# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM35/fasta_for_each_cluster/cluster_96.txt # target HMM database: merged_hmms/CBM35.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM35/CBM35_cluster_96.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: WGO96898.1|CBM2|CBM35|PL11_1 [L=915] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-25 76.2 1.5 2.4e-25 76.2 1.5 4.2 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.5 0.0 0.0044 0.0088 44 86 .. 57 99 .. 51 122 .. 0.90 2 ? -1.2 0.0 0.12 0.24 13 29 .. 180 196 .. 162 207 .. 0.74 3 ! 76.2 1.5 1.2e-25 2.4e-25 12 118 .. 657 765 .. 646 766 .. 0.89 4 ? -1.6 0.8 0.17 0.33 56 87 .. 823 854 .. 774 891 .. 0.68 Alignments for each domain: == domain 1 score: 3.5 bits; conditional E-value: 0.0044 CBM35.hmm 44 kaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 k+Gs +s+r+ ++ ++ + +v+ nGt ++ +++++n+ + WGO96898.1|CBM2|CBM35|PL11_1 57 KDGSVLVSWRWLGQEPDNTSFNVYRNGTLLTSAPLTNKTNFVD 99 67888899*****9***********************999865 PP == domain 2 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 13 vntnhagysGsgfvdgl 29 +++++gy+G+ + d + WGO96898.1|CBM2|CBM35|PL11_1 180 KDNSQSGYTGNVYLDAY 196 46778888888877765 PP == domain 3 score: 76.2 bits; conditional E-value: 1.2e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgtaa 91 ++++nh+gy+G gf + +a+g+ + +n ++p+aG+Y+ls+rYang ++++ + ++ t +s + f t++w++w++ WGO96898.1|CBM2|CBM35|PL11_1 657 TIDNNHSGYTGAGFTNTTNATGAGINWNLHAPTAGTYRLSMRYANG-STARGAVLNIETTGNSyPMAFAPTSTWTNWQEEY 736 799******************************************5.6677777777766666678888899********* PP CBM35.hmm 92 gtvtLkaGkntitiks..dwGwinldsle 118 +++ L+aG+n+i++++ G nld++ WGO96898.1|CBM2|CBM35|PL11_1 737 VDARLNAGYNSIRLEAnqAAGLPNLDAIY 765 ****************9999******995 PP == domain 4 score: -1.6 bits; conditional E-value: 0.17 CBM35.hmm 56 ngtgstktlsvvvnGtkvsevtfpstgnwdtw 87 +g+++t + +v+nG +v++ ++t+nw+ WGO96898.1|CBM2|CBM35|PL11_1 823 SGSTDTWGTGFVLNGFQVENEGQQATNNWQVT 854 44444444445555655555555555555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (915 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 175.73 // Query: XOU79051.1|CBM2|CBM35|PL11_1 [L=915] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-25 76.2 1.5 2.4e-25 76.2 1.5 4.2 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.5 0.0 0.0044 0.0088 44 86 .. 57 99 .. 51 122 .. 0.90 2 ? -1.2 0.0 0.12 0.24 13 29 .. 180 196 .. 162 207 .. 0.74 3 ! 76.2 1.5 1.2e-25 2.4e-25 12 118 .. 657 765 .. 646 766 .. 0.89 4 ? -1.6 0.8 0.17 0.33 56 87 .. 823 854 .. 774 891 .. 0.68 Alignments for each domain: == domain 1 score: 3.5 bits; conditional E-value: 0.0044 CBM35.hmm 44 kaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 k+Gs +s+r+ ++ ++ + +v+ nGt ++ +++++n+ + XOU79051.1|CBM2|CBM35|PL11_1 57 KDGSVLVSWRWLGQEPDNTSFNVYRNGTLLTSAPLTNKTNFVD 99 67888899*****9***********************999865 PP == domain 2 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 13 vntnhagysGsgfvdgl 29 +++++gy+G+ + d + XOU79051.1|CBM2|CBM35|PL11_1 180 KDNSQSGYTGNVYLDAY 196 46778888888877765 PP == domain 3 score: 76.2 bits; conditional E-value: 1.2e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgtaa 91 ++++nh+gy+G gf + +a+g+ + +n ++p+aG+Y+ls+rYang ++++ + ++ t +s + f t++w++w++ XOU79051.1|CBM2|CBM35|PL11_1 657 TIDNNHSGYTGAGFTNTTNATGAGINWNLHAPTAGTYRLSMRYANG-STARGAVLNIETTGNSyPMAFAPTSTWTNWQEEY 736 799******************************************5.6677777777766666678888899********* PP CBM35.hmm 92 gtvtLkaGkntitiks..dwGwinldsle 118 +++ L+aG+n+i++++ G nld++ XOU79051.1|CBM2|CBM35|PL11_1 737 VDARLNAGYNSIRLEAnqAAGLPNLDAIY 765 ****************9999******995 PP == domain 4 score: -1.6 bits; conditional E-value: 0.17 CBM35.hmm 56 ngtgstktlsvvvnGtkvsevtfpstgnwdtw 87 +g+++t + +v+nG +v++ ++t+nw+ XOU79051.1|CBM2|CBM35|PL11_1 823 SGSTDTWGTGFVLNGFQVENEGQQATNNWQVT 854 44444444445555655555555555555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (915 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 221.78 // Query: UWZ59698.1|CBM35|PL11_1 [L=740] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-30 91.3 5.0 5.2e-30 91.3 5.0 2.8 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.3 5.0 2.6e-30 5.2e-30 1 119 [] 36 158 .. 36 158 .. 0.97 2 ? -1.1 0.0 0.12 0.23 13 27 .. 298 312 .. 279 345 .. 0.62 3 ? -2.0 0.1 0.21 0.43 14 33 .. 299 318 .. 294 366 .. 0.73 Alignments for each domain: == domain 1 score: 91.3 bits; conditional E-value: 2.6e-30 CBM35.hmm 1 yeAedasltg.vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnw 84 yeAe+a t ++++nh+gysG+gf + +a g+a +f+v++ +aG+ ++ +rYangt++++ +v vnG+ v+ f tg+w UWZ59698.1|CBM35|PL11_1 36 YEAENAPATCdGAIESNHTGYSGTGFCNANNAVGAAAQFTVTASAAGTATIGIRYANGTADNRPADVLVNGAVVQaASAFAGTGAW 121 9*****9998888**************************************************************78889****** PP CBM35.hmm 85 dtwgtaagtvtLkaGkntitiks..dwGwinldslel 119 +tw+t++ t+tL+ G+nti+++ G n+d++++ UWZ59698.1|CBM35|PL11_1 122 TTWTTKTLTATLNVGNNTIRLNPttALGLANIDYVDV 158 **********************99999*******986 PP == domain 2 score: -1.1 bits; conditional E-value: 0.12 CBM35.hmm 13 vntnhagysGsgfvd 27 +++++g +G +vd UWZ59698.1|CBM35|PL11_1 298 KDNSQSGVTGVVYVD 312 234444444444444 PP == domain 3 score: -2.0 bits; conditional E-value: 0.21 CBM35.hmm 14 ntnhagysGsgfvdglqaag 33 +++++g +G +vd + +g UWZ59698.1|CBM35|PL11_1 299 DNSQSGVTGVVYVDAYRLSG 318 67778888888888765544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (740 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 122.19 // Query: UWZ58772.1|CBM35|CE12 [L=483] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-31 94.0 0.4 1.8e-30 92.8 0.4 1.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.8 0.4 9e-31 1.8e-30 1 119 [] 34 156 .. 34 156 .. 