# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM35/fasta_for_each_cluster/cluster_92.txt # target HMM database: merged_hmms/CBM35.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM35/CBM35_cluster_92.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: QDL68263.1|CBM35|CE3 [L=377] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-16 47.7 0.1 3.2e-16 46.8 0.1 1.5 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.8 0.1 1.6e-16 3.2e-16 17 118 .. 266 366 .. 248 367 .. 0.92 Alignments for each domain: == domain 1 score: 46.8 bits; conditional E-value: 1.6e-16 CBM35.hmm 17 hagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntiti 105 ++ sG + +++a++++++ +++p +G Y++ +r ng+gst t ++v+++ + +v ps w++w+ + ++v+L++G+nt+++ QDL68263.1|CBM35|CE3 266 SPTASGGVKAGHIDNADSYLQYVITAPYTGAYRMYVRAGNGMGSTCTHLLTVDDAPAVTVAYPSY-GWEEWSMTGVDVHLRQGANTLRF 353 567788889999****************************************************9.7********************** PP CBM35.hmm 106 ksdwGwinldsle 118 + + + ++d+++ QDL68263.1|CBM35|CE3 354 AKGTCYAEIDAID 366 **999*****985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (377 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 119.58 // Query: WHX15899.1|CBM35|CE3 [L=377] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-16 47.7 0.1 3.2e-16 46.8 0.1 1.5 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.8 0.1 1.6e-16 3.2e-16 17 118 .. 266 366 .. 248 367 .. 0.92 Alignments for each domain: == domain 1 score: 46.8 bits; conditional E-value: 1.6e-16 CBM35.hmm 17 hagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntiti 105 ++ sG + +++a++++++ +++p +G Y++ +r ng+gst t ++v+++ + +v ps w++w+ + ++v+L++G+nt+++ WHX15899.1|CBM35|CE3 266 SPTASGGVKAGHIDNADSYLQYVITAPYTGAYRMYVRAGNGMGSTCTHLLTVDDAPAVTVAYPSY-GWEEWSMTGVDVHLRQGANTLRF 353 567788889999****************************************************9.7********************** PP CBM35.hmm 106 ksdwGwinldsle 118 + + + ++d+++ WHX15899.1|CBM35|CE3 354 AKGTCYAEIDAID 366 **999*****985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (377 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.99 // Query: UHH22878.1|CBM35|CE3 [L=377] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-16 47.7 0.1 3.2e-16 46.8 0.1 1.5 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.8 0.1 1.6e-16 3.2e-16 17 118 .. 266 366 .. 248 367 .. 0.92 Alignments for each domain: == domain 1 score: 46.8 bits; conditional E-value: 1.6e-16 CBM35.hmm 17 hagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntiti 105 ++ sG + +++a++++++ +++p +G Y++ +r ng+gst t ++v+++ + +v ps w++w+ + ++v+L++G+nt+++ UHH22878.1|CBM35|CE3 266 SPTASGGVKAGHIDNADSYLQYVITAPYTGAYRMYVRAGNGMGSTCTHLLTVDDAPAVTVAYPSY-GWEEWSMTGVDVHLRQGANTLRF 353 567788889999****************************************************9.7********************** PP CBM35.hmm 106 ksdwGwinldsle 118 + + + ++d+++ UHH22878.1|CBM35|CE3 354 AKGTCYAEIDAID 366 **999*****985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (377 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 155.51 // Query: WPB88041.1|CBM35|CE3 [L=377] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-16 47.8 0.1 3.2e-16 46.8 0.1 1.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.8 0.1 1.6e-16 3.2e-16 17 118 .. 266 366 .. 248 367 .. 