFTIHGEPSVFEYP 207 9999999*******99888889999*********9986 PP == domain 2 score: -2.3 bits; conditional E-value: 0.42 CBM41.hmm 16 gwglwtWgddveaepsdw.ggaleftgkDdyGayadvklkegaskigfivrkg 67 gw+ + d+ +++++ +++l ++g D+ G+ ++ ++ ++a+ + + + g QLE08094.1|CBM41|CBM48|GH13_13 287 GWNAYQGSWDA-TAAKELiKQQLVVAGYDADGKLIEATYVQTAKALDDLYTSG 338 67777655444.45556668888889999999999888888877666555555 PP == domain 3 score: 3.8 bits; conditional E-value: 0.0051 CBM41.hmm 12 gdydgwglwtWgddveaeps.dwggalef..tgkDdyGayadvklkegaski 60 ++yd+ +++ + d+ + ++ +w+ l++ +++ ++G++a ++++++a+ + QLE08094.1|CBM41|CBM48|GH13_13 908 NSYDSGDWFNFV-DF-SMDTnNWNVGLPPaqDNQAKWGEIAPISANPNAQAM 957 678888888888.77.455569*9999995455677**********998654 PP == domain 4 score: -3.1 bits; conditional E-value: 0.73 CBM41.hmm 14 ydgwglwtWgddveaepsdwggaleftgkDdy 45 y+g g++t+ ++ + g++ef+ + QLE08094.1|CBM41|CBM48|GH13_13 1244 YQGKGIYTFTKQLS------AGSYEFKVASED 1269 78888888886653......555555433333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1438 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 135.91 // Query: ADT93524.1|CBM41|CBM48|GH13_13 [L=1440] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-20 60.5 1.9 1.1e-20 60.5 1.9 2.8 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.5 1.9 1.1e-20 1.1e-20 1 101 [. 90 213 .. 90 214 .. 0.87 2 ? -1.2 0.8 0.19 0.19 12 57 .. 910 956 .. 905 964 .. 0.69 Alignments for each domain: == domain 1 score: 60.5 bits; conditional E-value: 1.1e-20 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve...aeps....dwggaleftgkDd.yGayadvklkega.skigf 62 n+++++Y+r ++++y +++l+tW+d+++ a+ dw++ ++f+g D+ yGay+ ++lkeg+ + +f ADT93524.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRikdknntaSNAEYPKYKLHTWNDEKCdayAA-PfdtsDWSNGHPFDGIDPnYGAYWILNLKEGYgACGNF 167 68999****999999877799**********999986322.23556**888********************99458*** PP CBM41.hmm 63 ivrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 iv+ g ++k+lg ++ +++l + + + ++ +g+++vy++p ADT93524.1|CBM41|CBM48|GH13_13 168 IVHAGtddAGKALGkNNLTMSLVQddaTYVRVNFTIHGESDVYEYP 213 ***987778899999*******99888899999**********987 PP == domain 2 score: -1.2 bits; conditional E-value: 0.19 CBM41.hmm 12 gdydgwglwtWgddveaepsdwggalef..tgkDdyGayadvklkega 57 ++yd+ +++ + d+++++++w+ l+ ++ ++ ++a ++++++a ADT93524.1|CBM41|CBM48|GH13_13 910 NSYDSGDWFNYV-DFTYNTNNWNVGLPLaqDNSSKWTQIAGISANPNA 956 678888888887.55355558988888843456668889888888765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1440 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 158.84 // Query: QSX37546.1|CBM41|CBM48|GH13_13 [L=1445] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-20 57.8 0.5 8.1e-20 57.8 0.5 2.8 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 57.8 0.5 8.1e-20 8.1e-20 1 83 [. 89 200 .. 89 218 .. 0.78 2 ? 0.9 0.7 0.042 0.042 12 62 .. 914 969 .. 909 973 .. 0.72 Alignments for each domain: == domain 1 score: 57.8 bits; conditional E-value: 8.1e-20 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve...aeps....dwggaleftgkDd.yGayadvklkega.skigf 62 n+++++Y+r a+ +y g++l+tW++d++ a+ dw + +ef+g D+ yGay+ ++lkeg+ ++ +f QSX37546.1|CBM41|CBM48|GH13_13 89 NQAVLYYNRikdkdnssANPNYPGYKLHTWNNDTCdayAA-PfdtsDWANGHEFDGIDPnYGAYWILNLKEGHsDCANF 166 68899****99999887778***************86422.23556**888*******************988357*** PP CBM41.hmm 63 ivrkg...dkkdlg.gDrkidllk.........d 83 iv+ g ++k+lg gD k++l+ QSX37546.1|CBM41|CBM48|GH13_13 167 IVHIGtegSGKALGdGDLKMNLKPfedptaaeaR 200 ***976679999999****999766665444444 PP == domain 2 score: 0.9 bits; conditional E-value: 0.042 CBM41.hmm 12 gdydgwglwtWgddveaepsdwggalef..tgkDdyGayadvklkega....skigf 62 ++yd+ +++ + d+++++++w+ l+ ++++++ +a +++++++ s+igf QSX37546.1|CBM41|CBM48|GH13_13 914 NSYDSGDWFNYV-DFTQSGNNWNVGLPLaqDNQGNWNTIAGISANPNTaasaSEIGF 969 678888888888.55356669988888855779999999999999754344467776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1445 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 146.88 // Query: QGX61843.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-20 60.6 0.9 1e-20 60.6 0.9 3.4 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.6 0.9 1e-20 1e-20 1 99 [. 90 210 .. 90 212 .. 0.86 2 ? -3.7 0.0 1 1 69 95 .. 379 403 .. 365 405 .. 0.63 3 ? -1.7 0.1 0.26 0.26 31 70 .. 1133 1174 .. 1117 1193 .. 0.68 4 ? -2.5 0.0 0.49 0.49 13 45 .. 1244 1271 .. 1240 1283 .. 0.75 Alignments for each domain: == domain 1 score: 60.6 bits; conditional E-value: 1e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi QGX61843.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRaavdadnsnNDPAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 167 688999**999998888788899*************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ QGX61843.1|CBM41|CBM48|GH13_13 168 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 210 ***87778888888*****999977788888899999999875 PP == domain 2 score: -3.7 bits; conditional E-value: 1 CBM41.hmm 69 kkdlggDrkidllkdgsaevwlvsgde 95 +k l +++d+ d+++ vw +gd QGX61843.1|CBM41|CBM48|GH13_13 379 NKTL--SQRLDMVRDDTSGVWRYEGDM 403 3332..355666667788999999886 PP == domain 3 score: -1.7 bits; conditional E-value: 0.26 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgdkk 70 + +g++++t + + G+++ +k++ e+ s+++f +g++ QGX61843.1|CBM41|CBM48|GH13_13 1133 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAANGEEG 1174 333478888888888999999999735779999977777544 PP == domain 4 score: -2.5 bits; conditional E-value: 0.49 CBM41.hmm 13 dydgwglwtWgddveaepsdwggalef.tgkDdy 45 y+g +++t+++dve g++ef Dd+ QGX61843.1|CBM41|CBM48|GH13_13 1244 AYQGGRIYTFARDVE------PGSYEFkVASDDW 1271 5899999***99997......7777773335555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 132.18 // Query: QSX41131.1|CBM41|CBM48|GH13_13 [L=1445] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-20 59.8 0.2 1.8e-20 59.8 0.2 2.6 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.8 0.2 1.8e-20 1.8e-20 1 98 [. 89 215 .. 89 218 .. 0.81 2 ? -1.2 0.6 0.19 0.19 12 62 .. 914 969 .. 909 972 .. 0.65 Alignments for each domain: == domain 1 score: 59.8 bits; conditional E-value: 1.8e-20 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r a+ +y g++l+tW++d++ ++p +w + ++f+g D+ yGay+ ++lkeg+ ++ +fi QSX41131.1|CBM41|CBM48|GH13_13 89 NQAVLYYNRikdkdnssANPNYPGYKLHTWNNDTCdaYAPPfdtsSWANGHPFDGIDPnYGAYWILTLKEGHsDCANFI 167 68899****99999887778***************86444456569*888*******************988357**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk.........dgsaevwlvsgdekvy 98 v++g ++k+lg gD k++l+ + ++ +g+++vy QSX41131.1|CBM41|CBM48|GH13_13 168 VHTGtegSGKALGdGDLKMNLKPfedpsaaeaRFDRVNFTIHGESSVY 215 **987779999999*****99777776665555555566666666666 PP == domain 2 score: -1.2 bits; conditional E-value: 0.19 CBM41.hmm 12 gdydgwglwtWgddveaepsdwggalef..tgkDdyGayadvklkega....skigf 62 ++yd+ +++ + d+++++++w+ l+ ++++++ + +++++++ s+igf QSX41131.1|CBM41|CBM48|GH13_13 914 NSYDSGDWFNYV-DFTQSGNNWNVGLPLaqDNQGNWNTISGISANPNTaasaSEIGF 969 678888888888.54345668977777744667778888888887643333355665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1445 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 130.33 // Query: AGP93638.1|CBM41|CBM48|GH13_13 [L=1472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-21 61.6 1.0 5e-21 61.6 1.0 3.5 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.6 1.0 5e-21 5e-21 1 99 [. 119 239 .. 119 241 .. 0.87 2 ? -0.2 0.0 0.093 0.093 57 96 .. 397 433 .. 384 437 .. 0.77 3 ? -2.2 0.2 0.37 0.37 31 69 .. 1162 1202 .. 1146 1219 .. 0.67 Alignments for each domain: == domain 1 score: 61.6 bits; conditional E-value: 5e-21 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d+ y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi AGP93638.1|CBM41|CBM48|GH13_13 119 NQAVLYYNRaavdadnssNDAAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 196 68899****999999998899***************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ AGP93638.1|CBM41|CBM48|GH13_13 197 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 239 ***87778888888*****999977788888899999999875 PP == domain 2 score: -0.2 bits; conditional E-value: 0.093 CBM41.hmm 57 askigfivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 as++ +++ +++k+ ++id+ d+++ vw ++gd + AGP93638.1|CBM41|CBM48|GH13_13 397 ASNVDLLIYNDNKTL---SQRIDMVRDDTSGVWRHEGDMS 433 566777776665554...578999999999*******986 PP == domain 3 score: -2.2 bits; conditional E-value: 0.37 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgdk 69 + +g++++t + + G+++ +k++ e+ s+++f +g++ AGP93638.1|CBM41|CBM48|GH13_13 1162 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAADGEE 1202 33347788888888888888888873577888887666644 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1472 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.17 // Query: QOL26772.1|CBM41|CBM48|GH13_13 [L=1432] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-20 59.0 0.4 1.4e-19 57.0 0.1 2.3 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 57.0 0.1 1.4e-19 1.4e-19 1 101 [. 90 214 .. 90 215 .. 0.86 2 ? -3.3 0.0 0.82 0.82 56 96 .. 367 404 .. 358 405 .. 0.61 Alignments for each domain: == domain 1 score: 57.0 bits; conditional E-value: 1.4e-19 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve..aeps....dw.ggaleftgkDd.yGayadvklkegas.kig 61 n+++++Y+r +d +y+g++l+tW++d + ++p dw +g+++ +g D+ yGay+ ++lk+g+s + + QOL26772.1|CBM41|CBM48|GH13_13 90 NQAILYYNRgdvgaqntpDDPSYEGYRLHTWNSDSCdaYAPPfdssDWaNGHIH-DGVDPnYGAYWILNLKDGYSdCAN 167 678999999999999998889***************8644445666**888777.****99**********988537** PP CBM41.hmm 62 fivrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 fi++ g ++k+lg +D +++l++ + ++++g ++v+++p QOL26772.1|CBM41|CBM48|GH13_13 168 FIIHIGtddAGKALGsSDLQMPLNQddeRFVRMNFTFHGVPTVFEYP 214 ****876678899999*******99777777888999****999986 PP == domain 2 score: -3.3 bits; conditional E-value: 0.82 CBM41.hmm 56 gaskigfivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 +a+++ ++v + +k+++g ++++ d + +w gde+ QOL26772.1|CBM41|CBM48|GH13_13 367 TAQNVDLLVFDANKTETG-RYSMTE--DTATGIWSYTGDES 404 556677777666666533.344443..34688998888875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1432 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 160.51 // Query: AUC88144.1|CBM41|CBM48|GH13_13 [L=1468] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-21 62.1 1.4 2.4e-20 59.5 1.4 2.6 1 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.5 1.4 2.4e-20 2.4e-20 1 98 [. 115 234 .. 115 237 .. 0.85 Alignments for each domain: == domain 1 score: 59.5 bits; conditional E-value: 2.4e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d++ ++++dw +g ++ +g D+ yGay+ ++lk+++ ++ +fi AUC88144.1|CBM41|CBM48|GH13_13 115 NQAVLYYNRaavdadnssSDPAYEGWRLHTWNNDTCdayaDADTDWaNGRVH-NGVDPnYGAYWILDLKDNYgDCHNFI 192 68899****99999998888999*************97533555**888777.9***99**********999568**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvy 98 ++kg ++k++g gD + +l + + ++ ++ sg+++++ AUC88144.1|CBM41|CBM48|GH13_13 193 IHKGtddAGKEMGgGDFQASLVQddeTFTRMNFTLSGEPTLF 234 ***87778888888***9999997777778888888888876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1468 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 167.86 // Query: QLJ08524.1|CBM41|CBM48|GH13_13 [L=1438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-22 66.4 5.9 2.5e-21 62.6 0.5 3.2 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.6 0.5 2.5e-21 2.5e-21 2 101 .. 92 207 .. 91 208 .. 0.85 2 ! 4.9 0.7 0.0024 0.0024 12 59 .. 908 956 .. 902 965 .. 0.78 Alignments for each domain: == domain 1 score: 62.6 bits; conditional E-value: 2.5e-21 CBM41.hmm 2 tvrvhYkr.adgdydgwglwtWgddve...aeps....dwggaleftgkDd.yGayadvklkega.skigfivrkg... 67 ++++ Y+r +d+ y+g++l+tW++dv+ a+ dw + +e +g D+ yGay+ vklk+g+ ++ +fiv+ g QLJ08524.1|CBM41|CBM48|GH13_13 92 EAILFYNRtSDDAYEGYRLHTWNNDVCdayAA-PfdatDWANGHEYDGIDPnYGAYWIVKLKDGYnECANFIVHIGteg 169 57889*9945599**************86322.23555**777999****************988357******97667 PP CBM41.hmm 68 dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 ++k++g D k++l + + ++ ++ +g+++v+++p QLJ08524.1|CBM41|CBM48|GH13_13 170 SGKAFGdVDLKMPLMQddeKFQRMNFTIHGEPSVFEYP 207 9999999*******99888889999*********9986 PP == domain 2 score: 4.9 bits; conditional E-value: 0.0024 CBM41.hmm 12 gdydgwglwtWgddveaeps.dwggalef..tgkDdyGayadvklkegask 59 ++yd+ +++ + d+ ++++ +w+ l++ +++ ++G++a ++++ +a+ QLJ08524.1|CBM41|CBM48|GH13_13 908 NSYDSGDWFNFV-DF-SKETnNWNVGLPPaqDNQAKWGEIAPISANTNAQA 956 788999999998.77.466669*9999995455677*********998865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1438 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 158.10 // Query: APD95966.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-20 60.6 0.9 1e-20 60.6 0.9 3.3 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.6 0.9 1e-20 1e-20 1 99 [. 90 210 .. 90 212 .. 0.86 2 ? -1.7 0.1 0.26 0.26 31 70 .. 1133 1174 .. 1117 1193 .. 0.68 3 ? -2.5 0.0 0.49 0.49 13 45 .. 1244 1271 .. 1240 1283 .. 0.75 4 ? -3.9 0.1 1 1 32 57 .. 1348 1373 .. 1335 1393 .. 0.70 Alignments for each domain: == domain 1 score: 60.6 bits; conditional E-value: 1e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi APD95966.