0.97 Alignments for each domain: == domain 1 score: 92.8 bits; conditional E-value: 9e-31 CBM35.hmm 1 yeAedasltg.vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 yeAe+a t +++nh+gysG+gf + +a g+av+f+v + +aG+ +l +rYang+++++ +v vnG+ v+ ++ f+ tg+w+ UWZ58772.1|CBM35|CE12 34 YEAESAPATCaGVIESNHTGYSGTGFCNADNAVGAAVQFTVPAATAGTATLGIRYANGGTANRPADVLVNGALVQpSTAFDPTGAWTG 121 9****999986679*************************************************************9************ PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldslel 119 w+t++ tv L+ G+nt++++ G n+d+l++ UWZ58772.1|CBM35|CE12 122 WTTKTLTVALNSGTNTFRLSPttAAGLPNVDYLSV 156 *******************999999*******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (483 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 185.59 // Query: WBB61866.1|CBM35|PL11_1 [L=745] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-28 85.0 3.0 1.7e-27 83.2 0.9 2.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.2 0.9 8.6e-28 1.7e-27 1 118 [. 37 158 .. 37 159 .. 0.96 2 ? -0.1 0.0 0.055 0.11 41 86 .. 280 325 .. 274 349 .. 0.75 Alignments for each domain: == domain 1 score: 83.2 bits; conditional E-value: 8.6e-28 CBM35.hmm 1 yeAedasltg.vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnw 84 yeAe+a t +++nh+gysGsgf + + ++ +f+v++ +aG+ +lslrYangt++++ +v+vnG+ + f stg+w WBB61866.1|CBM35|PL11_1 37 YEAETAPATCdGLIESNHTGYSGSGFCNADNVVSAGAEFTVTASAAGTATLSLRYANGTTADRPADVSVNGDIAHaGSPFGSTGAW 122 99*99988887679**********************************************************9887999******* PP CBM35.hmm 85 dtwgtaagtvtLkaGkntitiks..dwGwinldsle 118 +tw+t++ tv+ +aG+nti+++ G n+d+l+ WBB61866.1|CBM35|PL11_1 123 STWATQTLTVSVDAGSNTIRLTPttAAGLANVDYLD 158 **********************99999*******96 PP == domain 2 score: -0.1 bits; conditional E-value: 0.055 CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 dv+ +G+Ye+ l++ ++++++++s v + +++ + ++ + w+ WBB61866.1|CBM35|PL11_1 280 DVDGDGQYEIFLKWDPDNQKDNSQSGVTSNVYIDAYRLDGQRLWRV 325 5778999***999999877877777777777777777777777765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (745 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 238.97 // Query: WPO36914.1|CBM35|PL11_1 [L=1664] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-45 139.5 4.5 9.2e-27 80.8 0.1 4.3 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.1 0.0 0.049 0.098 12 80 .. 179 200 .. 161 218 .. 0.61 2 ! 80.8 0.1 4.6e-27 9.2e-27 12 118 .. 833 940 .. 827 941 .. 0.96 3 ! 56.3 0.2 1.9e-19 3.7e-19 13 119 .] 1439 1548 .. 1429 1548 .. 0.93 4 ? -2.2 0.0 0.26 0.52 36 57 .. 1634 1655 .. 1624 1660 .. 0.70 Alignments for each domain: == domain 1 score: 0.1 bits; conditional E-value: 0.049 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 s +++++gy+G+ f+d + t++ WPO36914.1|CBM35|PL11_1 179 SKDNSQSGYTGNVFIDAY-----------------------------------------------TLEG 200 345556666666666554...............................................4433 PP == domain 2 score: 80.8 bits; conditional E-value: 4.6e-27 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLk 97 ++++n+agy+G+gf + ++ g+ +++++ v+++++Ye+ +rYan ++s++ +++++G + ++v +p tg w++w+ta tv L+ WPO36914.1|CBM35|PL11_1 833 TIDSNNAGYTGDGFANTDNTLGKGIEWRISVDTSDDYEILFRYAN-GSSDRPGDLIIDGVNMGNVGLPPTGGWTSWSTASLTVALE 917 5899*****************************************.6*************************************** PP CBM35.hmm 98 aGkntitiks..dwGwinldsle 118 G++ i++++ ++G n+d+l WPO36914.1|CBM35|PL11_1 918 SGEHDIRLEAttSSGLANVDYLG 940 *********************96 PP == domain 3 score: 56.3 bits; conditional E-value: 1.9e-19 CBM35.hmm 13 vntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgtaagtvt 95 v + +gy+G+g+ + + g ++ ++v++p +GsYe+++rY ng k+ ++++n++ v +++++++ n +w+t tv WPO36914.1|CBM35|PL11_1 1439 VHSYISGYTGTGYTNTYFRRGVSIYWAVNAPMEGSYEFTIRYHNGLLYRKNARLSINDEVVInNLKMKAKPNRFQWNTISFTVD 1522 777789***************************************9*************9987999999999999********* PP CBM35.hmm 96 LkaGkntitiks..dwGwinldslel 119 L +G n+i+++s +G ++d+le+ WPO36914.1|CBM35|PL11_1 1523 LGEGVNNIKLTSltFKGLPYIDYLEV 1548 *************999********97 PP == domain 4 score: -2.2 bits; conditional E-value: 0.26 CBM35.hmm 36 vtfnvdvpkaGsYelslrYang 57 t+++ ++G+Y l+l+Y g WPO36914.1|CBM35|PL11_1 1634 YTLDIPELSKGTYILQLHYTGG 1655 4555556689*********874 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1664 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 278.90 // Query: UZR99835.1|CBM35|PL11_1 [L=1478] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-42 130.0 9.1 1.3e-25 77.1 0.5 4.6 5 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.4 0.0 0.038 0.077 13 81 .. 189 210 .. 169 233 .. 0.63 2 ? -2.2 0.2 0.25 0.51 22 43 .. 708 729 .. 688 750 .. 0.63 3 ! 77.1 0.5 6.7e-26 1.3e-25 12 118 .. 842 949 .. 835 950 .. 0.96 4 ! 54.1 0.0 9.3e-19 1.9e-18 17 119 .] 1257 1362 .. 1249 1362 .. 0.94 5 ? -2.4 0.0 0.29 0.58 31 57 .. 1443 1469 .. 1418 1475 .. 0.69 Alignments for each domain: == domain 1 score: 0.4 bits; conditional E-value: 0.038 CBM35.hmm 13 vntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst 81 +++++gy+G+ f+d ++ ++ UZR99835.1|CBM35|PL11_1 189 KDNSQSGYTGNVFIDAYT-----------------------------------------------LEGE 210 345555666666655554...............................................4444 PP == domain 2 score: -2.2 bits; conditional E-value: 0.25 CBM35.hmm 22 Gsgfvdglqaagdavtfnvdvp 43 + +v+ l+a+gd+v n + UZR99835.1|CBM35|PL11_1 708 YYYWVTTLDANGDTVISNAAAS 729 2346888888888888776654 PP == domain 3 score: 77.1 bits; conditional E-value: 6.7e-26 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLk 97 +v++n+ag++G+gf + +a g ++++++++++G+Ye+ + Yan +++++ +++++G + ++v++ tg w+twgt+ + v+L+ UZR99835.1|CBM35|PL11_1 842 TVDSNNAGFTGDGFANTDNAVGTGIEWRIKINESGEYEILFGYAN-GANDRPGDLIIDGVNMGNVSLLPTGGWTTWGTSGIMVSLD 926 699******************************************.7*************************************** PP CBM35.hmm 98 aGkntitiks..dwGwinldsle 118 G++ i++++ + G n+d++ UZR99835.1|CBM35|PL11_1 927 TGEHDIRLEAttSGGLANIDYIG 949 ***********999999****95 PP == domain 4 score: 54.1 bits; conditional E-value: 9.3e-19 CBM35.hmm 17 hagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgtaagtvtLkaG 99 +g++G+g+ + + ++++vt+++++p aGsYe+++r+ ng +k ++++n++ + ++ f++ +w w+t t++L +G UZR99835.1|CBM35|PL11_1 1257 IPGFTGNGYTNTYYRKNARVTWAIEIPIAGSYEFTFRFHNGLLYKKPARLYLNDSLAVaNIGFKAEPDWLHWNTWSFTMELAEG 1340 689**************************************99**********997655************************* PP CBM35.hmm 100 kntitiks..dwGwinldslel 119 +n i+++s +G +ld+le+ UZR99835.1|CBM35|PL11_1 1341 TNYIALESssFKGLPYLDYLEI 1362 ********8889*******986 PP == domain 5 score: -2.4 bits; conditional E-value: 0.29 CBM35.hmm 31 aagdavtfnvdvpkaGsYelslrYang 57 a + t++++ ++G Y l+l+Y+ g UZR99835.1|CBM35|PL11_1 1443 AGEIHHTLDITDLSSGIYILQLQYKDG 1469 444445667777788999999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1478 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 308.76 // Query: XHR90302.1|CBM35|PL11_1 [L=747] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-20 59.2 11.8 8.9e-20 58.3 1.7 3.5 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.19 0.37 58 86 .. 