# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM35/fasta_for_each_cluster/cluster_9.txt # target HMM database: merged_hmms/CBM35.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM35/CBM35_cluster_9.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: AFV00496.2|CBM35|GH5_7 [L=923] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-23 69.9 2.2 3.8e-14 40.2 0.1 2.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.3 0.4 8.8e-11 1.8e-10 25 115 .. 109 197 .. 94 201 .. 0.82 2 ! 40.2 0.1 1.9e-14 3.8e-14 29 118 .. 319 405 .. 300 406 .. 0.84 Alignments for each domain: == domain 1 score: 28.3 bits; conditional E-value: 8.8e-11 CBM35.hmm 25 fvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitiks...d 108 f + +q ++++ ++n ++p++G+Y++sl ++ ++++k ++++v + +f+st++ d+w ++ g+vtL+aG++ ++ + AFV00496.2|CBM35|GH5_7 109 FNGFIQLKNGKASWNFEAPADGNYTVSLLVRS-PQGEKRNKFFVGSQV---FEFTSTDKDDEW-VTIGNVTLTAGAKIAGVDGgngS 190 44556789999*********************.9**********9555...667777777775.4589*********9999999999 PP CBM35.hmm 109 wGwinld 115 wG+i++ AFV00496.2|CBM35|GH5_7 191 WGYIDVV 197 9999875 PP == domain 2 score: 40.2 bits; conditional E-value: 1.9e-14 CBM35.hmm 29 lqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtLkaGkntitiks...dwGw 111 + ++ ++vt++vdvp a +Y++ + Ya+ ++ + ++++++G+ s+vtf+s+ + + +v+ + G++ti++++ d Gw AFV00496.2|CBM35|GH5_7 319 IMSPVSSVTWTVDVPVAAEYRVMVDYAA-AHGPRRNTLSIDGSG-SQVTFTSKdRA-----FFTRNVSFDMGSHTIAVEAlqgDDGW 398 4567799*********************.7***********998.56888888233.....4569********************** PP CBM35.hmm 112 inldsle 118 +n+ l+ AFV00496.2|CBM35|GH5_7 399 MNIYGLQ 405 **97665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (923 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 184.51 // Query: QEY17029.1|CBM10|CBM35|CBM5|GH5|GH5_7 [L=1785] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-17 49.5 0.4 1.7e-16 47.7 0.4 2.1 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.7 0.4 8.6e-17 1.7e-16 1 119 [] 1163 1270 .. 1163 1270 .. 0.85 Alignments for each domain: == domain 1 score: 47.7 bits; conditional E-value: 8.6e-17 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnG 70 y A +asl+g++v + G+ +l+aag+ ++ ++p aG+Y+l+l++++ ++++k+++++v+G QEY17029.1|CBM10|CBM35|CBM5|GH5|GH5_7 1163 YAANSASLQGAAVLS------GDA--VELKAAGSGAIWTFNAPMAGEYRLTLTWST-PSGSKVNTLMVDG 1223 667777777775443......443..4899**************************.9************ PP CBM35.hmm 71 tkvsevtfpstgnwdtwgtaagtvtLkaGkntitiks...dwGwinldslel 119 + v ++f+s t +t++ t+ L++G+++ i+ dwG++ ++sl++ QEY17029.1|CBM10|CBM35|CBM5|GH5|GH5_7 1224 AGVA-TNFNSA----TPATSVRTLMLSQGSHSAGIQVnagDWGYMTVHSLKV 1270 **98.455555....356889***********9999999***********97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1785 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 366.17 // Query: QEI17275.1|CBM10|CBM35|CBM5|GH5_7 [L=846] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-25 76.2 2.1 4.1e-25 75.5 0.7 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.5 0.7 2.1e-25 4.1e-25 1 119 [] 223 331 .. 223 331 .. 0.87 2 ? -2.6 0.0 0.33 0.65 40 72 .. 386 417 .. 361 425 .. 0.73 Alignments for each domain: == domain 1 score: 75.5 bits; conditional E-value: 2.1e-25 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsev 76 y+A++as+t+ + g+v++lq+ag+av +nvdvp +G+Y+++l++++ ++s+k++++v++Gt+ s + QEI17275.1|CBM10|CBM35|CBM5|GH5_7 223 YTAASASITAP--------AQLVGNVGELQGAGSAVIWNVDVPVTGEYRINLTWSS-PYSSKVNTLVMDGTALSYA 289 55666666663........24479********************************.9***************955 PP CBM35.hmm 77 tfpstgnwdtwgtaagtvtLkaGkntitiks...dwGwinldslel 119 + ++t t+++t tL+aG++++ ++ dwG++n++sl+l QEI17275.1|CBM10|CBM35|CBM5|GH5_7 290 FAEAT----VPVTYVQTKTLSAGNHSFGVRVgssDWGYMNVHSLKL 331 55555....33479***************9999**********987 PP == domain 2 score: -2.6 