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRaavdadnsnNDPAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 167 688999**999998888788899*************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ APD95966.1|CBM41|CBM48|GH13_13 168 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 210 ***87778888888*****999977788888899999999875 PP == domain 2 score: -1.7 bits; conditional E-value: 0.26 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgdkk 70 + +g++++t + + G+++ +k++ e+ s+++f +g++ APD95966.1|CBM41|CBM48|GH13_13 1133 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAANGEEG 1174 333478888888888999999999735779999977777544 PP == domain 3 score: -2.5 bits; conditional E-value: 0.49 CBM41.hmm 13 dydgwglwtWgddveaepsdwggalef.tgkDdy 45 y+g +++t+++dve g++ef Dd+ APD95966.1|CBM41|CBM48|GH13_13 1244 AYQGGRIYTFARDVE------PGSYEFkVASDDW 1271 5899999***99997......7777773335555 PP == domain 4 score: -3.9 bits; conditional E-value: 1 CBM41.hmm 32 dwggaleftgkDdyGayadvklkega 57 wg+ ft +++ ++ad++l++g+ APD95966.1|CBM41|CBM48|GH13_13 1348 GWGAVDMFTYQGEGVYTADIELSAGS 1373 46666667888888888888888765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 151.83 // Query: AXV64038.1|CBM41|CBM48|GH13_13 [L=1438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-22 66.4 5.9 2.5e-21 62.6 0.5 3.2 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.6 0.5 2.5e-21 2.5e-21 2 101 .. 92 207 .. 91 208 .. 0.85 2 ! 4.9 0.7 0.0024 0.0024 12 59 .. 908 956 .. 902 965 .. 0.78 Alignments for each domain: == domain 1 score: 62.6 bits; conditional E-value: 2.5e-21 CBM41.hmm 2 tvrvhYkr.adgdydgwglwtWgddve...aeps....dwggaleftgkDd.yGayadvklkega.skigfivrkg... 67 ++++ Y+r +d+ y+g++l+tW++dv+ a+ dw + +e +g D+ yGay+ vklk+g+ ++ +fiv+ g AXV64038.1|CBM41|CBM48|GH13_13 92 EAILFYNRtSDDAYEGYRLHTWNNDVCdayAA-PfdatDWANGHEYDGIDPnYGAYWIVKLKDGYnECANFIVHIGteg 169 57889*9945599**************86322.23555**777999****************988357******97667 PP CBM41.hmm 68 dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 ++k++g D k++l + + ++ ++ +g+++v+++p AXV64038.1|CBM41|CBM48|GH13_13 170 SGKAFGdVDLKMPLMQddeKFQRMNFTIHGEPSVFEYP 207 9999999*******99888889999*********9986 PP == domain 2 score: 4.9 bits; conditional E-value: 0.0024 CBM41.hmm 12 gdydgwglwtWgddveaeps.dwggalef..tgkDdyGayadvklkegask 59 ++yd+ +++ + d+ ++++ +w+ l++ +++ ++G++a ++++ +a+ AXV64038.1|CBM41|CBM48|GH13_13 908 NSYDSGDWFNFV-DF-SKETnNWNVGLPPaqDNQAKWGEIAPISANTNAQA 956 788999999998.77.466669*9999995455677*********998865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1438 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 163.36 // Query: QQM64070.1|CBM41|CBM48|GH13_13 [L=1434] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-21 62.2 0.1 3.4e-21 62.2 0.1 3.7 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.2 0.1 3.4e-21 3.4e-21 2 101 .. 90 205 .. 89 206 .. 0.87 2 ? -0.9 0.3 0.15 0.15 22 71 .. 292 339 .. 275 405 .. 0.72 3 ? -1.7 0.5 0.28 0.28 12 56 .. 905 950 .. 900 960 .. 0.67 4 ? -3.4 0.1 0.91 0.91 13 39 .. 1240 1260 .. 1236 1279 .. 0.63 Alignments for each domain: == domain 1 score: 62.2 bits; conditional E-value: 3.4e-21 CBM41.hmm 2 tvrvhYkr.adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfivrkg...d 68 ++++ Y+r ad++y+g++l+ W++dv+ ++p dw + +e +g D+ yGay+ ++lkeg+ ++ +fi++ g + QQM64070.1|CBM41|CBM48|GH13_13 90 EAVLFYNRlADDNYEGYRLHSWNNDVCdaYAPPfdtsDWANGHEYDGIDPnYGAYWIINLKEGYnECANFIIHIGtegS 168 57899***6779***************8644445666**777999****************988357******976679 PP CBM41.hmm 69 kkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 +k++g D +++l + + ++ ++ +g+++v+++p QQM64070.1|CBM41|CBM48|GH13_13 169 GKAFGdVDLTMPLMQddeTFQRMNFTIHGEPSVFEYP 205 999999*******9988889999**********9986 PP == domain 2 score: -0.9 bits; conditional E-value: 0.15 CBM41.hmm 22 Wgddveaepsdw.ggaleftgkDdyGayadvklkegaskigfivrkgdkkd 71 W+ + ++++ + +l +g D+ G+ + ++ ++a+ + + ++g++++ QQM64070.1|CBM41|CBM48|GH13_13 292 WD--T-NTAKALiKSQLVIAGYDSEGKLLEASYVQTAKALDALYTQGEDDA 339 22..2.122345577888899999999999999999999999998884443 PP == domain 3 score: -1.7 bits; conditional E-value: 0.28 CBM41.hmm 12 gdydgwglwtWgddveaeps.dwggaleftgkDd..yGayadvklkeg 56 ++yd+ +++ + d+ ++++ +w+ l++++ + + +++ ++++ + QQM64070.1|CBM41|CBM48|GH13_13 905 NSYDSGDWFNFV-DF-TKDTnNWNIGLPPAQDNEvkWQEIMPISANTQ 950 678888888888.66.56666998888886644433777777776654 PP == domain 4 score: -3.4 bits; conditional E-value: 0.91 CBM41.hmm 13 dydgwglwtWgddveaepsdwggalef 39 +y+g g++t+ + + +++ef QQM64070.1|CBM41|CBM48|GH13_13 1240 SYKGKGIYTFTKTLS------AASYEF 1260 799999999985553......333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1434 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 116.67 // Query: BCO17975.1|CBM41|CBM48|GH13_13 [L=1359] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-24 70.5 0.1 3.7e-23 68.5 0.1 2.1 1 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.5 0.1 3.7e-23 3.7e-23 1 100 [. 137 246 .. 137 247 .. 0.87 Alignments for each domain: == domain 1 score: 68.5 bits; conditional E-value: 3.7e-23 CBM41.hmm 1 ntvrvhYkradgdydgwglwtWgddve...aeps.......dwggaleftgkDd.yGayadvklkegaskigfivrkgd 68 n++ v Y+r+dg+ydgwgl++W+ +++ a+p+ +w ++++ +g + yGay+ +++++ga + +fiv+kg+ BCO17975.1|CBM41|CBM48|GH13_13 137 NQIAVFYNREDGQYDGWGLHLWNGQACgnyAAPTtqsshfsNWPDPYPADGVHPeYGAYYILTVEPGAACYNFIVHKGN 215 6899*******************9999875333334468889*********5555************************ PP CBM41.hmm 69 kkdlg.gDrkidllkdgsaevwlvsgdekvyts 100 +k+lg +D +++ +++++++g +++ ++ BCO17975.1|CBM41|CBM48|GH13_13 216 DKALGdADSRFEPEY--GNQAFTFNGFPELWYT 246 ***999******966..99***99998887665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1359 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 148.20 // Query: AFT74588.1|CBM41|CBM48|GH13_13 [L=1472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-20 58.6 1.6 4.6e-20 58.6 1.6 3.8 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.6 1.6 4.6e-20 4.6e-20 1 98 [. 119 238 .. 119 241 .. 0.84 2 ? -0.2 0.0 0.093 0.093 57 96 .. 397 433 .. 384 437 .. 0.77 3 ? -1.5 0.2 0.23 0.23 31 73 .. 1162 1206 .. 1147 1223 .. 0.69 4 ? -3.8 0.0 1 1 14 39 .. 1274 1293 .. 1271 1312 .. 0.66 Alignments for each domain: == domain 1 score: 58.6 bits; conditional E-value: 4.6e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d+ y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lk+g+ ++ +fi AFT74588.1|CBM41|CBM48|GH13_13 119 NQAVLYYNRaavdadnssNDAAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKDGYgNCHNFI 196 68899****999999998899***************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvy 98 ++kg ++k++g gD + +l + + + ++ sg+++++ AFT74588.1|CBM41|CBM48|GH13_13 197 IHKGtddAGKEMGgGDFQGSLVQddeTFVRMNFTLSGEATIF 238 ***877778888889999888886666677778888888776 PP == domain 2 score: -0.2 bits; conditional E-value: 0.093 CBM41.hmm 57 askigfivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 as++ +++ +++k+ ++id+ d+++ vw ++gd + AFT74588.1|CBM41|CBM48|GH13_13 397 ASNVDLLIYNDNKTL---SQRIDMVRDDTSGVWRHEGDMS 433 566777776665554...578999999999*******986 PP == domain 3 score: -1.5 bits; conditional E-value: 0.23 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgdkkdlg 73 + +g++++t + + G+++ +k++ e+ s+++f +g++ ++ AFT74588.1|CBM41|CBM48|GH13_13 1162 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAADGEEGTVT 1206 333478888899999999999999735889999988887665554 PP == domain 4 score: -3.8 bits; conditional E-value: 1 CBM41.hmm 14 ydgwglwtWgddveaepsdwggalef 39 y+g +++t+ +dve g +ef AFT74588.1|CBM41|CBM48|GH13_13 1274 YQGGRIYTFSRDVE------PGTYEF 1293 88889999999996......444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1472 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 135.72 // Query: AMJ88839.1|CBM41|CBM48|GH13_13 [L=1449] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-20 59.4 3.9 3.8e-20 58.8 2.0 2.5 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.8 2.0 3.8e-20 3.8e-20 1 101 [. 96 218 .. 96 219 .. 0.86 2 ? -3.6 0.0 1 1 68 96 .. 384 410 .. 374 412 .. 0.67 Alignments for each domain: == domain 1 score: 58.8 bits; conditional E-value: 3.8e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve..aeps..dwggaleftgkDd.yGayadvklkega.skigfiv 64 n+++++Y+r +d y+gw+l+tW++d + +++s dw + + tg D+ yGay+ ++lk++ ++ +fi+ AMJ88839.1|CBM41|CBM48|GH13_13 96 NQAVLYYNRaavdadnstNDPVYEGWRLHTWNNDECdaYADSdtDWANGRQHTGIDPnYGAYWVLDLKNDFdDCHNFII 174 688999***88888887777889*************98445556**666777****99**********998458***** PP CBM41.hmm 65 rkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 + g ++k+lg +D + +l + + + ++ sg+++++++p AMJ88839.1|CBM41|CBM48|GH13_13 175 HLGtddAGKELGgSDFQASLVQdddTYVRMNFTLSGEPTLFEYP 218 *876678899999***999999888899999******9999886 PP == domain 2 score: -3.6 bits; conditional E-value: 1 CBM41.hmm 68 dkkdlggDrkidllkdgsaevwlvsgdek 96 d+k l + ++++ d + +w ++gd + AMJ88839.1|CBM41|CBM48|GH13_13 384 DNKTLANRYSMTR--DTVTGIWQFEGDMS 410 5555555555555..45899999999865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1449 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 161.69 // Query: CED95594.1|CBM41|CBM48|GH13_13 [L=1440] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-20 60.5 1.9 1.1e-20 60.5 1.9 2.8 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.5 1.9 1.1e-20 1.1e-20 1 101 [. 90 213 .. 90 214 .. 0.87 2 ? -1.0 0.6 0.17 0.17 12 57 .. 910 956 .. 905 964 .. 0.69 Alignments for each domain: == domain 1 score: 60.5 bits; conditional E-value: 1.1e-20 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve...aeps....dwggaleftgkDd.yGayadvklkega.skigf 62 n+++++Y+r ++++y +++l+tW+d+++ a+ dw++ ++f+g D+ yGay+ ++lkeg+ + +f CED95594.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRikdknntaSNAEYPKYKLHTWNDEKCdayAA-PfdtsDWSNGHPFDGIDPnYGAYWILNLKEGYgACGNF 167 68999****999999877799**********999986322.23556**888********************99458*** PP CBM41.hmm 63 ivrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 iv+ g ++k+lg ++ +++l + + + ++ +g+++vy++p CED95594.1|CBM41|CBM48|GH13_13 168 IVHAGtddAGKALGkNNLTMSLVQddaTYVRVNFTIHGESDVYEYP 213 ***987778899999*******99888899999**********987 PP == domain 2 score: -1.0 bits; conditional E-value: 0.17 CBM41.hmm 12 gdydgwglwtWgddveaepsdwggalef..tgkDdyGayadvklkega 57 ++yd+ +++ + d+++++++w+ l+ ++ ++ ++a ++++++a CED95594.1|CBM41|CBM48|GH13_13 910 NSYDSGDWFNYV-DFTYNTNNWNVGLPLaqDNSSKWTQIAGISANPNA 956 678888888887.55355558988888843456668889888888765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1440 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 147.63 // Query: QQX78937.1|CBM41|CBM48|GH13_13 [L=1444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-21 60.7 5.5 1.6e-20 60.0 0.4 3.0 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.0 0.4 1.6e-20 1.6e-20 4 101 .. 92 212 .. 89 213 .. 0.84 2 ? 1.7 0.7 0.024 0.024 11 57 .. 913 960 .. 909 970 .. 0.70 Alignments for each domain: == domain 1 score: 60.0 bits; conditional E-value: 1.6e-20 CBM41.hmm 4 rvhYkr........adgdydgwglwtWgddve...aeps....dwggaleftgkDd.yGayadvklkega.skigfivr 65 +++Y++ +d ydg++l+tW+++++ a+ dw + +ef+g D+ yGay+ v+lkeg+ ++ +fi++ QQX78937.1|CBM41|CBM48|GH13_13 92 VIYYNNvqdadnsaNDPVYDGYRLHTWNNETCdayAA-PfdtsDWANGHEFDGIDPnYGAYWIVNLKEGYgDCGNFIIH 169 7888888887777677889*************86322.23556**888********************99568****** PP CBM41.hmm 66 kg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 g ++k+lg gD +++l + + + ++ +g+++v+++p QQX78937.1|CBM41|CBM48|GH13_13 170 IGtegSGKALGdGDLSMPLMQddeTFVRMNFTLHGEPSVFEYP 212 976779999999*******997777888899999999999886 PP == domain 2 score: 1.7 bits; conditional E-value: 0.024 CBM41.hmm 11 dgdydgwglwtWgddveaeps.dwggaleftgkDd..yGayadvklkega 57 ++yd+ +++ W d+ +++s +w+ l+ ++ + ++a ++++++a QQX78937.1|CBM41|CBM48|GH13_13 913 RNSYDSGDWFNWV-DF-TKSShNWNVGLPREQDNGikWDEIAGISANPNA 960 479*********9.77.456679*99998655332346677777776654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1444 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 140.82 // Query: AMJ80567.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-20 60.6 0.9 1e-20 60.6 0.9 3.1 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.6 0.9 1e-20 1e-20 1 99 [. 90 210 .. 90 212 .. 0.86 2 ? -3.7 0.0 1 1 69 95 .. 379 403 .. 365 405 .. 0.63 3 ? -2.9 0.2 0.62 0.62 33 68 .. 1136 1172 .. 1121 1189 .. 0.67 4 ? -3.2 0.0 0.79 0.79 14 40 .. 1245 1265 .. 1241 1284 .. 0.64 Alignments for each domain: == domain 1 score: 60.6 bits; conditional E-value: 1e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi AMJ80567.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRaavdadnsnNDPAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 167 688999**999998888788899*************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ AMJ80567.1|CBM41|CBM48|GH13_13 168 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 210 ***87778888888*****999977788888899999999875 PP == domain 2 score: -3.7 bits; conditional E-value: 1 CBM41.hmm 69 kkdlggDrkidllkdgsaevwlvsgde 95 +k l +++d+ d+++ vw +gd AMJ80567.1|CBM41|CBM48|GH13_13 379 NKTL--SQRLDMVRDDTSGVWRYEGDM 403 3332..355666667788999999886 PP == domain 3 score: -2.9 bits; conditional E-value: 0.62 CBM41.hmm 33 wggaleftgkDdyGayadvklk.egaskigfivrkgd 68 +g++++t + + G+++ +k++ e+ s+++f +g+ AMJ80567.1|CBM41|CBM48|GH13_13 1136 GDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAADGE 1172 3777888888888888888887357788888666664 PP == domain 4 score: -3.2 bits; conditional E-value: 0.79 CBM41.hmm 14 ydgwglwtWgddveaepsdwggaleft 40 y+g +++t+ +dve g +ef+ AMJ80567.1|CBM41|CBM48|GH13_13 1245 YQGGRVYTFSRDVE------PGTYEFK 1265 88899999999996......3444442 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 138.70 // Query: AXT40402.1|CBM41|CBM48|GH13_13 [L=1472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-21 63.0 0.8 1.2e-20 60.5 0.8 2.5 1 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.5 0.8 1.2e-20 1.2e-20 1 98 [. 119 238 .. 119 241 .. 