61 89 .. 52 134 .. 0.61 2 ! 6.5 0.2 0.00051 0.001 43 102 .. 153 208 .. 137 236 .. 0.86 3 ? -2.8 0.0 0.38 0.76 54 82 .. 564 593 .. 554 611 .. 0.67 4 ! 58.3 1.7 4.5e-20 8.9e-20 4 117 .. 629 744 .. 626 746 .. 0.88 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.19 CBM35.hmm 58 tgstktlsvvvnGtkvsevtfpstgnwdt 86 +++ t +v+ nG+k + + +++ + d XHR90302.1|CBM35|PL11_1 61 DAAGTTFNVYRNGSKLNATPLDALNYTDA 89 55555556666666666555555433333 PP == domain 2 score: 6.5 bits; conditional E-value: 0.00051 CBM35.hmm 43 pkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGknt 102 + +G+Ye+ ++++ +++++++s + +t+ + ++++ t w+ + + +aG++ XHR90302.1|CBM35|PL11_1 153 DGDGTYEIIIKWQPTNAKDNSQSGYTGNTYLDAYKLDGTRMWRI----DLGKNIRAGAHY 208 56899********999999999****99********99999987....666666666665 PP == domain 3 score: -2.8 bits; conditional E-value: 0.38 CBM35.hmm 54 Yang.tgstktlsvvvnGtkvsevtfpstg 82 Y++ +++t+ ++++ n +++s+v ++ g XHR90302.1|CBM35|PL11_1 564 YSTTiPTATRINTLMHNPQYRSQVAAQNAG 593 444448888888888888888888877763 PP == domain 4 score: 58.3 bits; conditional E-value: 4.5e-20 CBM35.hmm 4 edasltg.vsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw 87 e+a + g +++ t+ agy G+gf + a+g++ +f ++ ++G ++++rYang+ + +t + vnG ++ +tf+ tg+w+tw XHR90302.1|CBM35|PL11_1 629 ETAIVGGgTAARTDRAGYRGTGFL-TFPATGGSAEFGrINGGAGGVKTITIRYANGNPTPRTGVLKVNGVSQ-AITFKITGSWTTW 712 677777778999************.6889999999988******************************9985.5************ PP CBM35.hmm 88 gtaagtvtLkaGk.ntitiks.dwGwinldsl 117 +t + tv+L aG+ nt++++s + n+d+l XHR90302.1|CBM35|PL11_1 713 TTMTATVNLAAGSnNTLRFEStGQSLANIDEL 744 ************62689999855556699987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (747 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 185.70 // Query: WYH48427.1|CBM2|CBM35|PL11_1 [L=903] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-21 63.7 10.7 7.5e-21 61.8 0.4 4.4 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 4.2 0.1 0.0026 0.0052 42 96 .. 45 100 .. 42 106 .. 0.85 2 ? 0.1 0.0 0.047 0.095 13 32 .. 169 188 .. 156 204 .. 0.85 3 ! 61.8 0.4 3.7e-21 7.5e-21 12 118 .. 643 751 .. 637 752 .. 0.96 4 ? -0.1 0.8 0.057 0.11 31 86 .. 817 872 .. 789 880 .. 0.50 Alignments for each domain: == domain 1 score: 4.2 bits; conditional E-value: 0.0026 CBM35.hmm 42 vpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaagtvtL 96 v ++Gs +s+r+ ++ ++ +++ nGtk + ++ ++nw + g+a t +L WYH48427.1|CBM2|CBM35|PL11_1 45 VRDDGSVLVSWRWLGQDPDDTAFNLYRNGTKLNVNPITGQTNWVDAnGSANSTYEL 100 667889999******99**************************8864555555555 PP == domain 2 score: 0.1 bits; conditional E-value: 0.047 CBM35.hmm 13 vntnhagysGsgfvdglqaa 32 +++++gy+G+ ++d ++ + WYH48427.1|CBM2|CBM35|PL11_1 169 KDNSQSGYTGNVYIDAYELD 188 57899********9987654 PP == domain 3 score: 61.8 bits; conditional E-value: 3.7e-21 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaag 92 +v++n+ g+sG gf + + g+a++++ +v++a++Y l++rYang+ +++ ++ +n+++++e+ f t++w++w++ + WYH48427.1|CBM2|CBM35|PL11_1 643 TVDANNGGFSGAGFTNTDNVLGSAIEWQFTVTSADNYPLRWRYANGGDTARGGRLLLNNASIEEIAFSPTSSWTSWSSDGT 723 6899***************************************************************************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldsle 118 +v L+aG+ ++++ ++G n+d++ WYH48427.1|CBM2|CBM35|PL11_1 724 SVWLSAGTYRARLEAttSSGLGNIDYFA 751 ********999999999********986 PP == domain 4 score: -0.1 bits; conditional E-value: 0.057 CBM35.hmm 31 aagdavtfnvdv..pkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 ++g+ +t +v++ + +G Y s+ n +s t +v v+ ++v+ +++w++ WYH48427.1|CBM2|CBM35|PL11_1 817 GTGSDITATVNInnDWGGGYCASVLLENTASSPVTWEVGVD--VEGTVSSAWNAEWEQ 872 44444544444411345666666666664333333333333..444555555555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (903 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 259.49 // Query: XOU87232.1|CBM2|CBM35|PL11_1 [L=915] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-25 76.2 1.5 2.4e-25 76.2 1.5 4.2 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.5 0.0 0.0044 0.0088 44 86 .. 57 99 .. 51 122 .. 0.90 2 ? -1.2 0.0 0.12 0.24 13 29 .. 180 196 .. 162 207 .. 0.74 3 ! 76.2 1.5 1.2e-25 2.4e-25 12 118 .. 657 765 .. 646 766 .. 0.89 4 ? -1.6 0.8 0.17 0.33 56 87 .. 823 854 .. 774 891 .. 0.68 Alignments for each domain: == domain 1 score: 3.5 bits; conditional E-value: 0.0044 CBM35.hmm 44 kaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 k+Gs +s+r+ ++ ++ + +v+ nGt ++ +++++n+ + XOU87232.1|CBM2|CBM35|PL11_1 57 KDGSVLVSWRWLGQEPDNTSFNVYRNGTLLTSAPLTNKTNFVD 99 67888899*****9***********************999865 PP == domain 2 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 13 vntnhagysGsgfvdgl 29 +++++gy+G+ + d + XOU87232.1|CBM2|CBM35|PL11_1 180 KDNSQSGYTGNVYLDAY 196 46778888888877765 PP == domain 3 score: 76.2 bits; conditional E-value: 1.2e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgtaa 91 ++++nh+gy+G gf + +a+g+ + +n ++p+aG+Y+ls+rYang ++++ + ++ t +s + f t++w++w++ XOU87232.1|CBM2|CBM35|PL11_1 657 TIDNNHSGYTGAGFTNTTNATGAGINWNLHAPTAGTYRLSMRYANG-STARGAVLNIETTGNSyPMAFAPTSTWTNWQEEY 736 799******************************************5.6677777777766666678888899********* PP CBM35.hmm 92 gtvtLkaGkntitiks..dwGwinldsle 118 +++ L+aG+n+i++++ G nld++ XOU87232.1|CBM2|CBM35|PL11_1 737 VDARLNAGYNSIRLEAnqAAGLPNLDAIY 765 ****************9999******995 PP == domain 4 score: -1.6 bits; conditional E-value: 0.17 CBM35.hmm 56 ngtgstktlsvvvnGtkvsevtfpstgnwdtw 87 +g+++t + +v+nG +v++ ++t+nw+ XOU87232.1|CBM2|CBM35|PL11_1 823 SGSTDTWGTGFVLNGFQVENEGQQATNNWQVT 854 44444444445555655555555555555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (915 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 256.85 // Query: BCD95965.1|CBM35 [L=290] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-60 188.4 12.6 3.9e-32 98.2 3.0 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.2 3.0 1.9e-32 3.9e-32 1 119 [] 34 155 .. 