bits; conditional E-value: 0.33 CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtk 72 + + +G Y+l++ t +++l+v+v ++ QEI17275.1|CBM10|CBM35|CBM5|GH5_7 386 IPTQGDGVYRLKFGLEG-TVLSSNLRVTVGSAN 417 44556788888888776.777777777776555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (846 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 161.61 // Query: ACE82655.1|CBM10|CBM35|CBM5|GH5_7|3.2.1.78 [L=830] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-25 76.3 2.0 4e-25 75.5 0.7 2.1 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.5 0.7 2e-25 4e-25 1 119 [] 207 315 .. 207 315 .. 0.87 2 ? -3.2 0.0 0.53 1.1 54 74 .. 342 360 .. 335 385 .. 0.58 3 ? -2.9 0.0 0.41 0.83 42 73 .. 372 402 .. 359 409 .. 0.76 Alignments for each domain: == domain 1 score: 75.5 bits; conditional E-value: 2e-25 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvv 67 y+A++as+t+ + g+v++lq+ag+av +nvdvp +G+Y+++l++++ ++s+k++++v ACE82655.1|CBM10|CBM35|CBM5|GH5_7|3.2.1.78 207 YTAASASITAP--------AQLVGNVGELQGAGSAVIWNVDVPVTGEYRINLTWSS-PYSSKVNTLV 264 55666666663........24479********************************.9********* PP CBM35.hmm 68 vnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitiks...dwGwinldslel 119 ++Gt+ s ++ ++t t+++t tL+aG++++ ++ dwG++n++sl+l ACE82655.1|CBM10|CBM35|CBM5|GH5_7|3.2.1.78 265 MDGTALSYAFAEAT----VPVTYVQTKTLSAGNHSFGVRVgssDWGYMNVHSLKL 315 ******95555555....33479***************9999**********987 PP == domain 2 score: -3.2 bits; conditional E-value: 0.53 CBM35.hmm 54 YangtgstktlsvvvnGtkvs 74 Y + +++ l+ +vn+++ + ACE82655.1|CBM10|CBM35|CBM5|GH5_7|3.2.1.78 342 YEK--QGSGRLTYSVNDGATQ 360 444..3444555555555443 PP == domain 3 score: -2.9 bits; conditional E-value: 0.41 CBM35.hmm 42 vpkaGsYelslrYangtgstktlsvvvnGtkv 73 + +G Y+l++ t +++l+v+v ++v ACE82655.1|CBM10|CBM35|CBM5|GH5_7|3.2.1.78 372 TQGDGVYRLKFGLEG-TVLSSNLRVTVGSANV 402 556789999999887.7888888888876655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (830 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 164.59 // Query: QEI20852.1|CBM10|CBM35|CBM5|GH5_7 [L=846] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-25 76.2 2.1 4.1e-25 75.5 0.7 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.5 0.7 2.1e-25 4.1e-25 1 119 [] 223 331 .. 223 331 .. 0.87 2 ? -2.6 0.0 0.33 0.65 40 72 .. 386 417 .. 361 425 .. 0.73 Alignments for each domain: == domain 1 score: 75.5 bits; conditional E-value: 2.1e-25 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsev 76 y+A++as+t+ + g+v++lq+ag+av +nvdvp +G+Y+++l++++ ++s+k++++v++Gt+ s + QEI20852.1|CBM10|CBM35|CBM5|GH5_7 223 YTAASASITAP--------AQLVGNVGELQGAGSAVIWNVDVPVTGEYRINLTWSS-PYSSKVNTLVMDGTALSYA 289 55666666663........24479********************************.9***************955 PP CBM35.hmm 77 tfpstgnwdtwgtaagtvtLkaGkntitiks...dwGwinldslel 119 + ++t t+++t tL+aG++++ ++ dwG++n++sl+l QEI20852.1|CBM10|CBM35|CBM5|GH5_7 290 FAEAT----VPVTYVQTKTLSAGNHSFGVRVgssDWGYMNVHSLKL 331 55555....33479***************9999**********987 PP == domain 2 score: -2.6 bits; conditional E-value: 0.33 CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtk 72 + + +G Y+l++ t +++l+v+v ++ QEI20852.1|CBM10|CBM35|CBM5|GH5_7 386 IPTQGDGVYRLKFGLEG-TVLSSNLRVTVGSAN 417 44556788888888776.777777777776555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (846 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 167.84 // Query: QEI13701.1|CBM10|CBM35|CBM5|GH5_7 [L=846] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-25 76.2 2.1 4.1e-25 75.5 0.7 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.5 0.7 2.1e-25 4.1e-25 1 119 [] 223 331 .. 223 331 .. 0.87 2 ? -2.6 0.0 0.33 0.65 40 72 .. 386 417 .. 361 425 .. 