0.85 Alignments for each domain: == domain 1 score: 60.5 bits; conditional E-value: 1.2e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d+ y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi AXT40402.1|CBM41|CBM48|GH13_13 119 NQAVLYYNRaavdadnssNDAAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 196 68899****999999998899***************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvy 98 ++kg ++k+lg gD + +l + + + ++ sg+++++ AXT40402.1|CBM41|CBM48|GH13_13 197 IHKGtddAGKELGgGDFQGSLVQddeTFVRMNFTLSGEPTIF 238 ***877788889989999998886667777888888888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1472 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 163.76 // Query: APD88165.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-22 64.8 1.7 5.4e-21 61.5 1.3 2.9 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.5 1.3 5.4e-21 5.4e-21 1 98 [. 90 209 .. 90 212 .. 0.86 2 ? -1.3 0.0 0.2 0.2 62 96 .. 373 404 .. 357 408 .. 0.73 Alignments for each domain: == domain 1 score: 61.5 bits; conditional E-value: 5.4e-21 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lk+++ s+ +fi APD88165.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRaavdadnssNDTAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKDDYgSCHNFI 167 68899****9999999988999**************97533555**999888.999999**********999678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvy 98 ++kg ++k++g gD + +ll+ + + ++ sg+++++ APD88165.1|CBM41|CBM48|GH13_13 168 IHKGtddAGKEMGgGDFQASLLQddeTFVRMNFTLSGEPTIF 209 ***87778888888*******997777778888889888887 PP == domain 2 score: -1.3 bits; conditional E-value: 0.2 CBM41.hmm 62 fivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 +++ +++k+ ++id+l d+++ vw +gd + APD88165.1|CBM41|CBM48|GH13_13 373 LLLYNNNKTL---SQRIDMLRDDTSGVWRYEGDMS 404 5544444433...57899999999*******9976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 147.39 // Query: VEL97143.1|CBM41|CBM48|GH13_13 [L=1456] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-20 60.1 3.3 4.4e-20 58.6 1.7 2.7 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.6 1.7 4.4e-20 4.4e-20 1 101 [. 100 222 .. 100 223 .. 0.86 2 ? -1.7 0.0 0.26 0.26 64 96 .. 384 414 .. 371 418 .. 0.74 Alignments for each domain: == domain 1 score: 58.6 bits; conditional E-value: 4.4e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdwggaleftgkDd.yGayadvklkega.skigfiv 64 n+++++Y+r +d y+gw+l+tW++d + ++++dw + + tg D+ yGay+ ++lk++ ++ +fi+ VEL97143.1|CBM41|CBM48|GH13_13 100 NQAVLYYNRaavdadnstNDPAYEGWRLHTWNNDECdayaDADTDWANGRQHTGIDPnYGAYWILDLKDNFdNCHNFII 178 68899****99999888888999*************97533555**666777****99**********877478***** PP CBM41.hmm 65 rkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 + g ++k+lg +D + +l + + + ++ sg+++++++p VEL97143.1|CBM41|CBM48|GH13_13 179 HLGtddAGKELGgSDFQASLVQddeTYVRMNFTLSGEPTLFEYP 222 *876678899999****999998888889999999999999886 PP == domain 2 score: -1.7 bits; conditional E-value: 0.26 CBM41.hmm 64 vrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 ++++d+k l + ++++ ++ ++ +w ++gd + VEL97143.1|CBM41|CBM48|GH13_13 384 LTYNDNKTLASRYTMTRDT--NTGIWQFEGDMS 414 4556777777777777755..999999999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1456 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 141.47 // Query: QYJ87254.1|CBM41|CBM48|GH13_13 [L=1445] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-20 59.2 5.6 5.5e-19 55.1 0.3 3.0 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 55.1 0.3 5.5e-19 5.5e-19 2 98 .. 90 215 .. 89 218 .. 0.80 2 ! 5.1 0.8 0.0021 0.0021 11 57 .. 914 961 .. 909 973 .. 0.75 Alignments for each domain: == domain 1 score: 55.1 bits; conditional E-value: 5.5e-19 CBM41.hmm 2 tvrvhYkr........adgdydgwglwtWgddve...a...epsdwggaleftgkDd.yGayadvklkega.skigfiv 64 +++++Y+r ++ +y + +l+tW++d++ a +++dw + + f+g D+ yGay+ ++lk+g+ ++ +fiv QYJ87254.1|CBM41|CBM48|GH13_13 90 QAVLYYNRikdkdnsaSNPNYPSFKLHTWNNDTCdafAapfDSTDWANGHSFDGIDPnYGAYWILNLKAGHsECANFIV 168 6899999999998887778***************8653333444**778*******************988357***** PP CBM41.hmm 65 rkg...dkkdlg.gDrkidllk.........dgsaevwlvsgdekvy 98 ++g ++k+lg gD +++l+ + + ++ +g+++vy QYJ87254.1|CBM41|CBM48|GH13_13 169 HEGtegSGKALGdGDLTMNLKPfddstapeaQFDRINFTIHGESDVY 215 *9877799999999999999767666666655566667777777666 PP == domain 2 score: 5.1 bits; conditional E-value: 0.0021 CBM41.hmm 11 dgdydgwglwtWgddveaeps.dwggaleftg.kDd.yGayadvklkega 57 ++yd+ +++ W d+ +++s +w+ l+ ++ +++ + ++a ++++++a QYJ87254.1|CBM41|CBM48|GH13_13 914 RNSYDSGDWFNWV-DF-TKASnNWNVGLPLAQdNGSkWQQIAGISANPNA 961 489**********.77.46666999999995535555999**99999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1445 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 147.38 // Query: QCZ92212.1|CBM41|CBM48|GH13_13 [L=1382] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-25 74.1 0.2 2.4e-24 72.3 0.2 2.1 1 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.3 0.2 2.4e-24 2.4e-24 2 101 .. 57 166 .. 56 167 .. 0.89 Alignments for each domain: == domain 1 score: 72.3 bits; conditional E-value: 2.4e-24 CBM41.hmm 2 tvrvhYkradgdydgwglwtWgddve...aeps.......dwggaleftg.kDdyGayadvklkegaskigfivrkgdk 69 ++ + Y r+d++ydgwgl++W+ + + a+p+ +wg++++ +g + dyGay+ ++ ++gas+ +fiv+kgd+ QCZ92212.1|CBM41|CBM48|GH13_13 57 EIALFYSRDDENYDGWGLHLWNGEGCgeyASPTsdsthfnNWGNPYPADGiHPDYGAYYILTTEPGASCYNFIVHKGDE 135 57789*****************9999965333345568889*********7777************************* PP CBM41.hmm 70 kdlg.gDrkidllkdgsaevwlvsgdekvytsp 101 k+lg ++ k++ ++ +e ++++g ++v ++p QCZ92212.1|CBM41|CBM48|GH13_13 136 KALGnANSKFEPAQ--GQEGFTFHGYPEVWYEP 166 ****9******988..99**********99986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1382 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 162.67 // Query: AEF03054.1|CBM41|CBM48|GH13_13 [L=1484] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-20 59.9 1.6 1.8e-20 59.9 1.6 2.9 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.9 1.6 1.8e-20 1.8e-20 1 101 [. 128 250 .. 128 251 .. 0.86 2 ? -1.8 0.0 0.28 0.28 64 96 .. 412 442 .. 400 446 .. 0.74 3 ? -3.3 0.0 0.86 0.86 40 70 .. 1048 1078 .. 1021 1085 .. 0.70 Alignments for each domain: == domain 1 score: 59.9 bits; conditional E-value: 1.8e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdwggaleftgkDd.yGayadvklkega.skigfiv 64 n+++++Y+r +d y+gw+l+tW++d + ++++dw + + tg D+ yGay+ ++lk++ ++ +fi+ AEF03054.1|CBM41|CBM48|GH13_13 128 NQAVLYYNRaavdadnstTDPAYEGWRLHTWNNDECdayaDADTDWANGRQHTGIDPnYGAYWVLDLKDNFdNCHNFII 206 68899****99999999899999*************97533555**666777****99**********877478***** PP CBM41.hmm 65 rkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 + g ++k+lg +D + +l + + + ++ sg+++++++p AEF03054.1|CBM41|CBM48|GH13_13 207 HLGtddAGKELGgSDFQASLVQddeTYVRMNFTLSGEPTLFEYP 250 *876678899999****999998888889999999999999886 PP == domain 2 score: -1.8 bits; conditional E-value: 0.28 CBM41.hmm 64 vrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 ++++d+k l + ++++ ++ ++ +w ++gd + AEF03054.1|CBM41|CBM48|GH13_13 412 LTYNDNKTLASRYTMTRDT--NTGIWQFEGDMS 442 4556777777777777655..999999999976 PP == domain 3 score: -3.3 bits; conditional E-value: 0.86 CBM41.hmm 40 tgkDdyGayadvklkegaskigfivrkg.dkk 70 + D+yG+ a+ +l+ +++ i ++v++g ++k AEF03054.1|CBM41|CBM48|GH13_13 1048 SDADTYGE-ARADLDMQNDAIVVLVNTGyETK 1078 45677887.55566666666888888876665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1484 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 141.67 // Query: QEY19135.1|CBM41|CBM48|GH13_13 [L=1473] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-08 19.7 4.2 1e-07 18.9 0.1 3.3 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.9 0.1 1e-07 1e-07 11 95 .. 88 201 .. 76 207 .. 0.72 2 ? -3.9 0.1 1 1 30 46 .. 933 949 .. 927 951 .. 0.70 3 ? -2.9 0.1 0.64 0.64 16 80 .. 1143 1206 .. 1138 1218 .. 0.55 Alignments for each domain: == domain 1 score: 18.9 bits; conditional E-value: 1e-07 CBM41.hmm 11 d..gdydgwglwtWgddvea.......................eps.dw.ggaleftgkDd.yGayadvklkegaskig 61 d + +g++l++W+d + + + ++ +++D+ yGa++ ++ ++ ++ + QEY19135.1|CBM41|CBM48|GH13_13 88 DklSAFAGYNLHLWQDCG-NgwgasatdrtgatytipttwpngP-GvTSkDSGAAGERHDPyYGAFFVIPTSQLGTCGN 164 33345699******9444.2456788999999999877776542.1333355566699***9***************** PP CBM41.hmm 62 fivrkgdkkdlggDrkidllk...dgsaevwlvsgde 95 fi+++ + +++gD +++++ + + +w+ + + QEY19135.1|CBM41|CBM48|GH13_13 165 FIIKTPGGAAQTGDLQVSIKRdggEFDRMAWVIVNTD 201 *****9999999***9999886665666677665555 PP == domain 2 score: -3.9 bits; conditional E-value: 1 CBM41.hmm 30 psdwggaleftgkDdyG 46 + dw +a++ft++ + + QEY19135.1|CBM41|CBM48|GH13_13 933 AGDWFNAVDFTKQSNNW 949 34898899999987755 PP == domain 3 score: -2.9 bits; conditional E-value: 0.64 CBM41.hmm 16 gwglwtWgddveaepsdw..ggaleftgkDdyGayadvklkegaskigfivrkgdkkdlggDrkidl 80 + +l++ g dv+ + w ++a +t ++d ++a +++++g+ ++++ + ++ +lg++++i++ QEY19135.1|CBM41|CBM48|GH13_13 1143 DTALYVRG-DVS--AAGWdaTAANRMTYEGDGIYTALLTVTAGTHNFKVAESNWSNPNLGSNQTITV 1206 55666666.663..23343133444466666666666666665554444444447777777777765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1473 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.84 // Query: AYM87949.1|CBM41|CBM48|GH13_13 [L=1434] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-21 60.9 0.1 8.5e-21 60.9 0.1 3.3 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.9 0.1 8.5e-21 8.5e-21 2 101 .. 90 205 .. 89 206 .. 0.86 2 ? -0.8 0.3 0.14 0.14 22 71 .. 292 339 .. 275 377 .. 0.66 3 ? -3.0 0.2 0.69 0.69 22 58 .. 912 952 .. 901 955 .. 0.57 4 ? -3.3 0.0 0.84 0.84 13 39 .. 1240 1260 .. 1236 1287 .. 0.65 Alignments for each domain: == domain 1 score: 60.9 bits; conditional E-value: 8.5e-21 CBM41.hmm 2 tvrvhYkr.adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfivrkg...d 68 ++++ Y+r ad++y+g++l+ W+++v+ ++p dw + +e +g D+ yGay+ ++lkeg+ ++ +fi++ g + AYM87949.1|CBM41|CBM48|GH13_13 90 EAVLFYNRlADDNYEGYRLHSWNNEVCdaYAPPfdtsDWANGHEYDGIDPnYGAYWIINLKEGYnECANFIIHIGtegT 168 57899***6779***************8644445666**777999****************988357******976668 PP CBM41.hmm 69 kkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 +k++g D +++l + + ++ ++ +g+++v+++p AYM87949.1|CBM41|CBM48|GH13_13 169 GKAFGdVDLTMPLMQddeTFQRMNFTIHGEPSVFEYP 205 888999*******9988889999**********9986 PP == domain 2 score: -0.8 bits; conditional E-value: 0.14 CBM41.hmm 22 Wgddveaepsdw.ggaleftgkDdyGayadvklkegaskigfivrkgdkkd 71 W+ + ++++ + +l +g D+ G+ + ++ ++a+ + + ++g++++ AYM87949.1|CBM41|CBM48|GH13_13 292 WD--T-NTAKALiKSQLVIAGYDSEGKLLEASYVQTAKALDALYTQGEDDA 339 32..2.1233555888888999999**999999999999999999984444 PP == domain 3 score: -3.0 bits; conditional E-value: 0.69 CBM41.hmm 22 Wgddve.aeps.dwggalef..tgkDdyGayadvklkegas 58 W + v+ ++++ +w+ l+ ++++++ +++ ++++++a+ AYM87949.1|CBM41|CBM48|GH13_13 912 WFNAVDlTKENnNWNIGLPNaeKNQEKWSEIMPISANPDAQ 952 54455553444477444444334466677777777777765 PP == domain 4 score: -3.3 bits; conditional E-value: 0.84 CBM41.hmm 13 dydgwglwtWgddveaepsdwggalef 39 +y+g g++t+ + + +++ef AYM87949.1|CBM41|CBM48|GH13_13 1240 SYKGKGIYTFTKTLS------AASYEF 1260 799999999985553......333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1434 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 146.63 // Query: AFT78370.1|CBM41|CBM48|GH13_13 [L=1472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-21 63.5 5.4 2.4e-21 62.7 0.7 3.4 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.7 0.7 2.4e-21 2.4e-21 1 98 [. 119 238 .. 119 241 .. 0.86 2 ? 0.8 0.0 0.046 0.046 59 96 .. 399 433 .. 383 438 .. 0.77 3 ? -3.1 0.1 0.75 0.75 31 67 .. 1162 1200 .. 1149 1213 .. 0.63 Alignments for each domain: == domain 1 score: 62.7 bits; conditional E-value: 2.4e-21 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d+ y+gw+l+tW++d++ ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi AFT78370.1|CBM41|CBM48|GH13_13 119 NQAVLYYNRaavdadnssNDAAYEGWRLHTWNNDACdayaDADTDWaNGRIH-SGIDPnYGAYWILELKEGYgSCHNFI 196 68899****999999998899***************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvy 98 ++kg ++k++g gD k +l++ + + ++ sg+++++ AFT78370.1|CBM41|CBM48|GH13_13 197 IHKGtddAGKEMGgGDFKGSLIQddeTFVRMNFTLSGEPTIF 238 ***87778888888***9999996667778888889988887 PP == domain 2 score: 0.8 bits; conditional E-value: 0.046 CBM41.hmm 59 kigfivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 ++ +++ +++k+ +++i++ d+++ vw ++gd + AFT78370.1|CBM41|CBM48|GH13_13 399 NVDLLLYNDNKT---LNQRIEMVRDDTSGVWRHEGDMS 433 555555444444...5899****************986 PP == domain 3 score: -3.1 bits; conditional E-value: 0.75 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkg 67 + +g++++t + G+++ +k++ e+ s+++f +g AFT78370.1|CBM41|CBM48|GH13_13 1162 TYQgDGKYTVTAVLEGGVTYGFKFAsEDWSTVNFGAADG 1200 223367777777777777777777635667777755555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1472 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 149.33 // Query: AWB59532.1|CBM41|CBM48|GH13_13 [L=1425] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-19 55.4 2.4 5.6e-19 55.1 0.1 2.5 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 55.1 0.1 5.6e-19 5.6e-19 1 101 [. 90 205 .. 90 206 .. 0.88 2 ? -2.3 0.2 0.42 0.42 12 41 .. 896 924 .. 891 935 .. 0.76 Alignments for each domain: == domain 1 score: 55.1 bits; conditional E-value: 5.6e-19 CBM41.hmm 1 ntvrvhYkradgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfivrkg...d 68 n+++++++rad+ yd+++l+ W++ + ++p +w+ l +g D+ yGay+ ++l ++ ++ +fi++kg + AWB59532.1|CBM41|CBM48|GH13_13 90 NQAVLYFNRADAAYDEYKLHNWNTPECdaYAPDsiasSWDSGLVHSGVDPvYGAYWILNLIDDFtECGNFIIHKGtddA 168 6899*******************888887555568889*888888***************9877368*******87778 PP CBM41.hmm 69 kkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 +k++g gD k++l++ + ++ +++sg ++v+++p AWB59532.1|CBM41|CBM48|GH13_13 169 GKEMGgGDFKMPLKQddaTYQRMNFTFSGVASVFEYP 205 888888*******99999999************9986 PP == domain 2 score: -2.3 bits; conditional E-value: 0.42 CBM41.hmm 12 gdydgwglwtWgddveaepsdwggaleftg 41 + yd +++ + d+++++++w++ l+ ++ AWB59532.1|CBM41|CBM48|GH13_13 896 NTYDAGDWYNFV-DFTYNSNNWNKGLPLDK 924 678888888888.66456669999888754 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1425 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 144.71 // Query: AFT95410.1|CBM41|CBM48|GH13_13 [L=1472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-20 58.7 1.3 4e-20 58.7 1.3 3.6 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.7 1.3 4e-20 4e-20 1 98 [. 