34 155 .. 0.97 2 ! 96.0 2.2 9.1e-32 1.8e-31 1 119 [] 166 287 .. 166 287 .. 0.97 Alignments for each domain: == domain 1 score: 98.2 bits; conditional E-value: 1.9e-32 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgtaag 92 y+Ae+ + +++ ++t++agy+G+g+v+ + ag++v+f+v+vp++G+Y+l +Yangtgs++ ++++nG+ + +++ + tg+w tw+t BCD95965.1|CBM35 34 YQAEEQTWSQAVFETTNAGYTGTGYVNTNNVAGSYVEFTVEVPSDGNYSLASHYANGTGSNRPIDLSINGEFKLpQLSSTPTGSWATWNTESF 126 9**********************************************************************8766****************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 +v+L aG+nti++ ++G+ n+d+l++ BCD95965.1|CBM35 127 SVNLLAGSNTIRMIGagNSGAPNIDALTV 155 ************9888**********997 PP == domain 2 score: 96.0 bits; conditional E-value: 9.1e-32 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgtaag 92 y+Ae+ s ++ v+++h+gy+G+g+v+g +++ +++f+v vp++G+Y+ +r+ang+++++ +++ vnG+ + +f +tg w++w+t a+ BCD95965.1|CBM35 166 YQAENQSFYNAVVENEHTGYTGTGYVNGSNDEHTYIEFTVSVPNDGTYNAAFRFANGGSAARPTDLAVNGEFKIyGPSFSTTGGWTSWATEAT 258 99*********************************************************************98879***************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 t++L+aG+ntit+ G nldsl++ BCD95965.1|CBM35 259 TFNLTAGENTITLIGnsPDGPPNLDSLTI 287 ************9876778******9986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (290 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.25 // Query: XTP28684.1|CBM2|CBM35|PL11_1 [L=895] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-27 83.0 1.2 2e-27 83.0 1.2 2.7 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.0 1.2 9.9e-28 2e-27 12 118 .. 196 304 .. 161 305 .. 0.97 2 ? -1.1 0.1 0.12 0.23 46 82 .. 443 479 .. 428 529 .. 0.65 Alignments for each domain: == domain 1 score: 83.0 bits; conditional E-value: 9.9e-28 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaag 92 s+++n+ag++G gf + + +g +++++ ++ +a +Y l +r+ang+++++ +v vnG++ +v+fpstg w++w++a + XTP28684.1|CBM2|CBM35|PL11_1 196 SIDSNNAGFTGGGFANTHNLSGTRIRWSLNAASASDYLLDWRFANGGSANRPANVRVNGADLASVDFPSTGGWTSWSQASV 276 6899***************************************************************************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldsle 118 v L+aG+nti++ + + G n+d+l+ XTP28684.1|CBM2|CBM35|PL11_1 277 VVALTAGENTIELVAsgSDGLANIDALT 304 ***************9*9*******986 PP == domain 2 score: -1.1 bits; conditional E-value: 0.12 CBM35.hmm 46 GsYelslrYangtgstktlsvvvnGtkvsevtfpstg 82 G+Yel +++ +++ ++++s + + + + + ++ XTP28684.1|CBM2|CBM35|PL11_1 443 GQYELIVKWDPSNSRDNSQSGFTGNVYMDAYRLNGER 479 5555555555544444444444444444444444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (895 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 241.03 // Query: BGA08528.1|CBM35|CBM6|PL11 [L=345] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-29 90.0 1.8 1.3e-29 90.0 1.8 2.9 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 1.8 6.5e-30 1.3e-29 2 118 .. 28 147 .. 27 148 .. 0.94 2 ? -0.4 0.2 0.068 0.14 51 91 .. 184 224 .. 160 242 .. 0.64 3 ! 3.3 0.1 0.005 0.0099 43 87 .. 273 318 .. 264 324 .. 0.83 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.5e-30 CBM35.hmm 2 eAeda.sltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 eAe+a ++ g v++nhag sGsgf + +a g+av+f+v++ +aG +l++ Yang ++++ +v vnGt v++ +f +tg+ BGA08528.1|CBM35|CBM6|PL11 28 EAETApTVCGGLVEANHAGHSGSGFCNSDNAVGAAVEFRVNAAAAGPATLTFGYANGATESRPGEVLVNGTVVGTSQFGATGA 110 6777733445779********************************************************************** PP CBM35.hmm 84 wdtwgtaagtvtLkaGkntitiks..dwGwinldsle 118 w++w+++++t++L+aG+nt+++++ G n+d+l+ BGA08528.1|CBM35|CBM6|PL11 111 WTSWASQTVTAQLNAGTNTVRLRAtgAGGLANVDYLD 147 ************************9999999****95 PP == domain 2 score: -0.4 bits; conditional E-value: 0.068 CBM35.hmm 51 slrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaa 91 s+r ++++ +v+ +Gt+ +++ ++ +n+ + g + BGA08528.1|CBM35|CBM6|PL11 184 SWRLLGTDAQNVAFNVYRDGTRLNSTPITGATNYLDTGNGT 224 45555556666666777777777777777666655544333 PP == domain 3 score: 3.3 bits; conditional E-value: 0.005 CBM35.hmm 43 pkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtw 87 + +G+Ye ++++ +++++++++ v ++t ++ +t+++ +tw BGA08528.1|CBM35|CBM6|PL11 273 DGDGDYEYVVKWSPNNSKDNSQTGVTDNTIADAYTLQEPaCGGSTW 318 568***********99999****999***99999998874445555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (345 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 127.12 // Query: XOU70868.1|CBM2|CBM35|PL11_1 [L=915] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-25 76.2 1.5 2.4e-25 76.2 1.5 4.2 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.5 0.0 0.0044 0.0088 44 86 .. 57 99 .. 51 122 .. 0.90 2 ? -1.2 0.0 0.12 0.24 13 29 .. 180 196 .. 162 207 .. 0.74 3 ! 76.2 1.5 1.2e-25 2.4e-25 12 118 .. 657 765 .. 646 766 .. 0.89 4 ? -1.6 0.8 0.17 0.33 56 87 .. 823 854 .. 774 891 .. 0.68 Alignments for each domain: == domain 1 score: 3.5 bits; conditional E-value: 0.0044 CBM35.hmm 44 kaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 k+Gs +s+r+ ++ ++ + +v+ nGt ++ +++++n+ + XOU70868.1|CBM2|CBM35|PL11_1 57 KDGSVLVSWRWLGQEPDNTSFNVYRNGTLLTSAPLTNKTNFVD 99 67888899*****9***********************999865 PP == domain 2 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 13 vntnhagysGsgfvdgl 29 +++++gy+G+ + d + XOU70868.1|CBM2|CBM35|PL11_1 180 KDNSQSGYTGNVYLDAY 196 46778888888877765 PP == domain 3 score: 76.2 bits; conditional E-value: 1.2e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgtaa 91 ++++nh+gy+G gf + +a+g+ + +n ++p+aG+Y+ls+rYang ++++ + ++ t +s + f t++w++w++ XOU70868.1|CBM2|CBM35|PL11_1 657 TIDNNHSGYTGAGFTNTTNATGAGINWNLHAPTAGTYRLSMRYANG-STARGAVLNIETTGNSyPMAFAPTSTWTNWQEEY 736 799******************************************5.6677777777766666678888899********* PP CBM35.hmm 92 gtvtLkaGkntitiks..dwGwinldsle 118 +++ L+aG+n+i++++ G nld++ XOU70868.1|CBM2|CBM35|PL11_1 737 VDARLNAGYNSIRLEAnqAAGLPNLDAIY 765 ****************9999******995 PP == domain 4 score: -1.6 bits; conditional E-value: 0.17 CBM35.hmm 56 ngtgstktlsvvvnGtkvsevtfpstgnwdtw 87 +g+++t + +v+nG +v++ ++t+nw+ XOU70868.1|CBM2|CBM35|PL11_1 823 SGSTDTWGTGFVLNGFQVENEGQQATNNWQVT 854 44444444445555655555555555555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (915 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 211.94 // Query: UTF60412.1|CBM35|PL11_1 [L=1292] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-20 61.1 0.7 3.8e-20 59.5 0.2 2.2 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.1 0.0 0.47 0.93 24 58 .. 