0.92 Alignments for each domain: == domain 1 score: 46.8 bits; conditional E-value: 1.6e-16 CBM35.hmm 17 hagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntiti 105 ++ sG + +++a++++++ +++p +G Y++ +r ng+gst t ++v+++ + +v ps w++w+ + ++v+L++G+nt+++ WPB88041.1|CBM35|CE3 266 SPTASGGVKAGHIDNADSYLQYVITAPYTGAYRMYVRAGNGMGSTCTHLLTVDDAPAVTVAYPSY-GWEEWSMTGVDVHLRQGANTLRF 353 567788889999****************************************************9.7********************** PP CBM35.hmm 106 ksdwGwinldsle 118 + + + ++d+++ WPB88041.1|CBM35|CE3 354 AKGTCYAEIDAID 366 **999*****985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (377 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 152.59 // Query: ATL88456.1|CBM35|CE3 [L=377] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-16 47.7 0.1 3.2e-16 46.8 0.1 1.5 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.8 0.1 1.6e-16 3.2e-16 17 118 .. 266 366 .. 248 367 .. 0.92 Alignments for each domain: == domain 1 score: 46.8 bits; conditional E-value: 1.6e-16 CBM35.hmm 17 hagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntiti 105 ++ sG + +++a++++++ +++p +G Y++ +r ng+gst t ++v+++ + +v ps w++w+ + ++v+L++G+nt+++ ATL88456.1|CBM35|CE3 266 SPTASGGVKAGHIDNADSYLQYVITAPYTGAYRMYVRAGNGMGSTCTHLLTVDDAPAVTVAYPSY-GWEEWSMTGVDVHLRQGANTLRF 353 567788889999****************************************************9.7********************** PP CBM35.hmm 106 ksdwGwinldsle 118 + + + ++d+++ ATL88456.1|CBM35|CE3 354 AKGTCYAEIDAID 366 **999*****985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (377 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 171.26 // Query: AUA08350.1|CBM35|CE3 [L=391] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-16 47.6 0.1 3.5e-16 46.7 0.1 1.5 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.7 0.1 1.7e-16 3.5e-16 17 118 .. 280 380 .. 262 381 .. 0.92 Alignments for each domain: == domain 1 score: 46.7 bits; conditional E-value: 1.7e-16 CBM35.hmm 17 hagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntiti 105 ++ sG + +++a++++++ +++p +G Y++ +r ng+gst t ++v+++ + +v ps w++w+ + ++v+L++G+nt+++ AUA08350.1|CBM35|CE3 280 SPTASGGVKAGHIDNADSYLQYVITAPYTGAYRMYVRAGNGMGSTCTHLLTVDDAPAVTVAYPSY-GWEEWSMTGVDVHLRQGANTLRF 367 567788889999****************************************************9.7********************** PP CBM35.hmm 106 ksdwGwinldsle 118 + + + ++d+++ AUA08350.1|CBM35|CE3 368 AKGTCYAEIDAID 380 **999*****985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (391 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 169.45 // Query: XTM34104.1|CBM35|CE3 [L=364] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-17 48.6 0.0 1.6e-16 47.8 0.0 1.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.8 0.0 7.9e-17 1.6e-16 4 119 .] 245 358 .. 239 358 .. 0.90 Alignments for each domain: == domain 1 score: 47.8 bits; conditional E-value: 7.9e-17 CBM35.hmm 4 edasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaag 92 ++a++t++ + + a sG +++++ ++++vtf+ +v +aG+Y+++ r ang+g+ + v+ nG+ +v+ ps +wd +g++a+ XTM34104.1|CBM35|CE3 245 ANATITNA-RKVSIASASGGAKIGYIDYPDSSVTFRFQVGSAGTYRIRARGANGMGAVCSHHVSANGGPPATVSYPSY-SWDLLGESAV 331 34455553.455678899***********************************************************9.8********* PP CBM35.hmm 93 tvtLkaGkntitiksdwGwinldslel 119 +++L+a nt+++++ +++ld++++ XTM34104.1|CBM35|CE3 332 DLPLNARWNTVKFTKGDCYTELDAIDV 358 ************************987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (364 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 161.33 // Query: XOI90268.1|CBM35 [L=1680] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-76 239.4 31.6 6.9e-28 84.5 2.1 5.8 6 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 6.0 0.2 0.00072 0.0014 58 119 .] 