119 238 .. 119 241 .. 0.84 2 ? -0.3 0.0 0.099 0.099 57 96 .. 397 433 .. 388 437 .. 0.76 3 ? -2.2 0.2 0.39 0.39 31 68 .. 1162 1201 .. 1147 1219 .. 0.67 4 ? -4.0 0.0 1 1 14 39 .. 1274 1293 .. 1271 1310 .. 0.68 Alignments for each domain: == domain 1 score: 58.7 bits; conditional E-value: 4e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d+ y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lk+g+ s+ +fi AFT95410.1|CBM41|CBM48|GH13_13 119 NQAVLYYNRaavdadnssNDAAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKDGYgSCHNFI 196 68899****999999998899***************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvy 98 ++kg ++k++g gD + +l + + + ++ sg+++++ AFT95410.1|CBM41|CBM48|GH13_13 197 IHKGtddAGKEMGgGDFQGSLVQddeTFVRMNFTLSGEATIF 238 ***877778888889999888886666677778888888776 PP == domain 2 score: -0.3 bits; conditional E-value: 0.099 CBM41.hmm 57 askigfivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 as++ +++ +++k+ ++id+ d+++ vw ++gd + AFT95410.1|CBM41|CBM48|GH13_13 397 ASNVDLLIYNDNKTL---SQRIDMVRDDTSGVWRHEGDMS 433 566666666665554...578999999999*******986 PP == domain 3 score: -2.2 bits; conditional E-value: 0.39 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgd 68 + +g++++t + + G+++ +k++ e+ s+++f +g+ AFT95410.1|CBM41|CBM48|GH13_13 1162 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAADGE 1201 3233777888888888888888887357788888766664 PP == domain 4 score: -4.0 bits; conditional E-value: 1 CBM41.hmm 14 ydgwglwtWgddveaepsdwggalef 39 y+g +++t+ +dve g +ef AFT95410.1|CBM41|CBM48|GH13_13 1274 YQGGRIYTFSRDVE------PGTYEF 1293 88889999999996......444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1472 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 133.50 // Query: QLE84096.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-22 64.5 6.6 1.3e-21 63.6 0.6 2.9 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.6 0.6 1.3e-21 1.3e-21 1 101 [. 89 212 .. 89 213 .. 0.85 2 ? 2.8 0.8 0.011 0.011 11 57 .. 913 960 .. 909 971 .. 0.70 Alignments for each domain: == domain 1 score: 63.6 bits; conditional E-value: 1.3e-21 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve..a.eps....dwggaleftgkDd.yGayadvklkega.skigf 62 n+++v+Y+r +d ydg++l+tW++d + + + dw + ++f+g D+ yGay+ v+lk+g+ ++ +f QLE84096.1|CBM41|CBM48|GH13_13 89 NQAVVYYNRpndatnsaNDPVYDGYKLHTWNNDECdaYaA-PfdatDWANGHQFDGIDPnYGAYWIVELKDGYnECANF 166 6899*****9988888777889*************86232.23555**888*******************988357*** PP CBM41.hmm 63 ivrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 iv+ g ++k++g D k++l + + + ++ +g+++v+++p QLE84096.1|CBM41|CBM48|GH13_13 167 IVHIGtegSGKAMGdVDLKMPLMQddeTFVRMNFTLHGEPSVFEYP 212 ***976678999999*******997777888899999999999886 PP == domain 2 score: 2.8 bits; conditional E-value: 0.011 CBM41.hmm 11 dgdydgwglwtWgddveaeps.dwggaleftg..kDdyGayadvklkega 57 ++yd+ +++ W d+ +++s +w+ l+ ++ +++ +a ++++++a QLE84096.1|CBM41|CBM48|GH13_13 913 RNSYDSGDWFNWV-DF-TKQShNWNVGLPREQdnGEKWDMIAGISANPNA 960 479*********9.77.566669*98888644213347777777776654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.64 // Query: AUI84544.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-20 58.8 1.3 3.9e-20 58.8 1.3 3.6 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.8 1.3 3.9e-20 3.9e-20 1 98 [. 90 209 .. 90 212 .. 0.84 2 ? -0.1 0.0 0.088 0.088 57 96 .. 368 404 .. 355 409 .. 0.77 3 ? -2.2 0.2 0.38 0.38 31 68 .. 1133 1172 .. 1118 1190 .. 0.67 4 ? -3.8 0.0 1 1 14 39 .. 1245 1264 .. 1242 1283 .. 0.66 Alignments for each domain: == domain 1 score: 58.8 bits; conditional E-value: 3.9e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d+ y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lk+g+ s+ +fi AUI84544.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRaavdadnssNDAAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKDGYgSCHNFI 167 68899****999999998899***************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvy 98 ++kg ++k++g gD + +l + + + ++ sg+++++ AUI84544.1|CBM41|CBM48|GH13_13 168 IHKGtddAGKEMGgGDFQGSLVQddeTFVRMNFTLSGEATIF 209 ***877778888889999888886666677778888888776 PP == domain 2 score: -0.1 bits; conditional E-value: 0.088 CBM41.hmm 57 askigfivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 as++ +++ +++k+ ++id+ d+++ vw ++gd + AUI84544.1|CBM41|CBM48|GH13_13 368 ASNVDLLIYNDNKTL---SQRIDMVRDDTSGVWRHEGDMS 404 566777776665554...578999999999*******986 PP == domain 3 score: -2.2 bits; conditional E-value: 0.38 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgd 68 + +g++++t + + G+++ +k++ e+ s+++f +g+ AUI84544.1|CBM41|CBM48|GH13_13 1133 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAADGE 1172 3233777888888888888888887357788888766664 PP == domain 4 score: -3.8 bits; conditional E-value: 1 CBM41.hmm 14 ydgwglwtWgddveaepsdwggalef 39 y+g +++t+ +dve g +ef AUI84544.1|CBM41|CBM48|GH13_13 1245 YQGGRIYTFSRDVE------PGTYEF 1264 88889999999996......444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 129.18 // Query: AXR08462.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-21 61.0 1.2 8.1e-21 61.0 1.2 2.8 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.0 1.2 8.1e-21 8.1e-21 1 98 [. 94 213 .. 94 216 .. 0.86 2 ? -3.5 0.0 0.99 0.99 68 95 .. 382 407 .. 373 410 .. 0.67 3 ? -2.9 0.1 0.65 0.65 26 57 .. 1126 1153 .. 1118 1174 .. 0.66 4 ? -3.1 0.2 0.71 0.71 18 69 .. 1354 1407 .. 1348 1425 .. 0.58 Alignments for each domain: == domain 1 score: 61.0 bits; conditional E-value: 8.1e-21 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdwggaleftgkDd.yGayadvklkega.skigfiv 64 n+++++Y+r +d ydgw+l+tW+++++ ++++ w++ + +g D+ yGay+ + lk+++ ++ +fi+ AXR08462.1|CBM41|CBM48|GH13_13 94 NEAVLYYNRkhvdaentpSDTAYDGWRLHTWNNETCdayaDDDTAWDNGRPISGIDPtYGAYWILALKPDYdQCHNFII 172 67899****99999999999****************9743244499888*******************988467***** PP CBM41.hmm 65 rkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvy 98 +kg ++k+lg gD + +l++ + ++ ++ +g+++++ AXR08462.1|CBM41|CBM48|GH13_13 173 HKGtddAGKALGtGDFQAPLDQddeTFTRMNFTLDGEATIF 213 **87778888999*******997777778888888888876 PP == domain 2 score: -3.5 bits; conditional E-value: 0.99 CBM41.hmm 68 dkkdlggDrkidllkdgsaevwlvsgde 95 d+k l++ ++++l++ + vw+ + de AXR08462.1|CBM41|CBM48|GH13_13 382 DDKTLQQRYSMTLDE--ASGVWTYQADE 407 556666666666644..77888888776 PP == domain 3 score: -2.9 bits; conditional E-value: 0.65 CBM41.hmm 26 veaepsdwggaleftgkDdyGayadvklkega 57 + +wg++++ + +++ + ++v+l++++ AXR08462.1|CBM41|CBM48|GH13_13 1126 MN----EWGTQHPLNYQGNGQYRVQVNLNAET 1153 33....68888888666666666666666533 PP == domain 4 score: -3.1 bits; conditional E-value: 0.71 CBM41.hmm 18 glwtWgddveaeps..dw.ggaleftgkDdyGayadvklkegaskigfivrkgdk 69 +l W+ + +++ + + gga+ef+ + +a++++ +++a++ ++v + + AXR08462.1|CBM41|CBM48|GH13_13 1354 DLLQWQGGSTYA-VdiAIaGGATEFKIASQDWATVNLGNPDNATSNTVVVDEAKR 1407 566777444222.235677888888776666666666666666665555555433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 143.89 // Query: QYJ75697.1|CBM41|CBM48|GH13_13 [L=1441] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-22 64.5 0.1 6.3e-22 64.5 0.1 2.7 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.5 0.1 6.3e-22 6.3e-22 1 101 [. 89 212 .. 89 213 .. 0.86 2 ? -0.8 0.7 0.14 0.14 12 62 .. 910 965 .. 905 968 .. 0.67 Alignments for each domain: == domain 1 score: 64.5 bits; conditional E-value: 6.3e-22 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d ydg++l+tW++d++ ++p dw + +ef+g D+ yGay+ ++lkeg+ ++ +fi QYJ75697.1|CBM41|CBM48|GH13_13 89 NEAVIYYNRpkdadnspNDPVYDGYRLHTWNNDTCdaYAPPfdssDWANGHEFDGIDPnYGAYWILNLKEGYgECGNFI 167 6799*****9998888777889*************8644445666**888********************99568**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 ++ g ++k+lg gD k++l++ + + ++ +g ++v+++p QYJ75697.1|CBM41|CBM48|GH13_13 168 IHVGtegSGKALGdGDFKMPLKQddeKFVRMNFTLHGTPSVFEYP 212 **977779999999*******997777778889999999999876 PP == domain 2 score: -0.8 bits; conditional E-value: 0.14 CBM41.hmm 12 gdydgwglwtWgddveaepsdwggalef..tgkDdyGayadvklkega....skigf 62 ++yd+ +++ + d+++++++w+ l+ ++++++ + +++++++ s+igf QYJ75697.1|CBM41|CBM48|GH13_13 910 NSYDSGDWFNYV-DFTQSGNNWNVGLPLaqDNQGNWNTITGISANPNTaasaSEIGF 965 678888888888.55345669977787744668888888888888644333356666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1441 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 159.76 // Query: ALO36537.1|CBM41|CBM48|GH13_13 [L=1409] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-24 73.4 2.2 1.1e-24 73.4 2.2 3.7 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.4 2.2 1.1e-24 1.1e-24 2 100 .. 148 256 .. 147 257 .. 0.85 2 ? -3.2 0.0 0.78 0.78 32 67 .. 538 575 .. 530 593 .. 0.68 3 ? -3.0 0.4 0.66 0.66 22 44 .. 956 981 .. 946 1003 .. 0.60 4 ? -1.3 0.6 0.2 0.2 17 57 .. 1305 1348 .. 1296 1382 .. 0.58 Alignments for each domain: == domain 1 score: 73.4 bits; conditional E-value: 1.1e-24 CBM41.hmm 2 tvrvhYkradgdydgwglwtWgddve..a......epsdwggaleftgkDd.yGayadvklkega.skigfivrkgdkk 70 ++++ Y+r+d++y++w l++W+ d + + e++ w + +g+D+ yGay+ ++lk ++ + +fiv+kgd+k ALO36537.1|CBM41|CBM48|GH13_13 148 ELVIFYNRSDDNYENWVLHLWNGDGCiaYadfaddEGTVWALGQAANGEDAnYGAYWILPLKTDHnGCANFIVHKGDEK 226 689**********************9962555554555896667779*9999**********866269*********** PP CBM41.hmm 71 dlggDrkidllkdgsaevwlvsgdekvyts 100 d+ggD + ++ +g++ +w+ sg++++yt+ ALO36537.1|CBM41|CBM48|GH13_13 227 DIGGDTNNVVDLTGEHTIWTLSGNSELYTE 256 **988877776689**************97 PP == domain 2 score: -3.2 bits; conditional E-value: 0.78 CBM41.hmm 32 dw.ggaleftgkDd.yGayadvklkegaskigfivrkg 67 + g+ l+ft++D+ +y + +++g ++++++ ++ ALO36537.1|CBM41|CBM48|GH13_13 538 QNrGKYLAFTETDSnAVQYLKSLADAGVTHFHMLPAND 575 33488899999998566666666666777777776665 PP == domain 3 score: -3.0 bits; conditional E-value: 0.66 CBM41.hmm 22 Wgddve.aeps.dwggaleftg.kDd 44 W + v+ +++s +w++ ++ ++ +D+ ALO36537.1|CBM41|CBM48|GH13_13 956 WYNAVDySNQSnNWQAGTPIDNsNDS 981 33344434555688777777542555 PP == domain 4 score: -1.3 bits; conditional E-value: 0.2 CBM41.hmm 17 wglwtWgddveaeps.dwggalef...tgkDdyGayadvklkega 57 ++l++ g++ ++++ d+ g+++f + Dd+ +v++++++ ALO36537.1|CBM41|CBM48|GH13_13 1305 YRLHYKGNNI-YQAVaDFAGDMQFklaSDDDDWTTQLWVQAEASN 1348 5566666555.4555566777777765556667777777776544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1409 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.88 // Query: ATC83767.1|CBM41|CBM48|GH13_13 [L=1434] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-21 60.9 0.1 8.5e-21 60.9 0.1 3.2 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.9 0.1 8.5e-21 8.5e-21 2 101 .. 90 205 .. 89 206 .. 0.86 2 ? -1.8 0.2 0.3 0.3 30 71 .. 297 339 .. 279 377 .. 0.65 3 ? -3.0 0.2 0.69 0.69 22 58 .. 912 952 .. 901 955 .. 0.57 4 ? -2.5 0.0 0.49 0.49 13 41 .. 1240 1262 .. 1236 1305 .. 0.68 Alignments for each domain: == domain 1 score: 60.9 bits; conditional E-value: 8.5e-21 CBM41.hmm 2 tvrvhYkr.adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfivrkg...d 68 ++++ Y+r ad++y+g++l+ W+++v+ ++p dw + +e +g D+ yGay+ ++lkeg+ ++ +fi++ g + ATC83767.1|CBM41|CBM48|GH13_13 90 EAVLFYNRlADDNYEGYRLHSWNNEVCdaYAPPfdtsDWANGHEYDGIDPnYGAYWIINLKEGYnECANFIIHIGtegT 168 57899***6779***************8644445666**777999****************988357******976668 PP CBM41.hmm 69 kkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 +k++g D +++l + + ++ ++ +g+++v+++p ATC83767.1|CBM41|CBM48|GH13_13 169 GKAFGdVDLTMPLMQddeTFQRMNFTIHGEPSVFEYP 205 888999*******9988889999**********9986 PP == domain 2 score: -1.8 bits; conditional E-value: 0.3 CBM41.hmm 30 psdw.ggaleftgkDdyGayadvklkegaskigfivrkgdkkd 71 ++ + +l +g D+ G+ + ++ ++a+ + + ++g++++ ATC83767.1|CBM41|CBM48|GH13_13 297 AKALiKSQLVIAGYDSEGKLLEASYVQTAKALDALYTQGEDDA 339 3344467777789999999999999999999999988884443 PP == domain 3 score: -3.0 bits; conditional E-value: 0.69 CBM41.hmm 22 Wgddve.aeps.dwggalef..tgkDdyGayadvklkegas 58 W + v+ ++++ +w+ l+ ++++++ +++ ++++++a+ ATC83767.1|CBM41|CBM48|GH13_13 912 WFNAVDlTKENnNWNIGLPNaeKNQEKWSEIMPISANPDAQ 952 54455553444477444444334466677777777777765 PP == domain 4 score: -2.5 bits; conditional E-value: 0.49 CBM41.hmm 13 dydgwglwtWgddveaepsdwggaleftg 41 +y+g g++t+ + + +++ef+ ATC83767.1|CBM41|CBM48|GH13_13 1240 SYKGKGIYTFTKTLN------AASYEFKI 1262 799999999996665......44444433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1434 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 145.74 // Query: ALM90456.1|CBM41|CBM48|GH13_13 [L=1458] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-20 59.1 3.9 3.8e-20 58.8 2.0 2.3 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.8 2.0 3.8e-20 3.8e-20 1 101 [. 126 248 .. 126 249 .. 0.86 2 ? -3.6 0.0 1 1 68 96 .. 393 419 .. 383 421 .. 