159 194 .. 156 203 .. 0.60 2 ! 59.5 0.2 1.9e-20 3.8e-20 8 117 .. 1162 1274 .. 1154 1276 .. 0.92 Alignments for each domain: == domain 1 score: -3.1 bits; conditional E-value: 0.47 CBM35.hmm 24 gfvdglqaagdavtfn.vdvpkaGsYelslrYangt 58 gfvdg++ + a + d + +G+Yel l++ ++ UTF60412.1|CBM35|PL11_1 159 GFVDGVEYSYIANDASaADLTGDGQYELILKWEPDN 194 566665544333333335667789999999987653 PP == domain 2 score: 59.5 bits; conditional E-value: 1.9e-20 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgta 90 +++ ++++n ag++G+gf + +a+g+ ++++v++++aG+Y++ lrYang g+++ v +n + +++++st+ wd w ++ UTF60412.1|CBM35|PL11_1 1162 ISNGAIESNWAGFEGDGFSNTDNAEGEFISYKVNIQEAGTYRFLLRYANGAGDNRFALVDINSQIGAaTIDMESTSGWDVWMET 1245 6677899*******************************************************8876689*************** PP CBM35.hmm 91 agtvtLkaGkntitiks..dwGwinldsl 117 ++v+L+ G+ i++++ G n+d+l UTF60412.1|CBM35|PL11_1 1246 HVDVELEPGETDIKLRAgsGGGLGNVDYL 1274 *****************9555555***98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1292 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 341.08 // Query: UII27531.1|CBM35|GH128 [L=1103] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-15 42.5 0.4 7.2e-15 42.5 0.4 3.8 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.6 0.8 0.017 0.033 18 97 .. 121 204 .. 111 228 .. 0.61 2 ? 1.6 0.3 0.017 0.034 30 75 .. 193 237 .. 167 255 .. 0.75 3 ? -2.7 0.0 0.35 0.7 47 73 .. 412 438 .. 404 470 .. 0.69 4 ! 42.5 0.4 3.6e-15 7.2e-15 18 119 .] 768 869 .. 754 869 .. 0.95 Alignments for each domain: == domain 1 score: 1.6 bits; conditional E-value: 0.017 CBM35.hmm 18 agysGsgfvdglqaagdavtfn..vdvpkaGsYelslr..Yangtgstktlsvvv.nGtkvsevtfpstgnwdtwgtaagtvtLk 97 a sG+g + + g+ + +n v+ aG Ye+++ + +g +++l+ ++ +++++ +f+ +++ + w+t+++++ L+ UII27531.1|CBM35|GH128 121 ASGSGQGALGTTIGWGGDIVYNqaVTL-PAGLYEMEVVstFIGTNGIAANLTGWLgDDGNSALSDFTYSSSLGAWNTTTISFRLT 204 555666666666555555555543444.458888877633444466677777777344444477888888888888888888886 PP == domain 2 score: 1.6 bits; conditional E-value: 0.017 CBM35.hmm 30 qaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvse 75 ++++ +++f+ +++++G ++ +r n +g+ + +v+ ++ k + UII27531.1|CBM35|GH128 193 AWNTTTISFRLTSQTSGYIQVGVRAGN-SGTGAYAKVFTDDVKLYS 237 367888999999999999999999999.688888888888766543 PP == domain 3 score: -2.7 bits; conditional E-value: 0.35 CBM35.hmm 47 sYelslrYangtgstktlsvvvnGtkv 73 +Y+ + Ya +++s +++++v+n +++ UII27531.1|CBM35|GH128 412 DYAALTVYAGAGQSGSSMDFVINQHYK 438 666667777777777888888886553 PP == domain 4 score: 42.5 bits; conditional E-value: 3.6e-15 CBM35.hmm 18 agysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntit 104 +y+Gsg + +a g+ + ++++ ++G+ +l +rYa+ ++++ ++ vn++ v ++ f +tg ++t+ a ++++ + G+ i+ UII27531.1|CBM35|GH128 768 FNYTGSGAANTTNAVGNGIDYKINFMADGTETLIIRYAS--ATNRPGNILVNDSIVASLPFLATGGFGTYLNASVNIPVQVGTADIR 852 58************************************9..6********************************************* PP CBM35.hmm 105 iks..dwGwinldslel 119 i++ +G n+d++e+ UII27531.1|CBM35|GH128 853 IEAttAEGLGNVDYIEI 869 ***999*********86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1103 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 147.28 // Query: BCD95945.1|CBM35|PL1 [L=564] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-25 75.9 2.2 3.1e-25 75.9 2.2 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.9 2.2 1.6e-25 3.1e-25 12 119 .] 104 214 .. 94 214 .. 0.95 2 ? -1.5 0.5 0.16 0.31 61 108 .. 362 406 .. 348 420 .. 0.71 Alignments for each domain: == domain 1 score: 75.9 bits; conditional E-value: 1.6e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs..evtfpstgnwdtwgtaagtvtLka 98 ++++n+ g+sG+gf + +a+g++++++v+++++G +l++r+an +g+ ++ +++vn ++++ vt+ +tg w++w+t +tv L + BCD95945.1|CBM35|PL1 104 TIDSNNMGFSGDGFANTDNAEGQSISWQVNAQTSGPATLEFRFAN-GGDPRSGDLSVNSGANGtqPVTLANTGGWTDWATESVTVDLVQ 191 5899*****************************************.7***********99999888*********************** PP CBM35.hmm 99 Gkntitiks..dwGwinldslel 119 G n+i++++ d+G n+dsl++ BCD95945.1|CBM35|PL1 192 GLNNIKVTAtsDQGLANIDSLTV 214 ********999**********97 PP == domain 2 score: -1.5 bits; conditional E-value: 0.16 CBM35.hmm 61 tktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitiks.d 108 ++ ++v++G++ +++ ++ ++ w+ ++g++ +G+ ++t++ BCD95945.1|CBM35|PL1 362 QAWDNIVIEGAS-KNIWVDHSEFWNG---QDGNADVVKGADNVTFTWnI 406 555677777766.5677777766666...88888888888888887642 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (564 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 223.93 // Query: BCD95955.1|CBM35|PL11_1 [L=824] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-25 77.2 2.0 1.2e-25 77.2 2.0 3.1 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 0.4 0.11 0.21 50 84 .. 103 137 .. 90 158 .. 0.74 2 ? -1.5 0.0 0.15 0.31 13 30 .. 221 238 .. 204 249 .. 0.68 3 ! 77.2 2.0 6e-26 1.2e-25 11 119 .] 705 813 .. 696 813 .. 