0.73 Alignments for each domain: == domain 1 score: 75.5 bits; conditional E-value: 2.1e-25 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsev 76 y+A++as+t+ + g+v++lq+ag+av +nvdvp +G+Y+++l++++ ++s+k++++v++Gt+ s + QEI13701.1|CBM10|CBM35|CBM5|GH5_7 223 YTAASASITAP--------AQLVGNVGELQGAGSAVIWNVDVPVTGEYRINLTWSS-PYSSKVNTLVMDGTALSYA 289 55666666663........24479********************************.9***************955 PP CBM35.hmm 77 tfpstgnwdtwgtaagtvtLkaGkntitiks...dwGwinldslel 119 + ++t t+++t tL+aG++++ ++ dwG++n++sl+l QEI13701.1|CBM10|CBM35|CBM5|GH5_7 290 FAEAT----VPVTYVQTKTLSAGNHSFGVRVgssDWGYMNVHSLKL 331 55555....33479***************9999**********987 PP == domain 2 score: -2.6 bits; conditional E-value: 0.33 CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtk 72 + + +G Y+l++ t +++l+v+v ++ QEI13701.1|CBM10|CBM35|CBM5|GH5_7 386 IPTQGDGVYRLKFGLEG-TVLSSNLRVTVGSAN 417 44556788888888776.777777777776555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (846 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 168.31 // Query: AAO31761.1|CBM10|CBM35|CBM5|GH5_7|3.2.1.78 [L=830] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-25 76.3 2.0 4e-25 75.5 0.7 2.1 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.5 0.7 2e-25 4e-25 1 119 [] 207 315 .. 207 315 .. 0.87 2 ? -3.2 0.0 0.53 1.1 54 74 .. 342 360 .. 335 385 .. 0.58 3 ? -2.9 0.0 0.41 0.83 42 73 .. 372 402 .. 359 409 .. 0.76 Alignments for each domain: == domain 1 score: 75.5 bits; conditional E-value: 2e-25 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvv 67 y+A++as+t+ + g+v++lq+ag+av +nvdvp +G+Y+++l++++ ++s+k++++v AAO31761.1|CBM10|CBM35|CBM5|GH5_7|3.2.1.78 207 YTAASASITAP--------AQLVGNVGELQGAGSAVIWNVDVPVTGEYRINLTWSS-PYSSKVNTLV 264 55666666663........24479********************************.9********* PP CBM35.hmm 68 vnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitiks...dwGwinldslel 119 ++Gt+ s ++ ++t t+++t tL+aG++++ ++ dwG++n++sl+l AAO31761.1|CBM10|CBM35|CBM5|GH5_7|3.2.1.78 265 MDGTALSYAFAEAT----VPVTYVQTKTLSAGNHSFGVRVgssDWGYMNVHSLKL 315 ******95555555....33479***************9999**********987 PP == domain 2 score: -3.2 bits; conditional E-value: 0.53 CBM35.hmm 54 YangtgstktlsvvvnGtkvs 74 Y + +++ l+ +vn+++ + AAO31761.1|CBM10|CBM35|CBM5|GH5_7|3.2.1.78 342 YEK--QGSGRLTYSVNDGATQ 360 444..3444555555555443 PP == domain 3 score: -2.9 bits; conditional E-value: 0.41 CBM35.hmm 42 vpkaGsYelslrYangtgstktlsvvvnGtkv 73 + +G Y+l++ t +++l+v+v ++v AAO31761.1|CBM10|CBM35|CBM5|GH5_7|3.2.1.78 372 TQGDGVYRLKFGLEG-TVLSSNLRVTVGSANV 402 556789999999887.7888888888876655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (830 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 164.88 // Query: QEY17021.1|CBM10|CBM35|CBM5|GH5_7 [L=835] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-22 67.2 1.4 1.6e-22 67.2 1.4 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.2 1.4 8e-23 1.6e-22 26 119 .] 231 322 .. 210 322 .. 0.92 2 ? -1.6 0.1 0.17 0.34 39 69 .. 376 405 .. 343 416 .. 0.65 Alignments for each domain: == domain 1 score: 67.2 bits; conditional E-value: 8e-23 CBM35.hmm 26 vdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkn 101 v++l ++g+av +nv+ p +G+Y++++++++ +++tkt+++vv+Gt +s+v+ ++ t +++t tL aG++ QEY17021.1|CBM10|CBM35|CBM5|GH5_7 231 VGNLMGDGSAVIWNVNLPVTGEYRITINWSA-PYGTKTNTLVVDGTGISNVFAETA----TPVAYTQTKTLIAGAH 301 78899**************************.9****************9988887....45678*********** PP CBM35.hmm 102 titiks...dwGwinldslel 119 ++ i+ dwG++n++sl++ QEY17021.1|CBM10|CBM35|CBM5|GH5_7 302 SFGIQVggsDWGYMNVHSLKV 322 *******************97 PP == domain 2 score: -1.6 bits; conditional E-value: 0.17 CBM35.hmm 39 nvdvpkaGsYelslrYangtgstktlsvvvn 69 ++ + +G Y+++l t+ +++l+v+v QEY17021.1|CBM10|CBM35|CBM5|GH5_7 376 TIPTKGDGVYRIKLGMEG-TTLSSNLRVTVG 405 344455677888887776.666777777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (835 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 250.30 // [ok]