0.67 Alignments for each domain: == domain 1 score: 58.8 bits; conditional E-value: 3.8e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve..aeps..dwggaleftgkDd.yGayadvklkega.skigfiv 64 n+++++Y+r +d y+gw+l+tW++d + +++s dw + + tg D+ yGay+ ++lk++ ++ +fi+ ALM90456.1|CBM41|CBM48|GH13_13 126 NQAVLYYNRaavdadnstNDPVYEGWRLHTWNNDECdaYADSdtDWANGRQHTGIDPnYGAYWVLDLKNDFdDCHNFII 204 688999***88888887777889*************98445556**666777****99**********998458***** PP CBM41.hmm 65 rkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 + g ++k+lg +D + +l + + + ++ sg+++++++p ALM90456.1|CBM41|CBM48|GH13_13 205 HLGtddAGKELGgSDFQASLVQdddTYVRMNFTLSGEPTLFEYP 248 *876678899999***999999888899999******9999886 PP == domain 2 score: -3.6 bits; conditional E-value: 1 CBM41.hmm 68 dkkdlggDrkidllkdgsaevwlvsgdek 96 d+k l + ++++ d + +w ++gd + ALM90456.1|CBM41|CBM48|GH13_13 393 DNKTLANRYSMTR--DTVTGIWQFEGDMS 419 5555555555555..45899999999865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1458 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.40 // Query: ARU30160.1|CBM41|CBM48|GH13_13 [L=1484] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-08 20.9 1.0 1e-07 18.9 0.4 2.5 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.9 0.4 1e-07 1e-07 10 83 .. 92 193 .. 77 211 .. 0.73 2 ? -4.2 0.0 1 1 38 76 .. 1287 1325 .. 1273 1332 .. 0.65 Alignments for each domain: == domain 1 score: 18.9 bits; conditional E-value: 1e-07 CBM41.hmm 10 adgdydgwglwtWgddvea........................epsdwggaleftgkDd.yGayadvklke.gaskigf 62 +++ y+g++l++W+ + + s+ ++ ++D+ yGa++ ++++e g ++ ++ ARU30160.1|CBM41|CBM48|GH13_13 92 KNAAYAGYNLHLWQACG-NgwadstvdgnntswsiptewpdgpNVSSRNDGESGIKHDPyYGAFFVIPASEtGGTCGNY 169 5689*********8333.234578899999988877776654322233444444778988**********846689*** PP CBM41.hmm 63 ivrkgdkkdlggDrkidllk...d 83 iv++ + ++++D +++++ d ARU30160.1|CBM41|CBM48|GH13_13 170 IVKTPGGAAQTNDLQMQIKRnggD 193 ****99999999*99998774443 PP == domain 2 score: -4.2 bits; conditional E-value: 1 CBM41.hmm 38 eftgkDdyGayadvklkegaskigfivrkgdkkdlggDr 76 + +gk y ++dv+++++a ++++ ++ ++ +lggD ARU30160.1|CBM41|CBM48|GH13_13 1287 TYEGKRIYALIVDVTASDQAREFKVASEDWSSVNLGGDL 1325 445555677788888888887777666665666666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1484 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.00 // Query: QPL51724.1|CBM41|CBM48|GH13_13 [L=1442] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-22 65.4 3.2 2.9e-21 62.4 1.3 3.5 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.4 1.3 2.9e-21 2.9e-21 1 101 [. 90 212 .. 90 213 .. 0.85 2 ? -0.4 0.0 0.11 0.11 62 96 .. 373 404 .. 359 408 .. 0.77 3 ? -2.1 0.0 0.34 0.34 48 77 .. 1382 1412 .. 1345 1421 .. 0.71 Alignments for each domain: == domain 1 score: 62.4 bits; conditional E-value: 2.9e-21 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d++ ++++dw +g + tg D+ yGay+ ++lkeg+ ++ +fi QPL51724.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRaavdadnssNDPAYEGWRLHTWNNDTCdayaDADTDWaNG-RTHTGIDPnYGAYWILELKEGYgDCHNFI 167 688999***99999888888999*************97533555**666.666****99***********99568**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 +++g ++k++g gD + +l + + + ++ sg+++++++p QPL51724.1|CBM41|CBM48|GH13_13 168 IHQGtddAGKEMGgGDFQASLVQdddTFVRMNFTLSGEPTLFEYP 212 **987778888888*****99997778889999999999999876 PP == domain 2 score: -0.4 bits; conditional E-value: 0.11 CBM41.hmm 62 fivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 +++ ++kk +++i++l d+ + vw +gd + QPL51724.1|CBM41|CBM48|GH13_13 373 LLLYSENKKL---NQRIEMLRDDVSGVWRYEGDMS 404 5555555554...899****************986 PP == domain 3 score: -2.1 bits; conditional E-value: 0.34 CBM41.hmm 48 yadvklkegaskigfivrkgdkkdlg.gDrk 77 a+v+l + ++ ++ +v +g++k lg ++ + QPL51724.1|CBM41|CBM48|GH13_13 1382 WATVNLGNPNDAVSNLVVEGEAKTLGsSNNN 1412 4678888888889999999988886654443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1442 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 148.36 // Query: ARD23341.1|CBM41|CBM48|GH13_13 [L=1446] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-20 60.6 0.9 1.1e-20 60.6 0.9 3.1 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.6 0.9 1.1e-20 1.1e-20 1 101 [. 90 219 .. 90 220 .. 0.87 2 ? -3.3 0.0 0.87 0.87 68 96 .. 383 409 .. 373 411 .. 0.70 3 ? 1.7 0.2 0.023 0.023 12 42 .. 916 945 .. 910 969 .. 0.75 Alignments for each domain: == domain 1 score: 60.6 bits; conditional E-value: 1.1e-20 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r ++ +y g++l+tW++d++ ++p dw + + f+g D+ yGay+ ++lkeg+ ++ +fi ARD23341.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRikdndntdSNPNYPGYKLHTWNNDTCdsYAPPfdstDWANGHSFDGIDPnYGAYWIINLKEGYgECANFI 168 68999****999999666689**************86444456669*778********************99568**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk.........dgsaevwlvsgdekvytsp 101 v+ g ++k+lg gD ++l+ + ++ ++ +g+++vy +p ARD23341.1|CBM41|CBM48|GH13_13 169 VHIGtegSGKALGdGDLVMNLKVlaedgepeaNFNRTNFTIHGESDVYDYP 219 **976679999999**9999977899999999999999**********986 PP == domain 2 score: -3.3 bits; conditional E-value: 0.87 CBM41.hmm 68 dkkdlggDrkidllkdgsaevwlvsgdek 96 ++k+l++ + ++l++ + +w +sgd + ARD23341.1|CBM41|CBM48|GH13_13 383 AAKNLTSTEAMSLDA--DTGIWSFSGDMS 409 455566566666644..889999999975 PP == domain 3 score: 1.7 bits; conditional E-value: 0.023 CBM41.hmm 12 gdydgwglwtWgddveaeps.dwggaleftgk 42 + yd+ +++ W d+ +++s +w+ l+ ++ ARD23341.1|CBM41|CBM48|GH13_13 916 NTYDSGDWFNWV-DF-TKESnNWNVGLPLEQD 945 789999999999.77.4566599888887554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1446 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 152.05 // Query: AMJ96551.1|CBM41|CBM48|GH13_13 [L=1449] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-20 59.8 3.5 3.8e-20 58.8 2.0 2.5 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.8 2.0 3.8e-20 3.8e-20 1 101 [. 96 218 .. 96 219 .. 0.86 2 ? -3.7 0.0 1 1 68 95 .. 384 409 .. 374 411 .. 0.66 Alignments for each domain: == domain 1 score: 58.8 bits; conditional E-value: 3.8e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve..aeps..dwggaleftgkDd.yGayadvklkega.skigfiv 64 n+++++Y+r +d y+gw+l+tW++d + +++s dw + + tg D+ yGay+ ++lk++ ++ +fi+ AMJ96551.1|CBM41|CBM48|GH13_13 96 NQAVLYYNRaavdadnstNDPVYEGWRLHTWNNDECdaYADSdtDWANGRQHTGIDPnYGAYWVLDLKNDFdDCHNFII 174 688999***88888887777889*************98445556**666777****99**********998458***** PP CBM41.hmm 65 rkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 + g ++k+lg +D + +l + + + ++ sg+++++++p AMJ96551.1|CBM41|CBM48|GH13_13 175 HLGtddAGKELGgSDFQASLVQdddTYVRMNFTLSGEPTLFEYP 218 *876678899999***999999888899999******9999886 PP == domain 2 score: -3.7 bits; conditional E-value: 1 CBM41.hmm 68 dkkdlggDrkidllkdgsaevwlvsgde 95 d+k l + ++++ d + +w ++gd AMJ96551.1|CBM41|CBM48|GH13_13 384 DNKTLANRYSMTR--DTVTGIWQFEGDM 409 5555555555555..4589999999986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1449 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.02 // Query: BCO19222.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-21 61.5 0.9 5.4e-21 61.5 0.9 2.5 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.5 0.9 5.4e-21 5.4e-21 1 99 [. 90 210 .. 90 212 .. 0.85 2 ? -4.4 1.0 1 1 13 43 .. 902 930 .. 899 938 .. 0.54 Alignments for each domain: == domain 1 score: 61.5 bits; conditional E-value: 5.4e-21 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve...aeps.dw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r d y+gw+l+tW++d++ a+p dw +g ++ tg D+ yGay+ ++lk+g+ ++ +fi BCO19222.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRasvdadnssGDPAYEGWRLHTWNNDTCdayADPDtDWaNGRVH-TGVDPnYGAYWVLDLKDGYgDCHNFI 167 67899999988888776666789*************97534447**888777.9***99***********99568**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD k +l++ + ++ ++ sg+++v++ BCO19222.1|CBM41|CBM48|GH13_13 168 IHKGtddAGKEMGgGDFKGSLIQddeTFTRMNFTLSGEPTVFE 210 ***87778888888***99999987788899999999999985 PP == domain 2 score: -4.4 bits; conditional E-value: 1 CBM41.hmm 13 dydgwglwtWgddveaepsdwggaleftgkD 43 yd+ +++ + d+++++++w+ l+ + +D BCO19222.1|CBM41|CBM48|GH13_13 902 TYDSGDWFNYV-DFTYQTNNWNVGLPLA-QD 930 55666666665.4424444777766653.33 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 160.56 // Query: CAB9493951.1|CBM41|CBM48|GH13_13 [L=1472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-22 64.8 1.5 4.4e-21 61.8 1.0 3.0 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.8 1.0 4.4e-21 4.4e-21 1 98 [. 119 238 .. 119 241 .. 0.86 2 ? -2.3 0.0 0.42 0.42 60 96 .. 400 433 .. 388 436 .. 0.70 Alignments for each domain: == domain 1 score: 61.8 bits; conditional E-value: 4.4e-21 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skig 61 n+++++Y+r +d+ y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ + CAB9493951.1|CBM41|CBM48|GH13_13 119 NQAVLYYNRaavdadnssNDAAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHN 194 68899****999999998899***************97533555**999888.999999***********99678** PP CBM41.hmm 62 fivrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvy 98 fi++kg ++k++g gD + +l + + + ++ sg+++++ CAB9493951.1|CBM41|CBM48|GH13_13 195 FIIHKGtddAGKEMGgGDFQASLVQddeTFVRMNFTLSGEPTIF 238 *****87778888888****999997667778888888888887 PP == domain 2 score: -2.3 bits; conditional E-value: 0.42 CBM41.hmm 60 igfivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 + +++ ++dk+ ++id+ d+ + vw +gd + CAB9493951.1|CBM41|CBM48|GH13_13 400 VDLLLYNDDKTL---SQRIDMVRDDASGVWRYEGDMS 433 555554444443...5778888888999999999975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1472 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 160.58 // Query: AGP81870.1|CBM41|CBM48|GH13_13 [L=1472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-21 61.6 1.0 5e-21 61.6 1.0 3.5 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.6 1.0 5e-21 5e-21 1 99 [. 119 239 .. 119 241 .. 0.87 2 ? -0.2 0.0 0.093 0.093 57 96 .. 397 433 .. 384 437 .. 0.77 3 ? -2.2 0.2 0.37 0.37 31 69 .. 1162 1202 .. 1146 1219 .. 0.67 Alignments for each domain: == domain 1 score: 61.6 bits; conditional E-value: 5e-21 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d+ y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi AGP81870.1|CBM41|CBM48|GH13_13 119 NQAVLYYNRaavdadnssNDAAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 196 68899****999999998899***************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ AGP81870.1|CBM41|CBM48|GH13_13 197 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 239 ***87778888888*****999977788888899999999875 PP == domain 2 score: -0.2 bits; conditional E-value: 0.093 CBM41.hmm 57 askigfivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 as++ +++ +++k+ ++id+ d+++ vw ++gd + AGP81870.1|CBM41|CBM48|GH13_13 397 ASNVDLLIYNDNKTL---SQRIDMVRDDTSGVWRHEGDMS 433 566777776665554...578999999999*******986 PP == domain 3 score: -2.2 bits; conditional E-value: 0.37 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgdk 69 + +g++++t + + G+++ +k++ e+ s+++f +g++ AGP81870.1|CBM41|CBM48|GH13_13 1162 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAADGEE 1202 33347788888888888888888873577888887666644 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1472 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 153.75 // Query: QBG36859.1|CBM41 [L=846] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-12 33.7 2.2 1e-11 31.7 2.2 2.1 1 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.7 2.2 1e-11 1e-11 12 89 .. 228 317 .. 212 328 .. 0.72 Alignments for each domain: == domain 1 score: 31.7 bits; conditional E-value: 1e-11 CBM41.hmm 12 gdydgwglwtWgddve...aeps..dwggalef....tgkDd.yGayadvklkegas.kigfivrkg.dkkdlg.gDrkidllkdgsaevw 89 + y+++ ++tW++d + ++++ +wg + + +g Dd yG y+++ l eg+s + ++i +++ ++k+++ +D +++ + v+ QBG36859.1|CBM41 228 ALYENMVVHTWNNDDCtayQKDTlsNWGSNSDYanknKGIDDnYGHYWKLHLVEGHSnCGNIIFNDTaEGKKISdNDLVMPIGP-SGNVVF 317 679***********99875445588995555544576777777**********9886157777777687777675777776644.555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (846 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 121.77 // Query: ASM55473.1|CBM41|CBM48|GH13_13 [L=1334] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-19 55.0 0.0 5.9e-19 55.0 0.0 3.4 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 55.0 0.0 5.9e-19 5.9e-19 3 101 .. 93 207 .. 91 208 .. 0.84 2 ? -0.1 0.1 0.083 0.083 15 71 .. 285 341 .. 278 370 .. 0.78 3 ? -3.0 0.3 0.69 0.69 22 58 .. 914 954 .. 903 957 .. 0.56 4 ? -2.3 0.0 0.42 0.42 13 61 .. 1247 1268 .. 1224 1310 .. 0.64 Alignments for each domain: == domain 1 score: 55.0 bits; conditional E-value: 5.9e-19 CBM41.hmm 3 vrvhYkrad.gdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfivrkg...dk 69 +++ Ykr++ + y+g++l+ W++d + ++p +w++ +e +g D+ yGay+ v+lk+g+ ++ +fi++ g ++ ASM55473.1|CBM41|CBM48|GH13_13 93 AILFYKRPEnEGYEGYRLHSWNTDGCdaYAPPfdatEWSDGHEYDGIDPnYGAYWIVTLKDGYtECANFIIHIGtegSG 171 6889***77589**************86444456659*8889******************988357******9766778 PP CBM41.hmm 70 kdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 k+ g +D +++l + + ++++g+++v+++p ASM55473.1|CBM41|CBM48|GH13_13 172 KAHGdADLTMPLMQddeRFVRMNFTFDGEPSVFEYP 207 88888*******997666778889999999999886 PP == domain 2 score: -0.1 bits; conditional E-value: 0.083 CBM41.hmm 15 dgwglwtWgddveaepsdw.ggaleftgkDdyGayadvklkegaskigfivrkgdkkd 71 ++w+ + + d+ a++++ +++l +g D+ G+ + ++ ++a+ + + ++g++++ ASM55473.1|CBM41|CBM48|GH13_13 285 TDWTAYQGNWDA-ATAKQLiKQQLVLAGYDAEGKLLEASFVQTAKALDALYTQGESDA 341 566666666444.4555777999999***************99999999999885544 PP == domain 3 score: -3.0 bits; conditional E-value: 0.69 CBM41.hmm 22 Wgddve.aeps.dwggalef..tgkDdyGayadvklkegas 58 W + v+ ++++ +w+ l+ ++++++ +++ ++++++a+ ASM55473.1|CBM41|CBM48|GH13_13 914 WFNAVDlTKENnNWNIGLPNaeKNQEKWSEIMPISANADAQ 954 44455553333477444444234466677777777777665 PP == domain 4 score: -2.3 bits; conditional E-value: 0.42 CBM41.hmm 13 dydgwglwtWgddveaepsdwggaleftgkDdyGayadvklkegaskig 61 y+g gl+t+ ++ +++++ + ASM55473.1|CBM41|CBM48|GH13_13 1247 TYTGDGLYTFSKQL---------------------------SAQSDAYE 1268 35555555555333...........................33333332 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1334 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 123.26 // Query: QDG38488.1|CBM41|CBM48|GH13_13 [L=1472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-20 60.6 0.9 1.1e-20 60.6 0.9 3.4 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.6 0.9 1.1e-20 1.1e-20 1 99 [. 