0.92 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.11 CBM35.hmm 50 lslr.YangtgstktlsvvvnGtkvsevtfpstgnw 84 +s+r + n + ++ +++ nG+kv+ + +++++n+ BCD95955.1|CBM35|PL11_1 103 VSWRmWGN-EPKSTGYNLYRNGQKVNATPITTSTNY 137 55662444.777888899999999999998888776 PP == domain 2 score: -1.5 bits; conditional E-value: 0.15 CBM35.hmm 13 vntnhagysGsgfvdglq 30 ++++ gy+G+ f+d ++ BCD95955.1|CBM35|PL11_1 221 KDSSQFGYTGKVFIDAYK 238 455666777777777665 PP == domain 3 score: 77.2 bits; conditional E-value: 6e-26 CBM35.hmm 11 vsvntnhagysGs.gfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvt 95 v +++++ gy+G+ g+ + + +g++vt++ dvpka++Y +s+rYa +s++ s++vnGt+ ++ f st++w++w+t +++v BCD95955.1|CBM35|PL11_1 705 V-IENTNGGYTGTaGYANSDNVEGANVTWALDVPKADDYLISIRYAG--ASDRAASLSVNGTAGPSLAFGSTTTWTNWQTETVKVR 787 4.789999****7588888899999*********************8..7************************************ PP CBM35.hmm 96 LkaGkntitiks..dwGwinldslel 119 L+aG+n +t+++ G n+d+l++ BCD95955.1|CBM35|PL11_1 788 LTAGNNLLTLTAnsADGLANIDRLSV 813 **********999999*******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (824 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 241.45 // Query: XQQ78704.1|CBM2|CBM35|PL11_1 [L=892] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-27 82.9 2.4 9e-27 80.9 0.5 2.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 80.9 0.5 4.5e-27 9e-27 12 119 .] 193 301 .. 182 301 .. 0.96 2 ? -0.1 0.1 0.056 0.11 46 82 .. 439 475 .. 424 502 .. 0.64 Alignments for each domain: == domain 1 score: 80.9 bits; conditional E-value: 4.5e-27 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaag 92 ++++n+ag++Gsgf + + g +++++v++++a +Y l +r+an +g ++ sv +nGt+ +v+fp+tg w++w++a XQQ78704.1|CBM2|CBM35|PL11_1 193 TIDSNNAGFTGSGFANTENLIGTRIRWSVNATSASDYLLDWRFAN-GGIARPASVRINGTNLANVDFPTTGGWTSWSQASA 272 6899*****************************************.6********************************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 v+L+aG+n++++ + + G n+dsl++ XQQ78704.1|CBM2|CBM35|PL11_1 273 VVSLEAGENSVELVAdgSDGLANIDSLTV 301 ***************999*********97 PP == domain 2 score: -0.1 bits; conditional E-value: 0.056 CBM35.hmm 46 GsYelslrYangtgstktlsvvvnGtkvsevtfpstg 82 G+Yel +++ +++ ++++s v + +v+ + ++ XQQ78704.1|CBM2|CBM35|PL11_1 439 GQYELIVKWDPSNSRDNSQSGVTGNVYVDAYRLNGER 475 5566655555554555555444444444444444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (892 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 271.78 // Query: WYH52454.1|CBM2|CBM35|PL11_1 [L=903] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-21 63.6 10.8 6.9e-21 61.9 0.4 4.3 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 4.2 0.1 0.0026 0.0052 42 96 .. 45 100 .. 42 106 .. 0.85 2 ? 0.3 0.0 0.044 0.088 13 32 .. 169 188 .. 158 218 .. 0.86 3 ! 61.9 0.4 3.5e-21 6.9e-21 12 118 .. 643 751 .. 637 752 .. 0.96 4 ? -0.3 0.6 0.063 0.13 37 81 .. 825 867 .. 790 879 .. 0.50 Alignments for each domain: == domain 1 score: 4.2 bits; conditional E-value: 0.0026 CBM35.hmm 42 vpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaagtvtL 96 v ++Gs +s+r+ ++ ++ +++ nGtk + ++ ++nw + g+a t +L WYH52454.1|CBM2|CBM35|PL11_1 45 VRDDGSVLVSWRWLGQDPDDTAFNLYRNGTKLNVNPITGQTNWVDAnGSANSTYEL 100 667889999******99**************************8864555555555 PP == domain 2 score: 0.3 bits; conditional E-value: 0.044 CBM35.hmm 13 vntnhagysGsgfvdglqaa 32 +++++gy+G+ ++d ++ + WYH52454.1|CBM2|CBM35|PL11_1 169 KDNSQSGYTGNVYIDAYELD 188 57899*********987655 PP == domain 3 score: 61.9 bits; conditional E-value: 3.5e-21 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaag 92 +v++n+ g+sG gf + + g+a++++ +v++a++Y l++rYang+ +++ ++ +n+++++e+ f t++w++w++ + WYH52454.1|CBM2|CBM35|PL11_1 643 TVDANNGGFSGAGFTNTDNVLGSAIEWQFTVTTADNYPLRWRYANGGDTDRGGRLLLNNASIEEIAFSPTSSWTSWSSEGT 723 6899***************************************************************************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldsle 118 +v L+aG+ ++++ ++G n+d++ WYH52454.1|CBM2|CBM35|PL11_1 724 SVWLSAGTYRARLEAttSSGLGNIDYFA 751 ********999999999********986 PP == domain 4 score: -0.3 bits; conditional E-value: 0.063 CBM35.hmm 37 tfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst 81 t+n++ + +G Y s+ n +s t +v v+ ++v+ + WYH52454.1|CBM2|CBM35|PL11_1 825 TVNINNDWGGGYCASVLIENTASSPVTWEVGVD--VEGTVSSAWN 867 333444445555555555553333333333332..4444444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (903 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 240.72 // Query: WMD06947.1|CBM35|CE12 [L=494] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-30 92.9 0.1 4.4e-30 91.5 0.1 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.5 0.1 2.2e-30 4.4e-30 1 119 [] 38 159 .. 38 159 .. 0.96 Alignments for each domain: == domain 1 score: 91.5 bits; conditional E-value: 2.2e-30 CBM35.hmm 1 yeAedasltg.vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw 87 yeAe+a t + +nh gysG+gf dg ++ g+a +f+v ++++Gs +l +rYang+++++ v+vnG v +++f+ tg w+ w WMD06947.1|CBM35|CE12 38 YEAETAPATCdGLIASNHDGYSGTGFCDGDNEVGAAAQFTVSATEEGSATLAIRYANGSTTARPAAVMVNGVTVLSTSFEPTGGWNRW 125 999999888876699************************************************************************* PP CBM35.hmm 88 gtaagtvtLkaGkntitiks..dwGwinldslel 119 +t++ v L+ G+nti+++ G n+d+l++ WMD06947.1|CBM35|CE12 126 TTKTSAVRLNPGSNTIRLSPtgAGGLPNVDYLDV 159 *******************99888999****987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (494 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 209.74 // Query: XOU74960.1|CBM2|CBM35|PL11_1 [L=915] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-25 76.2 1.5 2.4e-25 76.2 1.5 4.2 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.5 0.0 0.0044 0.0088 44 86 .. 57 99 .. 51 122 .. 0.90 2 ? -1.2 0.0 0.12 0.24 13 29 .. 180 196 .. 162 207 .. 0.74 3 ! 76.2 1.5 1.2e-25 2.4e-25 12 118 .. 657 765 .. 646 766 .. 0.89 4 ? -1.6 0.8 0.17 0.33 56 87 .. 823 854 .. 774 891 .. 