393 462 .. 384 462 .. 0.81 2 ? -3.3 0.0 0.56 1.1 58 86 .. 713 741 .. 706 749 .. 0.76 3 ! 83.9 1.4 5.3e-28 1.1e-27 1 118 [. 896 1013 .. 896 1014 .. 0.93 4 ! 83.9 1.4 5.3e-28 1.1e-27 1 118 [. 1118 1235 .. 1118 1236 .. 0.93 5 ! 84.5 2.1 3.4e-28 6.9e-28 1 118 [. 1429 1546 .. 1429 1547 .. 0.93 6 ? -3.0 0.3 0.46 0.92 85 85 .. 1608 1608 .. 1566 1639 .. 0.45 Alignments for each domain: == domain 1 score: 6.0 bits; conditional E-value: 0.00072 CBM35.hmm 58 tgstktlsvvvnGtkvs.evtfpstgnwdtwgtaagtvtLk.aGkntitiks.......dwGwinldslel 119 +g++ +++++vnG+ ++ + ++ gn+ t + +L+ +G+nt+ ++s +G++n d+++l XOI90268.1|CBM35 393 DGANDENKLYVNGQLSDdSSNIAYAGNFVGT-TPVNIGYLTyQGNNTFHLDSaideltiYSGAVNTDQVKL 462 578899********99988889999999873.44444455449*********9999999999999999875 PP == domain 2 score: -3.3 bits; conditional E-value: 0.56 CBM35.hmm 58 tgstktlsvvvnGtkvsevtfpstgnwdt 86 +gs+ +++++v+G ++++ + ++++++ XOI90268.1|CBM35 713 DGSSGETRLYVDGVLQNTTPHTYSSDFTD 741 567788999****9999888888887776 PP == domain 3 score: 83.9 bits; conditional E-value: 5.3e-28 CBM35.hmm 1 yeAedasltg.vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgt 89 yeAeda+++ ++ + h+gy+G+g+vd+ +++v+++v+ ++G+Y+l +rYa +++++ l ++v+ t+ + +++fp+tg w+twg+ XOI90268.1|CBM35 896 YEAEDAEMSPaFAISSAHSGYTGTGYVDYT--GEGYVKWTVELAAEGNYDLVFRYAL-GSGNRPLHISVDSTSGGsTIDFPATGGWSTWGE 983 9********9899**************987..899**********************.7*************99889************** PP CBM35.hmm 90 aagtvtLkaGkntitiksdwGwi..nldsle 118 + +tv+L+aG++ti + +G n+d+l+ XOI90268.1|CBM35 984 TRTTVSLTAGTHTIYAST-TGLSgaNVDHLS 1013 **************9997.554445888886 PP == domain 4 score: 83.9 bits; conditional E-value: 5.3e-28 CBM35.hmm 1 yeAedasltg.vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgt 89 yeAeda+++ ++ + h+gy+G+g+vd+ +++v+++v+ ++G+Y+l +rYa +++++ l ++v+ t+ + +++fp+tg w+twg+ XOI90268.1|CBM35 1118 YEAEDAEMSPaFAISSAHSGYTGTGYVDYT--GEGYVKWTVELAAEGNYDLVFRYAL-GSGNRPLHISVDSTSGGsTIDFPATGGWSTWGE 1205 9********9899**************987..899**********************.7*************99889************** PP CBM35.hmm 90 aagtvtLkaGkntitiksdwGwi..nldsle 118 + +tv+L+aG++ti + +G n+d+l+ XOI90268.1|CBM35 1206 TRTTVSLTAGTHTIYAST-TGLSgaNVDHLS 1235 **************9997.554445888886 PP == domain 5 score: 84.5 bits; conditional E-value: 3.4e-28 CBM35.hmm 1 yeAedasltg.vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgt 89 yeAeda+++ ++ + h+gy+G+g+vd+ +++v+++v+ ++G+Y+l +rYa +++++ l ++v+ t+ + +++fp+tg w+twg+ XOI90268.1|CBM35 1429 YEAEDAEMSSaFAISSAHSGYTGTGYVDYA--GEGYVKWTVELATEGNYDLVFRYAL-GSGNRPLHISVDSTSGGsTIDFPATGGWSTWGE 1516 9*******99899**************976..999**********************.7*************99889************** PP CBM35.hmm 90 aagtvtLkaGkntitiksdwGwi..nldsle 118 + +tv+L+aG++ti + +G n+d+l+ XOI90268.1|CBM35 1517 TRTTVSLTAGTHTIYAST-TGLSgaNVDHLS 1546 **************9997.554445888886 PP == domain 6 score: -3.0 bits; conditional E-value: 0.46 CBM35.hmm 85 d 85 + XOI90268.1|CBM35 1608 N 1608 2 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1680 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 283.83 // [ok]