119 239 .. 119 241 .. 0.86 2 ? -2.8 0.0 0.6 0.6 67 96 .. 407 433 .. 390 436 .. 0.67 3 ? -1.7 0.1 0.27 0.27 31 70 .. 1162 1203 .. 1146 1222 .. 0.68 4 ? -2.7 0.0 0.54 0.54 13 45 .. 1273 1300 .. 1269 1312 .. 0.74 Alignments for each domain: == domain 1 score: 60.6 bits; conditional E-value: 1.1e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi QDG38488.1|CBM41|CBM48|GH13_13 119 NQAVLYYNRaavdadnsnNDPAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 196 688999**999998888788899*************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ QDG38488.1|CBM41|CBM48|GH13_13 197 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 239 ***87778888888*****999977788888899999999875 PP == domain 2 score: -2.8 bits; conditional E-value: 0.6 CBM41.hmm 67 gdkkdlggDrkidllkdgsaevwlvsgdek 96 + +k l +++d+ d+++ vw +gd + QDG38488.1|CBM41|CBM48|GH13_13 407 D-NKTL--SQRVDMVRDDTSGVWRYEGDMS 433 3.3332..3667777788899999999875 PP == domain 3 score: -1.7 bits; conditional E-value: 0.27 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgdkk 70 + +g++++t + + G+++ +k++ e+ s+++f +g++ QDG38488.1|CBM41|CBM48|GH13_13 1162 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAANGEEG 1203 333478888888888999999999735779999977777544 PP == domain 4 score: -2.7 bits; conditional E-value: 0.54 CBM41.hmm 13 dydgwglwtWgddveaepsdwggalef.tgkDdy 45 y+g +++t+++dve g +ef Dd+ QDG38488.1|CBM41|CBM48|GH13_13 1273 AYQGGRIYTFARDVE------PGTYEFkVASDDW 1300 589999999999997......6777773335554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1472 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.92 // Query: QMW14772.1|CBM41|CBM48|GH13_13 [L=1438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-22 66.3 5.9 2.5e-21 62.6 0.5 3.1 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.6 0.5 2.5e-21 2.5e-21 2 101 .. 92 207 .. 91 208 .. 0.85 2 ! 4.9 0.7 0.0024 0.0024 12 59 .. 908 956 .. 902 965 .. 0.78 Alignments for each domain: == domain 1 score: 62.6 bits; conditional E-value: 2.5e-21 CBM41.hmm 2 tvrvhYkr.adgdydgwglwtWgddve...aeps....dwggaleftgkDd.yGayadvklkega.skigfivrkg... 67 ++++ Y+r +d+ y+g++l+tW++dv+ a+ dw + +e +g D+ yGay+ vklk+g+ ++ +fiv+ g QMW14772.1|CBM41|CBM48|GH13_13 92 EAILFYNRtSDDAYEGYRLHTWNNDVCdayAA-PfdatDWANGHEYDGIDPnYGAYWIVKLKDGYnECANFIVHIGteg 169 57889*9945599**************86322.23555**777999****************988357******97667 PP CBM41.hmm 68 dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 ++k++g D k++l + + ++ ++ +g+++v+++p QMW14772.1|CBM41|CBM48|GH13_13 170 SGKAFGdVDLKMPLMQddeKFQRMNFTIHGEPSVFEYP 207 9999999*******99888889999*********9986 PP == domain 2 score: 4.9 bits; conditional E-value: 0.0024 CBM41.hmm 12 gdydgwglwtWgddveaeps.dwggalef..tgkDdyGayadvklkegask 59 ++yd+ +++ + d+ ++++ +w+ l++ +++ ++G++a ++++ +a+ QMW14772.1|CBM41|CBM48|GH13_13 908 NSYDSGDWFNFV-DF-SKETnNWNVGLPPaqDNQAKWGEIAPISANTNAQA 956 788999999998.77.466669*9999995455677*********998865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1438 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.96 // Query: AOW76317.1|CBM41|CBM48|GH13_13 [L=1396] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.9e-25 73.5 2.1 9.9e-25 73.5 2.1 2.8 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.5 2.1 9.9e-25 9.9e-25 1 101 [. 145 250 .. 145 251 .. 0.89 2 ? -3.8 0.1 1 1 32 54 .. 945 966 .. 937 995 .. 0.48 3 ? -2.3 0.5 0.4 0.4 15 41 .. 1290 1316 .. 1283 1343 .. 0.57 Alignments for each domain: == domain 1 score: 73.5 bits; conditional E-value: 9.9e-25 CBM41.hmm 1 ntvrvhYkradgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfivrkgdkkdl 72 n++++ Y+rad+ y++w +++W+++++ ++++dw +g+++ tg D+ yGay+ ++lk+g+ ++ +fi++kgd+kdl AOW76317.1|CBM41|CBM48|GH13_13 145 NELVIFYNRADATYSNWIIHLWNNETCdayaNADTDWaTGQAQ-TGLDPnYGAYWLIDLKAGYgDCANFIIHKGDDKDL 222 6899***********************97533455**666666.999999***********99568************* PP CBM41.hmm 73 g.gDrkidllkdgsaevwlvsgdekvytsp 101 g D++ dl+ g + w+ sg ++vyt+p AOW76317.1|CBM41|CBM48|GH13_13 223 GgIDHQADLS--GDRMTWTLSGISDVYTQP 250 *99**99995..6999************97 PP == domain 2 score: -3.8 bits; conditional E-value: 1 CBM41.hmm 32 dwggaleftgkDdyGayadvklk 54 dw ++++ft + + + ++l+ AOW76317.1|CBM41|CBM48|GH13_13 945 DWFNKVDFTMSTNNWNV-GLPLA 966 55444555544433322.22222 PP == domain 3 score: -2.3 bits; conditional E-value: 0.4 CBM41.hmm 15 dgwglwtWgddveaeps.dwggaleftg 41 ++ +l++ g+++ ++++ +++ga++f+ AOW76317.1|CBM41|CBM48|GH13_13 1290 EEFRLHYKGNNQ-YQAVaEFDGAMQFKL 1316 555666666444.444534566666643 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1396 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 150.63 // Query: AFV85574.1|CBM41|CBM48|GH13_13 [L=1472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-20 60.6 0.9 1.1e-20 60.6 0.9 3.1 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.6 0.9 1.1e-20 1.1e-20 1 99 [. 119 239 .. 119 241 .. 0.86 2 ? -3.7 0.0 1 1 69 95 .. 408 432 .. 394 434 .. 0.63 3 ? -2.9 0.2 0.63 0.63 33 68 .. 1165 1201 .. 1150 1218 .. 0.67 4 ? -3.2 0.0 0.81 0.81 14 40 .. 1274 1294 .. 1270 1313 .. 0.64 Alignments for each domain: == domain 1 score: 60.6 bits; conditional E-value: 1.1e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi AFV85574.1|CBM41|CBM48|GH13_13 119 NQAVLYYNRaavdadnsnNDPAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 196 688999**999998888788899*************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ AFV85574.1|CBM41|CBM48|GH13_13 197 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 239 ***87778888888*****999977788888899999999875 PP == domain 2 score: -3.7 bits; conditional E-value: 1 CBM41.hmm 69 kkdlggDrkidllkdgsaevwlvsgde 95 +k l +++d+ d+++ vw +gd AFV85574.1|CBM41|CBM48|GH13_13 408 NKTL--SQRLDMVRDDTSGVWRYEGDM 432 3332..355666667788999999886 PP == domain 3 score: -2.9 bits; conditional E-value: 0.63 CBM41.hmm 33 wggaleftgkDdyGayadvklk.egaskigfivrkgd 68 +g++++t + + G+++ +k++ e+ s+++f +g+ AFV85574.1|CBM41|CBM48|GH13_13 1165 GDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAADGE 1201 3777888888888888888887357788888666664 PP == domain 4 score: -3.2 bits; conditional E-value: 0.81 CBM41.hmm 14 ydgwglwtWgddveaepsdwggaleft 40 y+g +++t+ +dve g +ef+ AFV85574.1|CBM41|CBM48|GH13_13 1274 YQGGRVYTFSRDVE------PGTYEFK 1294 88899999999996......3444442 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1472 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 141.82 // Query: AEA98044.1|CBM41|CBM48|GH13_13 [L=1472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-21 60.9 1.1 8.5e-21 60.9 1.1 3.1 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.9 1.1 8.5e-21 8.5e-21 1 99 [. 119 239 .. 119 241 .. 0.87 2 ? -3.0 0.0 0.7 0.7 58 96 .. 398 433 .. 392 435 .. 0.65 3 ? -2.2 0.2 0.37 0.37 31 69 .. 1162 1202 .. 1146 1219 .. 0.67 Alignments for each domain: == domain 1 score: 60.9 bits; conditional E-value: 8.5e-21 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d+ y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lk+g+ s+ +fi AEA98044.1|CBM41|CBM48|GH13_13 119 NQAVLYYNRaavdadnssNDAAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKDGYgSCHNFI 196 68899****999999998899***************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ AEA98044.1|CBM41|CBM48|GH13_13 197 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 239 ***87778888888*****999977788888899999999875 PP == domain 2 score: -3.0 bits; conditional E-value: 0.7 CBM41.hmm 58 skigfivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 s++ +++ +++k+ +++d+ d+++ vw +gd + AEA98044.1|CBM41|CBM48|GH13_13 398 SNVDLLIYNDNKTL---SQRLDMVRDDTSGVWRYEGDMS 433 55555555554443...3556666677889999999875 PP == domain 3 score: -2.2 bits; conditional E-value: 0.37 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgdk 69 + +g++++t + + G+++ +k++ e+ s+++f +g++ AEA98044.1|CBM41|CBM48|GH13_13 1162 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAADGEE 1202 33347788888888888888888873577888887666644 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1472 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 153.69 // Query: AMJ92690.1|CBM41|CBM48|GH13_13 [L=1449] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-20 59.4 3.9 3.8e-20 58.8 2.0 2.5 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.8 2.0 3.8e-20 3.8e-20 1 101 [. 96 218 .. 96 219 .. 0.86 2 ? -3.6 0.0 1 1 68 96 .. 384 410 .. 374 412 .. 0.67 Alignments for each domain: == domain 1 score: 58.8 bits; conditional E-value: 3.8e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve..aeps..dwggaleftgkDd.yGayadvklkega.skigfiv 64 n+++++Y+r +d y+gw+l+tW++d + +++s dw + + tg D+ yGay+ ++lk++ ++ +fi+ AMJ92690.1|CBM41|CBM48|GH13_13 96 NQAVLYYNRaavdadnstNDPVYEGWRLHTWNNDECdaYADSdtDWANGRQHTGIDPnYGAYWVLDLKNDFdDCHNFII 174 688999***88888887777889*************98445556**666777****99**********998458***** PP CBM41.hmm 65 rkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 + g ++k+lg +D + +l + + + ++ sg+++++++p AMJ92690.1|CBM41|CBM48|GH13_13 175 HLGtddAGKELGgSDFQASLVQdddTYVRMNFTLSGEPTLFEYP 218 *876678899999***999999888899999******9999886 PP == domain 2 score: -3.6 bits; conditional E-value: 1 CBM41.hmm 68 dkkdlggDrkidllkdgsaevwlvsgdek 96 d+k l + ++++ d + +w ++gd + AMJ92690.1|CBM41|CBM48|GH13_13 384 DNKTLANRYSMTR--DTVTGIWQFEGDMS 410 5555555555555..45899999999865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1449 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 161.54 // Query: AQT61809.1|CBM41|CBM48|GH13_13 [L=1494] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-09 23.3 0.8 2.5e-08 20.9 0.1 2.6 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.9 0.1 2.5e-08 2.5e-08 14 96 .. 115 224 .. 108 229 .. 0.71 2 ? -2.3 0.1 0.41 0.41 32 47 .. 954 970 .. 945 987 .. 0.63 Alignments for each domain: == domain 1 score: 20.9 bits; conditional E-value: 2.5e-08 CBM41.hmm 14 ydgwglwtWgddvea.........................epsdw.ggaleftgkDd.yGayadvklkegaskigfivr 65 ++++l++W+ + + + +ga+ ++D+ yGay+ ++++e+ ++ ++i++ AQT61809.1|CBM41|CBM48|GH13_13 115 FASYNLHLWQACG-NgwgssvtdgnnttyaipttwpngpgVA-SKnDGAVG-VRHDPyYGAYFVIPVSETGTCGNYIIK 190 5678888886222.2344567777777777666555432222.33255555.567777********************* PP CBM41.hmm 66 kgdkkdlggDrkidllk...dgsaevwlvsgdek 96 + + ++++D +++++ d ++ +w+ + ++ AQT61809.1|CBM41|CBM48|GH13_13 191 TPGGAAQTNDLSLTIKRdggDYERMAWIIVNADN 224 *9999999****9998888888889998766655 PP == domain 2 score: -2.3 bits; conditional E-value: 0.41 CBM41.hmm 32 dwggaleftgkDd.yGa 47 dw ++++ft++ + +G+ AQT61809.1|CBM41|CBM48|GH13_13 954 DWFNKVDFTKQTNnWGV 970 67555777665443554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1494 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 85.57 // Query: AGH44347.1|CBM41|CBM48|GH13_13 [L=1444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-17 48.8 0.1 4.9e-17 48.8 0.1 2.4 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 48.8 0.1 4.9e-17 4.9e-17 2 99 .. 91 214 .. 90 216 .. 0.83 2 ? -3.6 0.4 1 1 12 40 .. 910 937 .. 907 949 .. 0.60 Alignments for each domain: == domain 1 score: 48.8 bits; conditional E-value: 4.9e-17 CBM41.hmm 2 tvrvhYkr.........adgdydgwglwtWgddve..aeps..dw.ggaleftgkDd.yGayadvklkega.....ski 60 +++++++r +d +y+g++l+tW +d++ +++s dw + ++ +g D+ yGay+ ++lk+++ + AGH44347.1|CBM41|CBM48|GH13_13 91 QAVLYFNRaavgadnssNDPSYEGYRLHTWSNDTCnaYADSdtDWaNSRVH-NGVDPnYGAYWILDLKPNYastegACG 168 677788888887777778899**************984455569*555555.9***99**********9776776568* PP CBM41.hmm 61 gfivrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 +fi++ g ++k++g gD +++l++ d ++ +++sg ++v++ AGH44347.1|CBM41|CBM48|GH13_13 169 NFIIHIGteaAGKEMGgGDFMMPLSQddiDFTRMNFTFSGVASVFE 214 *****987888888888*******9999989999999999998875 PP == domain 2 score: -3.6 bits; conditional E-value: 1 CBM41.hmm 12 gdydgwglwtWgddveaeps.dwggaleft 40 + yd+ +++ + d+ +++s +w+ l+ + AGH44347.1|CBM41|CBM48|GH13_13 910 NTYDSGDWFSYV-DF-TKESnNWNVGLPLA 937 456666666676.55.34554777777653 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1444 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 145.55 // Query: AEP30133.1|CBM41|CBM48|GH13_13 [L=1464] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-17 49.7 0.1 1.5e-16 47.3 0.1 2.4 1 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.3 0.1 1.5e-16 1.5e-16 2 99 .. 90 214 .. 89 216 .. 0.84 Alignments for each domain: == domain 1 score: 47.3 bits; conditional E-value: 1.5e-16 CBM41.hmm 2 tvrvhYkr.........adgdydgwglwtWgddve...aeps.dw.ggaleftgkDd.yGayadvklkega.....ski 60 +++++Y+r +d +y+g++l+tW +d++ a+p w +g ++ tg D+ yGay+ ++lk+g+ + AEP30133.1|CBM41|CBM48|GH13_13 90 QAVLYYNRaavgadnspNDPSYEGYRLHTWSNDACdayADPDtAWdNGRVH-TGIDPtYGAYWVLELKPGYaltpgACQ 167 68999999999999988899***************975344479*777666.9***99***********888988779* PP CBM41.hmm 61 gfivrkg...dkkdlg.gDrkidllk....dgsaevwlvsgdekvyt 99 +fi++ g ++k++g D k +l++ + +++sg +++y+ AEP30133.1|CBM41|CBM48|GH13_13 168 NFIIHIGtddAGKEMGgIDGKAKLQQpddeRFARMNFTFSGVPTIYE 214 *****876667788777899999988777677788999999999996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1464 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 160.85 // Query: ANB23641.1|CBM41|CBM48|GH13_13 [L=1449] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-20 59.4 3.9 3.8e-20 58.8 2.0 2.5 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.8 2.0 3.8e-20 3.8e-20 1 101 [. 96 218 .. 96 219 .. 0.86 2 ? -3.6 0.0 1 1 68 96 .. 384 410 .. 374 412 .. 