0.68 Alignments for each domain: == domain 1 score: 3.5 bits; conditional E-value: 0.0044 CBM35.hmm 44 kaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 k+Gs +s+r+ ++ ++ + +v+ nGt ++ +++++n+ + XOU74960.1|CBM2|CBM35|PL11_1 57 KDGSVLVSWRWLGQEPDNTSFNVYRNGTLLTSAPLTNKTNFVD 99 67888899*****9***********************999865 PP == domain 2 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 13 vntnhagysGsgfvdgl 29 +++++gy+G+ + d + XOU74960.1|CBM2|CBM35|PL11_1 180 KDNSQSGYTGNVYLDAY 196 46778888888877765 PP == domain 3 score: 76.2 bits; conditional E-value: 1.2e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgtaa 91 ++++nh+gy+G gf + +a+g+ + +n ++p+aG+Y+ls+rYang ++++ + ++ t +s + f t++w++w++ XOU74960.1|CBM2|CBM35|PL11_1 657 TIDNNHSGYTGAGFTNTTNATGAGINWNLHAPTAGTYRLSMRYANG-STARGAVLNIETTGNSyPMAFAPTSTWTNWQEEY 736 799******************************************5.6677777777766666678888899********* PP CBM35.hmm 92 gtvtLkaGkntitiks..dwGwinldsle 118 +++ L+aG+n+i++++ G nld++ XOU74960.1|CBM2|CBM35|PL11_1 737 VDARLNAGYNSIRLEAnqAAGLPNLDAIY 765 ****************9999******995 PP == domain 4 score: -1.6 bits; conditional E-value: 0.17 CBM35.hmm 56 ngtgstktlsvvvnGtkvsevtfpstgnwdtw 87 +g+++t + +v+nG +v++ ++t+nw+ XOU74960.1|CBM2|CBM35|PL11_1 823 SGSTDTWGTGFVLNGFQVENEGQQATNNWQVT 854 44444444445555655555555555555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (915 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 226.79 // Query: WGL16559.1|CBM2|CBM35|PL11_1 [L=894] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-28 84.8 2.2 2e-27 83.0 0.5 3.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.0 0.5 9.9e-28 2e-27 12 119 .] 195 304 .. 184 304 .. 0.97 2 ? -1.7 0.0 0.17 0.34 45 81 .. 441 477 .. 433 506 .. 0.62 Alignments for each domain: == domain 1 score: 83.0 bits; conditional E-value: 9.9e-28 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaag 92 sv++n+ag++G+gf + + +g +++++v++ ++ +Y l +r+ang+++++ v vnG++ +v+fp+tg w++w++a WGL16559.1|CBM2|CBM35|PL11_1 195 SVDSNNAGFTGDGFANTDNLNGTRIRWSVNAASSSDYLLDWRFANGGSAARPAGVRVNGADLASVDFPTTGGWTSWSQASA 275 699****************************************************************************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 ++L+aG+nt+++ + d+G n+d+l++ WGL16559.1|CBM2|CBM35|PL11_1 276 VASLQAGENTVELVAssDSGLANIDALTV 304 **************999*********997 PP == domain 2 score: -1.7 bits; conditional E-value: 0.17 CBM35.hmm 45 aGsYelslrYangtgstktlsvvvnGtkvsevtfpst 81 +G+Yel +++ +++ ++++s + + +++ + ++ WGL16559.1|CBM2|CBM35|PL11_1 441 DGQYELIVKWDPSNSRDNSQSGITGNVYIDAYRLNGE 477 5666666666655555555554444444444444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (894 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 286.80 // Query: XOU83143.1|CBM2|CBM35|PL11_1 [L=915] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-25 76.2 1.5 2.4e-25 76.2 1.5 4.2 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.5 0.0 0.0044 0.0088 44 86 .. 57 99 .. 51 122 .. 0.90 2 ? -1.2 0.0 0.12 0.24 13 29 .. 180 196 .. 162 207 .. 0.74 3 ! 76.2 1.5 1.2e-25 2.4e-25 12 118 .. 657 765 .. 646 766 .. 0.89 4 ? -1.6 0.8 0.17 0.33 56 87 .. 823 854 .. 774 891 .. 0.68 Alignments for each domain: == domain 1 score: 3.5 bits; conditional E-value: 0.0044 CBM35.hmm 44 kaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 k+Gs +s+r+ ++ ++ + +v+ nGt ++ +++++n+ + XOU83143.1|CBM2|CBM35|PL11_1 57 KDGSVLVSWRWLGQEPDNTSFNVYRNGTLLTSAPLTNKTNFVD 99 67888899*****9***********************999865 PP == domain 2 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 13 vntnhagysGsgfvdgl 29 +++++gy+G+ + d + XOU83143.1|CBM2|CBM35|PL11_1 180 KDNSQSGYTGNVYLDAY 196 46778888888877765 PP == domain 3 score: 76.2 bits; conditional E-value: 1.2e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgtaa 91 ++++nh+gy+G gf + +a+g+ + +n ++p+aG+Y+ls+rYang ++++ + ++ t +s + f t++w++w++ XOU83143.1|CBM2|CBM35|PL11_1 657 TIDNNHSGYTGAGFTNTTNATGAGINWNLHAPTAGTYRLSMRYANG-STARGAVLNIETTGNSyPMAFAPTSTWTNWQEEY 736 799******************************************5.6677777777766666678888899********* PP CBM35.hmm 92 gtvtLkaGkntitiks..dwGwinldsle 118 +++ L+aG+n+i++++ G nld++ XOU83143.1|CBM2|CBM35|PL11_1 737 VDARLNAGYNSIRLEAnqAAGLPNLDAIY 765 ****************9999******995 PP == domain 4 score: -1.6 bits; conditional E-value: 0.17 CBM35.hmm 56 ngtgstktlsvvvnGtkvsevtfpstgnwdtw 87 +g+++t + +v+nG +v++ ++t+nw+ XOU83143.1|CBM2|CBM35|PL11_1 823 SGSTDTWGTGFVLNGFQVENEGQQATNNWQVT 854 44444444445555655555555555555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (915 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 235.04 // Query: XLD97956.1|CBM35|PL11_1 [L=745] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-28 85.3 6.0 8.4e-28 84.2 3.1 3.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 84.2 3.1 4.2e-28 8.4e-28 1 118 [. 37 158 .. 37 159 .. 0.94 2 ? -0.4 0.0 0.07 0.14 41 86 .. 280 325 .. 274 349 .. 0.75 Alignments for each domain: == domain 1 score: 84.2 bits; conditional E-value: 4.2e-28 CBM35.hmm 1 yeAedasltg.vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnw 84 yeAe+ t +++nh+gysGsgf + +a+++ +f+v++ +aG+ ++ +rYangt++++ +v+vnG+ + tf++tg+w XLD97956.1|CBM35|PL11_1 37 YEAESSPATCdGLIESNHTGYSGSGFCNADNATSAGAQFTVTAAAAGTATVDIRYANGTTADRPADVSVNGAVAHaGSTFDATGAW 122 89998666655559**********************************************************988799******** PP CBM35.hmm 85 dtwgtaagtvtLkaGkntitiks..dwGwinldsle 118 ++w+t++ tvt +aG+nti+++ G n+d+l+ XLD97956.1|CBM35|PL11_1 123 TDWATQTLTVTVNAGSNTIRLTPttAAGLANVDYLD 158 **********************99999*******96 PP == domain 2 score: -0.4 bits; conditional E-value: 0.07 CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 dv+ +G+Ye+ l++ ++++++ +s v + +++ + ++ + w+ XLD97956.1|CBM35|PL11_1 280 DVDGDGQYEIFLKWDPSDQKDNAQSGVTSNVYIDAYRLDGQRLWRV 325 5778999999999998877777777777777777777777766665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (745 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 251.12 // Query: XDO40182.1|CBM35|PL11_1 [L=820] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-31 94.8 2.0 4.4e-31 94.8 2.0 3.6 5 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 0.0 0.87 1.7 51 74 .. 20 43 .. 18 47 .. 0.71 2 ! 94.8 2.0 2.2e-31 4.4e-31 1 119 [] 111 232 .. 111 232 .. 0.98 3 ? -2.4 0.1 0.29 0.59 58 70 .. 318 330 .. 287 341 .. 0.56 4 ! 5.8 0.1 0.00082 0.0016 43 86 .. 369 412 .. 364 433 .. 0.87 5 ? -3.0 0.0 0.46 0.92 15 26 .. 559 570 .. 549 577 .. 