0.67 Alignments for each domain: == domain 1 score: 58.8 bits; conditional E-value: 3.8e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve..aeps..dwggaleftgkDd.yGayadvklkega.skigfiv 64 n+++++Y+r +d y+gw+l+tW++d + +++s dw + + tg D+ yGay+ ++lk++ ++ +fi+ ANB23641.1|CBM41|CBM48|GH13_13 96 NQAVLYYNRaavdadnstNDPVYEGWRLHTWNNDECdaYADSdtDWANGRQHTGIDPnYGAYWVLDLKNDFdDCHNFII 174 688999***88888887777889*************98445556**666777****99**********998458***** PP CBM41.hmm 65 rkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 + g ++k+lg +D + +l + + + ++ sg+++++++p ANB23641.1|CBM41|CBM48|GH13_13 175 HLGtddAGKELGgSDFQASLVQdddTYVRMNFTLSGEPTLFEYP 218 *876678899999***999999888899999******9999886 PP == domain 2 score: -3.6 bits; conditional E-value: 1 CBM41.hmm 68 dkkdlggDrkidllkdgsaevwlvsgdek 96 d+k l + ++++ d + +w ++gd + ANB23641.1|CBM41|CBM48|GH13_13 384 DNKTLANRYSMTR--DTVTGIWQFEGDMS 410 5555555555555..45899999999865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1449 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.23 // Query: ACJ30110.1|CBM41|CBM48|GH13_13 [L=1444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-21 63.5 7.7 5.3e-21 61.6 0.3 3.3 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.6 0.3 5.3e-21 5.3e-21 1 101 [. 89 212 .. 89 213 .. 0.84 2 ? -3.2 0.0 0.79 0.79 75 95 .. 382 406 .. 377 408 .. 0.65 3 ! 4.4 1.1 0.0033 0.0033 11 57 .. 913 960 .. 908 972 .. 0.75 Alignments for each domain: == domain 1 score: 61.6 bits; conditional E-value: 5.3e-21 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve...aeps....dwggaleftgkDd.yGayadvklkegas.kigf 62 n+++v+Y++ +d ydg++l+tW++d++ a+ dw + ++ +g D+ yGay+ v+lkeg+s + +f ACJ30110.1|CBM41|CBM48|GH13_13 89 NQAVVYYNNvqdadnspSDPTYDGYRLHTWNNDTCdayAA-PfdssDWANGHQIDGIDPnYGAYWIVNLKEGYSdCGNF 166 689999*99999999989999**************86422.23556**778********************99637*** PP CBM41.hmm 63 ivrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 i++ g ++k+lg gD +++l + + ++ +g+++v+++p ACJ30110.1|CBM41|CBM48|GH13_13 167 IIHIGtegSGKALGdGDLSMPLMQddeAFVRMNFTLHGEPSVFEYP 212 ***976779999999*******996555666778888888888775 PP == domain 2 score: -3.2 bits; conditional E-value: 0.79 CBM41.hmm 75 Drkidllk....dgsaevwlvsgde 95 D++++ ++ d+++ +w ++gd ACJ30110.1|CBM41|CBM48|GH13_13 382 DKSLNRSEemsfDAMTGIWSFKGDM 406 44444444444488999**999997 PP == domain 3 score: 4.4 bits; conditional E-value: 0.0033 CBM41.hmm 11 dgdydgwglwtWgddveaeps.dwggalef..tgkDdyGayadvklkega 57 ++yd+ +++ W d+ +++s +w+ l+ +++ ++ ++a ++++++a ACJ30110.1|CBM41|CBM48|GH13_13 913 RNSYDSGDWFNWV-DF-TKNShNWNVGLPRkqDNEAKWQEIAGISANPNA 960 489**********.77.456669*88888833445559999999999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1444 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 149.34 // Query: ATC88064.1|CBM41|CBM48|GH13_13 [L=1434] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-21 62.3 0.1 3.2e-21 62.3 0.1 3.7 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.3 0.1 3.2e-21 3.2e-21 2 101 .. 90 205 .. 89 206 .. 0.87 2 ? -0.3 0.4 0.098 0.098 22 71 .. 292 339 .. 274 408 .. 0.72 3 ? -1.8 0.5 0.29 0.29 12 56 .. 905 950 .. 900 960 .. 0.66 4 ? -3.7 0.0 1 1 13 39 .. 1240 1260 .. 1237 1283 .. 0.62 Alignments for each domain: == domain 1 score: 62.3 bits; conditional E-value: 3.2e-21 CBM41.hmm 2 tvrvhYkr.adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfivrkg...d 68 ++++ Y+r ad++y+g++l+ W++dv+ ++p dw + +e +g D+ yGay+ ++lkeg+ ++ +fi++ g + ATC88064.1|CBM41|CBM48|GH13_13 90 EAVLFYNRlADDNYEGYRLHSWNNDVCaaYAPPfdtsDWANGHEYDGIDPnYGAYWIINLKEGYnECANFIIHIGtegS 168 57899***6779***************8644445666**777999****************988357******976679 PP CBM41.hmm 69 kkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 +k++g D +++l + + ++ ++ +g+++v+++p ATC88064.1|CBM41|CBM48|GH13_13 169 GKAFGdVDLTMPLMQddeTFQRMNFTIHGEPSVFEYP 205 999999*******9988889999**********9986 PP == domain 2 score: -0.3 bits; conditional E-value: 0.098 CBM41.hmm 22 Wgddveaepsdw.ggaleftgkDdyGayadvklkegaskigfivrkgdkkd 71 W+ + +++++ + +l +g D+ G+ + ++ ++a+ + + ++g++++ ATC88064.1|CBM41|CBM48|GH13_13 292 WD--T-STAKTLiKSQLVIAGYDSEGKLLEASYVQTAKALDALYTQGEDDA 339 22..2.223355578888899999999999999999988888888874443 PP == domain 3 score: -1.8 bits; conditional E-value: 0.29 CBM41.hmm 12 gdydgwglwtWgddveaeps.dwggaleftgkDd..yGayadvklkeg 56 ++yd+ +++ + d+ ++++ +w+ l++++ + + +++ ++++ + ATC88064.1|CBM41|CBM48|GH13_13 905 NSYDSGDWFNFV-DF-TQDTnNWNIGLPPAQDNEvkWQEIMPISANTQ 950 678888888888.66.45666898888886544433777777776654 PP == domain 4 score: -3.7 bits; conditional E-value: 1 CBM41.hmm 13 dydgwglwtWgddveaepsdwggalef 39 +y++ g++t+ + + +++ef ATC88064.1|CBM41|CBM48|GH13_13 1240 SYKNKGIYTFTKTLS------AASYEF 1260 689999999985543......333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1434 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 120.70 // Query: QDP02817.1|CBM41|CBM48|GH13_13 [L=1430] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-18 53.1 0.1 7.4e-18 51.5 0.1 2.0 1 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.5 0.1 7.4e-18 7.4e-18 10 101 .. 103 209 .. 91 210 .. 0.83 Alignments for each domain: == domain 1 score: 51.5 bits; conditional E-value: 7.4e-18 CBM41.hmm 10 adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfivrkg...dkkdlg.gDr 76 +++dy g++l+tW++d++ ++p dw + +e +g D+ yGay+ ++lkeg+ ++ +fiv+ g ++k+lg gD QDP02817.1|CBM41|CBM48|GH13_13 103 NPDDYVGYRLHTWNTDQCdaYAPPhdtsDWANGHEYAGVDPtYGAYYILNLKEGYtECGNFIVHIGtddAGKALGsGDF 181 458***************8733334557**777999*****************88357******876678899999*** PP CBM41.hmm 77 kidllk...dgsaevwlvsgdekvytsp 101 +++l++ + + ++++g+++v+++p QDP02817.1|CBM41|CBM48|GH13_13 182 QMPLQQddpTYARMNFTFNGEPSVFEYP 209 ****99999999999*********9986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1430 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 158.94 // Query: AYA66645.1|CBM41|CBM48|GH13_13 [L=1446] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-20 60.2 0.7 1.4e-20 60.2 0.7 2.9 3 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.2 0.7 1.4e-20 1.4e-20 3 94 .. 93 206 .. 91 213 .. 0.80 2 ? -2.2 0.1 0.37 0.37 32 57 .. 1129 1154 .. 1119 1173 .. 0.78 3 ? -2.9 0.1 0.64 0.64 32 62 .. 1352 1382 .. 1348 1399 .. 0.72 Alignments for each domain: == domain 1 score: 60.2 bits; conditional E-value: 1.4e-20 CBM41.hmm 3 vrvhYkr.........adgdydgwglwtWgddve....aepsdwggaleftgkDd.yGayadvklkega.skigfivrk 66 ++++Y+r +d y+gw+l+tW++d++ ++++dw + ++tg D+ +Gay+ ++lke++ ++ +fi++k AYA66645.1|CBM41|CBM48|GH13_13 93 AVLYYNRgsvdadnvpNDPAYEGWRLHTWNNDTCdayaDADTDWANGRQPTGIDPnFGAYWVLELKENYgTCHNFIIHK 171 78999999999999988999**************97533555**777999****************999578******* PP CBM41.hmm 67 g...dkkdlg.gDrkidllk...dgsaevwlvsgd 94 g ++k++g gD +l + + ++ ++ sg+ AYA66645.1|CBM41|CBM48|GH13_13 172 GtddAGKEMGgGDFAGSLVQddeTYTRMNFTLSGE 206 87777777887888877776555566666666665 PP == domain 2 score: -2.2 bits; conditional E-value: 0.37 CBM41.hmm 32 dwggaleftgkDdyGayadvklkega 57 wg++++ft ++d ++++ +l++g+ AYA66645.1|CBM41|CBM48|GH13_13 1129 GWGTDTPFTYQGDGVYTVTATLNAGT 1154 69999999999998888888777765 PP == domain 3 score: -2.9 bits; conditional E-value: 0.64 CBM41.hmm 32 dwggaleftgkDdyGayadvklkegaskigf 62 +wg++ + t ++d ++ad+ l+ ga+++++ AYA66645.1|CBM41|CBM48|GH13_13 1352 SWGTDNTLTWQGDGTYTADIVLSGGATEFKV 1382 5766777777777777888888877776654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1446 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 154.65 // Query: ALQ09497.1|CBM41|CBM48|GH13_13 [L=1434] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-20 60.4 2.1 3.5e-20 58.9 0.1 2.9 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.9 0.1 3.5e-20 3.5e-20 1 99 [. 89 203 .. 89 205 .. 0.83 2 ? -1.7 0.3 0.27 0.27 16 71 .. 284 339 .. 280 378 .. 0.70 Alignments for each domain: == domain 1 score: 58.9 bits; conditional E-value: 3.5e-20 CBM41.hmm 1 ntvrvhYkr.adgdydgwglwtWgddve..a....epsdw.ggaleftgkDd.yGayadvklkega.skigfivrkg.. 67 n++++ Y+r +d++y+g++l+ W++dv+ ++sdw +g+++ +g D+ yGay+ +klk+++ ++ +fi++ g ALQ09497.1|CBM41|CBM48|GH13_13 89 NEAILFYNRvTDANYEGYRLHSWNNDVCdaFappfDTSDWeNGHVH-DGIDPnYGAYWIIKLKADYnECANFIIHIGte 166 578899***889****************8633343444**777666.****99**********977357******9766 PP CBM41.hmm 68 .dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 d+k++g D +++l + + ++ ++ +g+++v++ ALQ09497.1|CBM41|CBM48|GH13_13 167 gDGKAFGdVDLTMPLMQddeKFQRMNFTLHGEPSVFE 203 78899999******99987777888999999998875 PP == domain 2 score: -1.7 bits; conditional E-value: 0.27 CBM41.hmm 16 gwglwtWgddveaepsdw.ggaleftgkDdyGayadvklkegaskigfivrkgdkkd 71 +w+ + + d+ +++++ +++l ++g D G+ + ++ ++a+ + + +++++++ ALQ09497.1|CBM41|CBM48|GH13_13 284 DWTAYQGNWDA-EAAKQLiKQQLLVAGFDVDGKLLEASYVQTAKALDALYTQNENDA 339 56666655444.455566688888888999999999988888888888888775444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1434 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 153.54 // Query: APE03846.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-20 60.6 0.9 1e-20 60.6 0.9 3.3 5 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.6 0.9 1e-20 1e-20 1 99 [. 90 210 .. 90 212 .. 0.86 2 ? -3.7 0.0 1 1 69 95 .. 379 403 .. 365 405 .. 0.63 3 ? -1.7 0.1 0.26 0.26 31 70 .. 1133 1174 .. 1117 1193 .. 0.68 4 ? -3.9 0.0 1 1 14 39 .. 1245 1264 .. 1242 1280 .. 0.70 5 ? -3.9 0.1 1 1 32 57 .. 1348 1373 .. 1335 1393 .. 0.70 Alignments for each domain: == domain 1 score: 60.6 bits; conditional E-value: 1e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi APE03846.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRaavdadnsnNDPAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 167 688999**999998888788899*************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ APE03846.1|CBM41|CBM48|GH13_13 168 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 210 ***87778888888*****999977788888899999999875 PP == domain 2 score: -3.7 bits; conditional E-value: 1 CBM41.hmm 69 kkdlggDrkidllkdgsaevwlvsgde 95 +k l +++d+ d+++ vw +gd APE03846.1|CBM41|CBM48|GH13_13 379 NKTL--SQRLDMVRDDTSGVWRYEGDM 403 3332..355666667788999999886 PP == domain 3 score: -1.7 bits; conditional E-value: 0.26 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgdkk 70 + +g++++t + + G+++ +k++ e+ s+++f +g++ APE03846.1|CBM41|CBM48|GH13_13 1133 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAANGEEG 1174 333478888888888999999999735779999977777544 PP == domain 4 score: -3.9 bits; conditional E-value: 1 CBM41.hmm 14 ydgwglwtWgddveaepsdwggalef 39 y+g +++t+++dve g++ef APE03846.1|CBM41|CBM48|GH13_13 1245 YQGGRIYTFARDVE------PGSYEF 1264 88899999999996......455555 PP == domain 5 score: -3.9 bits; conditional E-value: 1 CBM41.hmm 32 dwggaleftgkDdyGayadvklkega 57 wg+ ft +++ ++ad++l++g+ APE03846.1|CBM41|CBM48|GH13_13 1348 GWGAVDMFTYQGEGVYTADIELSAGS 1373 46666667888888888888888765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 141.29 // Query: AVT48787.1|CBM41|CBM48|GH13_13 [L=1440] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-20 60.5 1.9 1.1e-20 60.5 1.9 2.6 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.5 1.9 1.1e-20 1.1e-20 1 101 [. 90 213 .. 90 214 .. 0.87 2 ? -2.0 0.6 0.34 0.34 12 55 .. 910 954 .. 905 963 .. 0.63 Alignments for each domain: == domain 1 score: 60.5 bits; conditional E-value: 1.1e-20 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve...aeps....dwggaleftgkDd.yGayadvklkega.skigf 62 n+++++Y+r ++++y +++l+tW+d+++ a+ dw++ ++f+g D+ yGay+ ++lkeg+ + +f AVT48787.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRikdknntaSNAEYPKYKLHTWNDEKCdayAA-PfdtsDWSNGHPFDGIDPnYGAYWILNLKEGYgACGNF 167 68999****999999877799**********999986322.23556**888********************99458*** PP CBM41.hmm 63 ivrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 iv+ g ++k+lg ++ +++l + + + ++ +g+++vy++p AVT48787.1|CBM41|CBM48|GH13_13 168 IVHAGtddAGKALGkNNLTMSLVQddaTYVRVNFTIHGESDVYEYP 213 ***987778899999*******99888899999**********987 PP == domain 2 score: -2.0 bits; conditional E-value: 0.34 CBM41.hmm 12 gdydgwglwtWgddveaepsdwggaleftg..kDdyGayadvklke 55 ++yd+ +++ + d+++++++w+ l++++ ++ ++ +++++ AVT48787.1|CBM41|CBM48|GH13_13 910 NSYDSGDWFNYV-DFTYNSNNWNVGLPPAQdnSSKWTQISGISANP 954 677777777777.553555589888888542144466666666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1440 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 154.99 // Query: APD91751.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-21 61.6 1.2 5.2e-21 61.6 1.2 3.2 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.6 1.2 5.2e-21 5.2e-21 1 99 [. 90 210 .. 90 212 .. 0.87 2 ? -3.7 0.0 1 1 69 95 .. 379 403 .. 365 405 .. 0.63 3 ? -1.7 0.1 0.26 0.26 31 70 .. 1133 1174 .. 1117 1193 .. 0.68 4 ? -3.9 0.1 1 1 32 57 .. 1348 1373 .. 1335 1393 .. 0.70 Alignments for each domain: == domain 1 score: 61.6 bits; conditional E-value: 5.2e-21 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d+ y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi APD91751.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRaavdadnsnNDSAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 167 688999***999999998999***************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD + +l + + + ++ sg++++++ APD91751.1|CBM41|CBM48|GH13_13 168 IHKGtddAGKEMGgGDFQASLVQeddTFVRMNFTLSGEPTIFE 210 ***87778888888*****999977788888899999999875 PP == domain 2 score: -3.7 bits; conditional E-value: 1 CBM41.hmm 69 kkdlggDrkidllkdgsaevwlvsgde 95 +k l +++d+ d+++ vw +gd APD91751.1|CBM41|CBM48|GH13_13 379 NKTL--SQRLDMVRDDTSGVWRYEGDM 403 3332..355666667788999999886 PP == domain 3 score: -1.7 bits; conditional E-value: 0.26 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgdkk 70 + +g++++t + + G+++ +k++ e+ s+++f +g++ APD91751.1|CBM41|CBM48|GH13_13 1133 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAANGEEG 1174 333478888888888999999999735779999977777544 PP == domain 4 score: -3.9 bits; conditional E-value: 1 CBM41.hmm 32 dwggaleftgkDdyGayadvklkega 57 wg+ ft +++ ++ad++l++g+ APD91751.1|CBM41|CBM48|GH13_13 1348 GWGAVDMFTYQGEGVYTADIELSAGS 1373 46666667888888888888888765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.44 // Query: VEF25159.1|CBM41|CBM48|GH13_13 [L=1440] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-20 60.5 1.9 1.1e-20 60.5 1.9 2.5 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.5 1.9 1.1e-20 1.1e-20 1 101 [. 