0.77 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 0.87 CBM35.hmm 51 slrYangtgstktlsvvvnGtkvs 74 s++ ++g++stk ++ +G+ +s XDO40182.1|CBM35|PL11_1 20 SYSLSAGPASTKYGDLNADGKINS 43 555666788888888888887655 PP == domain 2 score: 94.8 bits; conditional E-value: 2.2e-31 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwd 85 y+Aeda l ++ +t hagy+G+++v++ +++g+++++nv+v ++G+Y+l +rYang+ +++ +++ vn + v +++f t++w+ XDO40182.1|CBM35|PL11_1 111 YQAEDAMLYKAFEETIHAGYDGRSYVNYDNEPGGYIEWNVNVSSSGTYKLIFRYANGSNNNRPMEIRVNSNLVAgSLDFYPTSAWT 196 9********************************************************************999988*********** PP CBM35.hmm 86 twgtaagtvtLkaGkntitiks..dwGwinldslel 119 w+++ + vtL+aG+n i+ + + G n+d+le+ XDO40182.1|CBM35|PL11_1 197 VWNDQSIVVTLNAGNNVIRATGiaSDGGPNVDYLEV 232 *********************999**********97 PP == domain 3 score: -2.4 bits; conditional E-value: 0.29 CBM35.hmm 58 tgstktlsvvvnG 70 t+st t++ v+nG XDO40182.1|CBM35|PL11_1 318 TSSTYTVRAVING 330 2333333444444 PP == domain 4 score: 5.8 bits; conditional E-value: 0.00082 CBM35.hmm 43 pkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 + +G+Ye+ l++ ++++++++s + ++ + + ++++ t w+ XDO40182.1|CBM35|PL11_1 369 DGDGEYEIVLKWEPNNAKDNSQSGYTDNVYLDAYKLNGTRLWRI 412 568************************************99975 PP == domain 5 score: -3.0 bits; conditional E-value: 0.46 CBM35.hmm 15 tnhagysGsgfv 26 +n++gy+G+g+ XDO40182.1|CBM35|PL11_1 559 NNYSGYNGQGNH 570 788899998864 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (820 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 225.86 // Query: XPR76102.1|CBM35|PL11_1 [L=741] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-29 88.5 0.9 3.8e-29 88.5 0.9 3.1 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.5 0.9 1.9e-29 3.8e-29 2 119 .] 43 163 .. 42 163 .. 0.94 2 ? -2.8 0.1 0.38 0.76 58 88 .. 206 236 .. 186 249 .. 0.61 3 ! 2.9 0.2 0.0068 0.014 43 85 .. 288 330 .. 279 353 .. 0.88 Alignments for each domain: == domain 1 score: 88.5 bits; conditional E-value: 1.9e-29 CBM35.hmm 2 eAeda.sltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 eAe+a ++ g v++nhag sGsgf + +a g+av+f+vd+ +aG +l++ Yang+++++ +v vnG+ v++ +f +tg+w++ XPR76102.1|CBM35|PL11_1 43 EAETApTVCGGLVEANHAGHSGSGFCNSDNAVGAAVEFRVDAAAAGPATLTFGYANGGTDSRPGEVLVNGAVVGTSQFGATGAWTS 128 6777733445779************************************************************************* PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldslel 119 w+++++t++L+aG nt+++++ G n+d+l++ XPR76102.1|CBM35|PL11_1 129 WASQTVTAQLNAGVNTVRLRAtgAGGLANIDYLDV 163 **********************999999****987 PP == domain 2 score: -2.8 bits; conditional E-value: 0.38 CBM35.hmm 58 tgstktlsvvvnGtkvsevtfpstgnwdtwg 88 ++++ +v+ +Gtk +++ ++ +n+ + g XPR76102.1|CBM35|PL11_1 206 DAQNVGFNVYRDGTKLNSTPITGATNYLDTG 236 4555555666677777776666666554433 PP == domain 3 score: 2.9 bits; conditional E-value: 0.0068 CBM35.hmm 43 pkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwd 85 + +G+Ye +++ +++++++s v ++t v+ +t++ t w+ XPR76102.1|CBM35|PL11_1 288 DGDGDYEYVVKWYPTNAKDNSQSGVTDNTIVDAYTLQGTRLWR 330 5689*******999899**********************9997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (741 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 235.81 // Query: WYH46502.1|CBM2|CBM35|PL11_1 [L=904] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-21 63.6 0.3 2e-21 63.6 0.3 4.6 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 2.5 0.1 0.0089 0.018 42 96 .. 45 100 .. 42 105 .. 0.85 2 ? 0.2 0.0 0.044 0.088 13 31 .. 169 187 .. 154 206 .. 0.83 3 ! 63.6 0.3 1e-21 2e-21 12 118 .. 643 751 .. 637 752 .. 0.96 4 ? -0.6 0.8 0.078 0.16 30 63 .. 817 852 .. 789 879 .. 0.49 Alignments for each domain: == domain 1 score: 2.5 bits; conditional E-value: 0.0089 CBM35.hmm 42 vpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaagtvtL 96 v ++Gs +s+r+ ++ ++ +++ nG k + ++ ++nw + g+a t +L WYH46502.1|CBM2|CBM35|PL11_1 45 VRDDGSVLVSWRWLGQDPDDTAFNLYRNGVKLNVNPITGQTNWVDTnGSASSTYEL 100 667889999******999*************************7764666666666 PP == domain 2 score: 0.2 bits; conditional E-value: 0.044 CBM35.hmm 13 vntnhagysGsgfvdglqa 31 +++++gy+G+ ++d ++ WYH46502.1|CBM2|CBM35|PL11_1 169 KDNSQSGYTGNVYIDAYEL 187 5788999999999987754 PP == domain 3 score: 63.6 bits; conditional E-value: 1e-21 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaag 92 +v++n+ g+sG gf + + g+a++++ +v++a++Y l++rYang+++++ ++ +n+t+++e+ f t++w++w++ + WYH46502.1|CBM2|CBM35|PL11_1 643 TVDANNGGFSGAGFTNTDNVLGSAIEWQFTVTSADNYPLRWRYANGSADARGARLLLNNTSIEEIAFSPTSSWTSWSSDGT 723 6899***************************************************************************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldsle 118 +v L+aG+ ++++ ++G n+d++ WYH46502.1|CBM2|CBM35|PL11_1 724 SVWLSAGTYRARLEAttSSGLGNIDYFA 751 ********999999999********986 PP == domain 4 score: -0.6 bits; conditional E-value: 0.078 CBM35.hmm 30 qaagdavtfnvdvpk..aGsYelslrYangtgstkt 63 ++g+ vt +v++++ +G Y s+ n ++ t WYH46502.1|CBM2|CBM35|PL11_1 817 GGTGSDVTATVNINNdwGGGYCASVLLENTASGPVT 852 444555555544433114555555555553222222 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (904 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 137.76 // Query: UZJ44958.1|CBM35|PL11_1 [L=1297] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-22 67.1 4.0 2e-22 66.9 1.6 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.0 0.15 0.3 23 60 .. 157 195 .. 154 210 .. 0.75 2 ! 66.9 1.6 9.9e-23 2e-22 11 117 .. 1170 1279 .. 1159 1281 .. 0.90 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.15 CBM35.hmm 23 sgfvdglqaagdavtfn.vdvpkaGsYelslrYangtgs 60 +gfvdg + + +a + d + +G+Yel +++ ++++ UZJ44958.1|CBM35|PL11_1 157 NGFVDGAEYSYSANDASaADLTGDGQYELIVKWEPDNAK 195 788888887777666655888899999999999865444 PP == domain 2 score: 66.9 bits; conditional E-value: 9.9e-23 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgtaagt 93 +++n agy+G+gf + +a+g+++t++v++ +aG+Y+l +rYang g+++ +v +n + +++++ tg+wdtw ++ ++ UZJ44958.1|CBM35|PL11_1 1170 GLIESNWAGYEGDGFSNTDNAEGEYITYKVNIRDAGTYRLLVRYANGAGDNRFARVDINSQIGVaQIDMEGTGAWDTWMESSVD 1253 5588999****************************************************875446******************* PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldsl 117 v+L+ G+ it+ + G n+d+l UZJ44958.1|CBM35|PL11_1 1254 VELESGETDITLYAgsGGGLGNVDYL 1279 *************99555555***98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1297 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 314.77 // [ok]