90 213 .. 90 214 .. 0.87 2 ? -2.8 0.5 0.6 0.6 12 49 .. 910 948 .. 906 961 .. 0.55 Alignments for each domain: == domain 1 score: 60.5 bits; conditional E-value: 1.1e-20 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve...aeps....dwggaleftgkDd.yGayadvklkega.skigf 62 n+++++Y+r ++++y +++l+tW+d+++ a+ dw++ ++f+g D+ yGay+ ++lkeg+ + +f VEF25159.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRikdknntaSNAEYPKYKLHTWNDEKCdayAA-PfdtsDWSNGHPFDGIDPnYGAYWILNLKEGYgACGNF 167 68999****999999877799**********999986322.23556**888********************99458*** PP CBM41.hmm 63 ivrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 iv+ g ++k+lg ++ +++l + + + ++ +g+++vy++p VEF25159.1|CBM41|CBM48|GH13_13 168 IVHAGtddAGKALGkNNLTMSLVQddaTYVRVNFTIHGESDVYEYP 213 ***987778899999*******99888899999**********987 PP == domain 2 score: -2.8 bits; conditional E-value: 0.6 CBM41.hmm 12 gdydgwglwtWgddveaepsdwggalef..tgkDdyGaya 49 ++yd+ +++ + d+++++++w+ l+ ++ ++ ++ VEF25159.1|CBM41|CBM48|GH13_13 910 NSYDSGDWFNYV-DFTYNTNNWNVGLPLaqDNSSKWTQIS 948 566666666666.443444477666666223333355555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1440 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 150.59 // Query: QBY04398.1|CBM41|CBM48|GH13_13 [L=1440] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-21 62.3 0.2 1.1e-20 60.5 0.2 2.0 1 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.5 0.2 1.1e-20 1.1e-20 1 101 [. 90 214 .. 90 215 .. 0.86 Alignments for each domain: == domain 1 score: 60.5 bits; conditional E-value: 1.1e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkegas.kigf 62 n+++++Y+r d +ydg++l+tW++d++ ++p dw + ++ +g D+ yGay+ ++lkeg+s + +f QBY04398.1|CBM41|CBM48|GH13_13 90 NEAIIYYNRsalgatneaGDPSYDGYRLHTWNSDFCdaYAPPhdtsDWANGHQISGIDPtYGAYWVLNLKEGYSdCGNF 168 67899****99999887777899*************8733334557**778********************99637*** PP CBM41.hmm 63 ivrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 i++ g ++k++g gD +++l + + ++ ++++g ++v+++p QBY04398.1|CBM41|CBM48|GH13_13 169 IIHVGtddAGKAMGsGDFQMPLHQddeTYTRMNFTFDGVPSVFEYP 214 ***977678888999*******9998899999*********99986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1440 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.77 // Query: QTH63660.1|CBM41|CBM48|GH13_13 [L=1409] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-22 65.9 0.7 2.4e-22 65.9 0.7 2.6 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.9 0.7 2.4e-22 2.4e-22 4 94 .. 176 273 .. 173 280 .. 0.88 2 ? -3.3 0.4 0.85 0.85 22 45 .. 976 1001 .. 967 1010 .. 0.68 Alignments for each domain: == domain 1 score: 65.9 bits; conditional E-value: 2.4e-22 CBM41.hmm 4 rvhYkradgdydgwglwtWgddve.a.......epsdwggaleftgkDd.yGayadvklkegaskigfivrkgdkkdlg 73 +v+Y r+dg ydg+ l+ W+++ + a ++++w++ le+tg D+ yGa++ ++ k++a++ +fiv+kgd+kd++ QTH63660.1|CBM41|CBM48|GH13_13 176 VVYYLREDGVYDGYVLHAWNNEECdAyadfasgAGTEWTAGLEPTGIDPnYGAFWHFDTKANATCANFIVHKGDQKDPD 254 79******************99997346666666669*999************************************** PP CBM41.hmm 74 gDrkidllkdgsaevwlvsgd 94 +D+k+ l +++ ++vsg+ QTH63660.1|CBM41|CBM48|GH13_13 255 SDQKVALE--NNRWSFVVSGK 273 ******95..48888888876 PP == domain 2 score: -3.3 bits; conditional E-value: 0.85 CBM41.hmm 22 Wgddve.aeps.dwggaleftgkDdy 45 W + v+ ++++ +w+ ++ ++ + y QTH63660.1|CBM41|CBM48|GH13_13 976 WFNHVDyTNQTnNWNVGYPIERDGRY 1001 44444444555688888888777766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1409 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 162.33 // Query: AMK00388.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-20 58.3 1.2 5.6e-20 58.3 1.2 3.7 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.3 1.2 5.6e-20 5.6e-20 1 98 [. 90 209 .. 90 212 .. 0.82 2 ? -0.2 0.0 0.091 0.091 57 96 .. 368 404 .. 355 408 .. 0.77 3 ? -2.2 0.2 0.38 0.38 31 68 .. 1133 1172 .. 1118 1190 .. 0.67 4 ? -3.2 0.0 0.79 0.79 14 40 .. 1245 1265 .. 1241 1284 .. 0.64 Alignments for each domain: == domain 1 score: 58.3 bits; conditional E-value: 5.6e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d+ y+gw+l+tW++d + ++++dw +g ++ +g D+ yGay+ ++lkeg+ s+ +fi AMK00388.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRaavdadnssNDAAYEGWRLHTWNNDECdayaDADTDWaNGRIH-SGIDPnYGAYWILDLKEGYgSCHNFI 167 68899****999999998899***************97533555**999888.999999***********99678**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvy 98 ++kg ++k++g g+ + +l + + + ++ sg+++++ AMK00388.1|CBM41|CBM48|GH13_13 168 IHKGtddAGKEMGgGNFQGSLVQddeTFVRMNFTLSGEATIF 209 ***877777777778888777775556667777777777776 PP == domain 2 score: -0.2 bits; conditional E-value: 0.091 CBM41.hmm 57 askigfivrkgdkkdlggDrkidllkdgsaevwlvsgdek 96 as++ +++ +++k+ ++id+ d+++ vw ++gd + AMK00388.1|CBM41|CBM48|GH13_13 368 ASNVDLLIYNDNKTL---SQRIDMVRDDTSGVWRHEGDMS 404 566777776665554...578999999999*******986 PP == domain 3 score: -2.2 bits; conditional E-value: 0.38 CBM41.hmm 31 sdw.ggaleftgkDdyGayadvklk.egaskigfivrkgd 68 + +g++++t + + G+++ +k++ e+ s+++f +g+ AMK00388.1|CBM41|CBM48|GH13_13 1133 TYQgDGKYTVTATLEGGVTYGFKFAsEDWSTVNFGAADGE 1172 3233777888888888888888887357788888766664 PP == domain 4 score: -3.2 bits; conditional E-value: 0.79 CBM41.hmm 14 ydgwglwtWgddveaepsdwggaleft 40 y+g +++t+ +dve g +ef+ AMK00388.1|CBM41|CBM48|GH13_13 1245 YQGGRVYTFSRDVE------PGTYEFK 1265 88899999999996......3444442 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.74 // Query: AZN34042.1|CBM41|CBM48|GH13_13 [L=1434] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-21 61.3 0.1 6.2e-21 61.3 0.1 3.3 4 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.3 0.1 6.2e-21 6.2e-21 2 101 .. 90 205 .. 89 206 .. 0.87 2 ? -0.8 0.3 0.14 0.14 22 71 .. 292 339 .. 275 377 .. 0.66 3 ? -3.0 0.2 0.69 0.69 22 58 .. 912 952 .. 901 955 .. 0.57 4 ? -3.3 0.0 0.84 0.84 13 39 .. 1240 1260 .. 1236 1287 .. 0.65 Alignments for each domain: == domain 1 score: 61.3 bits; conditional E-value: 6.2e-21 CBM41.hmm 2 tvrvhYkr.adgdydgwglwtWgddve..aeps....dwggaleftgkDd.yGayadvklkega.skigfivrkg...d 68 ++++ Y+r ad++y+g++l+ W+++v+ ++p dw + +e +g D+ yGay+ ++lkeg+ ++ +fi++ g + AZN34042.1|CBM41|CBM48|GH13_13 90 EAVLFYNRlADDNYEGYRLHSWNNEVCdaYAPPfdtsDWANGHEYDGIDPnYGAYWIINLKEGYnECANFIIHIGtegS 168 57899***6779***************8644445666**777999****************988357******976679 PP CBM41.hmm 69 kkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 +k++g D +++l + + ++ ++ +g+++v+++p AZN34042.1|CBM41|CBM48|GH13_13 169 GKAFGdVDLTMPLMQddeTFQRMNFTIHGEPSVFEYP 205 999999*******9988889999**********9986 PP == domain 2 score: -0.8 bits; conditional E-value: 0.14 CBM41.hmm 22 Wgddveaepsdw.ggaleftgkDdyGayadvklkegaskigfivrkgdkkd 71 W+ + ++++ + +l +g D+ G+ + ++ ++a+ + + ++g++++ AZN34042.1|CBM41|CBM48|GH13_13 292 WD--T-NTAKALiKSQLVIAGYDSEGKLLEASYVQTAKALDALYTQGEDDA 339 32..2.1233555888888999999**999999999999999999984444 PP == domain 3 score: -3.0 bits; conditional E-value: 0.69 CBM41.hmm 22 Wgddve.aeps.dwggalef..tgkDdyGayadvklkegas 58 W + v+ ++++ +w+ l+ ++++++ +++ ++++++a+ AZN34042.1|CBM41|CBM48|GH13_13 912 WFNAVDlTKENnNWNIGLPNaeKNQEKWSEIMPISANPDAQ 952 54455553444477444444334466677777777777765 PP == domain 4 score: -3.3 bits; conditional E-value: 0.84 CBM41.hmm 13 dydgwglwtWgddveaepsdwggalef 39 +y+g g++t+ + + +++ef AZN34042.1|CBM41|CBM48|GH13_13 1240 SYKGKGIYTFTKTLS------AASYEF 1260 799999999985553......333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1434 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 136.83 // Query: QSX30361.1|CBM41|CBM48|GH13_13 [L=1445] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-20 58.4 0.4 5.2e-20 58.4 0.4 2.8 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.4 0.4 5.2e-20 5.2e-20 1 98 [. 89 215 .. 89 218 .. 0.80 2 ? 0.9 0.7 0.042 0.042 12 62 .. 914 969 .. 909 973 .. 0.72 Alignments for each domain: == domain 1 score: 58.4 bits; conditional E-value: 5.2e-20 CBM41.hmm 1 ntvrvhYkr........adgdydgwglwtWgddve...aeps....dwggaleftgkDd.yGayadvklkega.skigf 62 n+++++Y+r a+ +y g++l+tW++d++ a+ dw + +ef+g D+ yGay+ ++lkeg+ ++ +f QSX30361.1|CBM41|CBM48|GH13_13 89 NQAVLYYNRikdkdnssANPNYPGYKLHTWNNDTCdayAA-PfdtsDWANGHEFDGIDPnYGAYWILNLKEGHsDCANF 166 68899****99999887778***************86422.23556**888*******************988357*** PP CBM41.hmm 63 ivrkg...dkkdlg.gDrkidllk.........dgsaevwlvsgdekvy 98 iv+ g ++k+lg gD k++l+ + ++ +g+++vy QSX30361.1|CBM41|CBM48|GH13_13 167 IVHIGtegSGKALGdGDLKMNLKPfedpsaaeaRFDRVNFTIHGESSVY 215 ***976679999999*****99777776665555555566666666666 PP == domain 2 score: 0.9 bits; conditional E-value: 0.042 CBM41.hmm 12 gdydgwglwtWgddveaepsdwggalef..tgkDdyGayadvklkega....skigf 62 ++yd+ +++ + d+++++++w+ l+ ++++++ +a +++++++ s+igf QSX30361.1|CBM41|CBM48|GH13_13 914 NSYDSGDWFNYV-DFTQSGNNWNVGLPLaqDNQGNWNTIAGISANPNTaasaSEIGF 969 678888888888.55356669988888855779999999999999754344467776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1445 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 156.77 // Query: BCO23182.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-21 61.5 0.9 5.4e-21 61.5 0.9 2.5 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.5 0.9 5.4e-21 5.4e-21 1 99 [. 90 210 .. 90 212 .. 0.85 2 ? -4.4 1.0 1 1 13 43 .. 902 930 .. 899 938 .. 0.54 Alignments for each domain: == domain 1 score: 61.5 bits; conditional E-value: 5.4e-21 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve...aeps.dw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r d y+gw+l+tW++d++ a+p dw +g ++ tg D+ yGay+ ++lk+g+ ++ +fi BCO23182.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRasvdadnssGDPAYEGWRLHTWNNDTCdayADPDtDWaNGRVH-TGVDPnYGAYWVLDLKDGYgDCHNFI 167 67899999988888776666789*************97534447**888777.9***99***********99568**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvyt 99 ++kg ++k++g gD k +l++ + ++ ++ sg+++v++ BCO23182.1|CBM41|CBM48|GH13_13 168 IHKGtddAGKEMGgGDFKGSLIQddeTFTRMNFTLSGEPTVFE 210 ***87778888888***99999987788899999999999985 PP == domain 2 score: -4.4 bits; conditional E-value: 1 CBM41.hmm 13 dydgwglwtWgddveaepsdwggaleftgkD 43 yd+ +++ + d+++++++w+ l+ + +D BCO23182.1|CBM41|CBM48|GH13_13 902 TYDSGDWFNYV-DFTYQTNNWNVGLPLA-QD 930 55666666665.4424444777766653.33 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.63 // Query: AMJ76405.1|CBM41|CBM48|GH13_13 [L=1449] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-20 59.4 3.9 3.8e-20 58.8 2.0 2.5 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.8 2.0 3.8e-20 3.8e-20 1 101 [. 96 218 .. 96 219 .. 0.86 2 ? -3.6 0.0 1 1 68 96 .. 384 410 .. 374 412 .. 0.67 Alignments for each domain: == domain 1 score: 58.8 bits; conditional E-value: 3.8e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve..aeps..dwggaleftgkDd.yGayadvklkega.skigfiv 64 n+++++Y+r +d y+gw+l+tW++d + +++s dw + + tg D+ yGay+ ++lk++ ++ +fi+ AMJ76405.1|CBM41|CBM48|GH13_13 96 NQAVLYYNRaavdadnstNDPVYEGWRLHTWNNDECdaYADSdtDWANGRQHTGIDPnYGAYWVLDLKNDFdDCHNFII 174 688999***88888887777889*************98445556**666777****99**********998458***** PP CBM41.hmm 65 rkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvytsp 101 + g ++k+lg +D + +l + + + ++ sg+++++++p AMJ76405.1|CBM41|CBM48|GH13_13 175 HLGtddAGKELGgSDFQASLVQdddTYVRMNFTLSGEPTLFEYP 218 *876678899999***999999888899999******9999886 PP == domain 2 score: -3.6 bits; conditional E-value: 1 CBM41.hmm 68 dkkdlggDrkidllkdgsaevwlvsgdek 96 d+k l + ++++ d + +w ++gd + AMJ76405.1|CBM41|CBM48|GH13_13 384 DNKTLANRYSMTR--DTVTGIWQFEGDMS 410 5555555555555..45899999999865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1449 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 155.31 // Query: APE06100.1|CBM41|CBM48|GH13_13 [L=1443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-21 60.8 3.1 2.3e-20 59.5 1.4 2.7 2 CBM41.hmm Domain annotation for each model (and alignments): >> CBM41.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.5 1.4 2.3e-20 2.3e-20 1 98 [. 90 209 .. 90 212 .. 0.85 2 ? -3.2 0.0 0.78 0.78 13 39 .. 1244 1264 .. 1240 1276 .. 0.70 Alignments for each domain: == domain 1 score: 59.5 bits; conditional E-value: 2.3e-20 CBM41.hmm 1 ntvrvhYkr.........adgdydgwglwtWgddve....aepsdw.ggaleftgkDd.yGayadvklkega.skigfi 63 n+++++Y+r +d y+gw+l+tW++d++ ++++dw +g ++ +g D+ yGay+ ++lk+++ ++ +fi APE06100.1|CBM41|CBM48|GH13_13 90 NQAVLYYNRaavdadnssSDPAYEGWRLHTWNNDTCdayaDADTDWaNGRVH-NGVDPnYGAYWILDLKDNYgDCHNFI 167 68899****99999998888999*************97533555**888777.9***99**********999568**** PP CBM41.hmm 64 vrkg...dkkdlg.gDrkidllk...dgsaevwlvsgdekvy 98 ++kg ++k++g gD + +l + + ++ ++ sg+++++ APE06100.1|CBM41|CBM48|GH13_13 168 IHKGtddAGKEMGgGDFQASLVQddeTFTRMNFTLSGEPTLF 209 ***87778888888***9999997777778888888888876 PP == domain 2 score: -3.2 bits; conditional E-value: 0.78 CBM41.hmm 13 dydgwglwtWgddveaepsdwggalef 39 +y+g +l+t++++ e g +ef APE06100.1|CBM41|CBM48|GH13_13 1244 NYQGGRLYTFARNME------PGTYEF 1264 89999*****97775......444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1443 residues searched) Target model(s): 1 (102 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.03 // [ok]