# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM35/fasta_for_each_cluster/cluster_55.txt # target HMM database: merged_hmms/CBM35.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM35/CBM35_cluster_55.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: QWG10603.1|CBM35|GH2 [L=1011] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-18 54.2 0.2 1.1e-17 51.6 0.2 2.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.6 0.2 5.3e-18 1.1e-17 2 115 .. 889 1006 .. 889 1010 .. 0.87 Alignments for each domain: == domain 1 score: 51.6 bits; conditional E-value: 5.3e-18 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang..tgstktlsvvvnGtkvsevtfpstgnwd 85 +Aeda +gv++ ++ a+++G+g++d ++g++v+++ + ++G+ +l++rY++g ++ +++++vnG++++ v ++g + QWG10603.1|CBM35|GH2 889 QAEDARFDGVTIASKGANFNGKGYIDFGRNSGGYVEWYqENDGSEGEFTLQIRYSAGidVRKEHKVKLTVNGKEQELVLPANKGFRK 975 69************************************4555899***********9866778899*******97766655667778 PP CBM35.hmm 86 twgtaagtvtLkaGkntitiks..dwGwinld 115 tw++ ++ v G+nti+i++ ++G +d QWG10603.1|CBM35|GH2 976 TWQVIDVPVIMGTGANTIRITAlqSNGLC-ID 1006 99*******************98766654.55 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1011 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 208.89 // Query: QXP71851.1|CBM35|GH2 [L=1031] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-14 40.6 4.3 5e-14 39.7 1.5 2.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.1 0.08 0.16 26 47 .. 153 174 .. 149 205 .. 0.76 2 ! 39.7 1.5 2.5e-14 5e-14 2 116 .. 908 1027 .. 907 1030 .. 0.85 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.08 CBM35.hmm 26 vdglqaagdavtfnvdvpkaGs 47 v++l+++ +++tf+v v+++ + QXP71851.1|CBM35|GH2 153 VSELANTAETITFAVRVDNDKQ 174 7889999999****99987654 PP == domain 2 score: 39.7 bits; conditional E-value: 2.5e-14 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang..tgstktlsvvvnGtkvs.evtfpst.gn 83 +Ae+a+l+++++ ++ ++++G+gfv l++++++++++ + +aG+ el++rY+++ +++ + +v + G+ v e+ + +t + QXP71851.1|CBM35|GH2 908 QAEEATLENATISSKGKNFNGKGFV-SLKSKNASISWYqENDGSAGNAELTIRYSTNvaNKDGAYIKVNISGKVVRkELLLANTkQL 993 7************************.799*********555589************9656666667777789988888888888677 PP CBM35.hmm 84 wdtwgtaagtvtLkaGkntitiks.dwGwinlds 116 ++w+t+ + ++ + G+nti i+s + +d+ QXP71851.1|CBM35|GH2 994 GNNWKTVIIPIKIDRGANTILIESlGDQEVLIDE 1027 8999*****************9986444555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1031 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 265.58 // Query: AWW32876.1|CBM35|GH2 [L=1022] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-20 59.9 0.3 2e-19 57.2 0.1 2.6 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.3 0.0 0.26 0.52 62 77 .. 645 660 .. 639 672 .. 0.71 2 ! 57.2 0.1 9.8e-20 2e-19 2 118 .. 900 1020 .. 900 1021 .. 0.86 Alignments for each domain: == domain 1 score: -2.3 bits; conditional E-value: 0.26 CBM35.hmm 62 ktlsvvvnGtkvsevt 77 ++++vvnG++ ++ + AWW32876.1|CBM35|GH2 645 DEVELVVNGKSLGKKS 660 56899*****998654 PP == domain 2 score: 57.2 bits; conditional E-value: 9.8e-20 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang..tgstktlsvvvnGtkvsevtfpstgnw. 84 +Aedas ++ v ++ +gy+G+g+vd +ag++v+++ + ++G+ l+lrY+++ ++ +++++nG++ +++ +p+t+n+ AWW32876.1|CBM35|GH2 900 QAEDASYVQAIVSSDGQGYNGKGYVDFGRNAGGYVEWYqENDGSDGEFVLELRYSASpkVRDQYRVRLMINGKE-QNIILPATKNYr 985 69************************************4555899***********96445677889999*998.669999997772 PP CBM35.hmm 85 dtwgtaagtvtLkaGkntitiks..dwGwinldsle 118 ++w ++ + v LkaG+n+i+i d G + +d+l+ AWW32876.1|CBM35|GH2 986 KDWVVKNIRVDLKAGANNIRIMPmdDDG-FAIDQLK 1020 579******************9884444.5588876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1022 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 303.04 // Query: AWW32692.1|CBM35|GH2 [L=1016] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-18 51.8 0.1 2.9e-16 47.0 0.2 2.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.8 0.0 0.03 0.06 58 107 .. 107 151 .. 100 155 .. 0.72 2 ! 47.0 0.2 1.4e-16 2.9e-16 18 109 .. 911 1003 .. 898 1014 .. 0.84 Alignments for each domain: == domain 1 score: 0.8 bits; conditional E-value: 0.03 CBM35.hmm 58 tgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitiks 107 +g +++ +v+vnG++ ++ ++ ++++ +L +G+n i+++ AWW32692.1|CBM35|GH2 107 DGVYRNSEVWVNGHYLGKRPYGYI-SF----RYEISDYLHEGENLIAVRV 151 566788899999999986655555.23....4588889999999998876 PP == domain 2 score: 47.0 bits; conditional E-value: 1.4e-16 CBM35.hmm 18 agysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang.tgstktlsvvvnGtkvsevtfpstgnwdt.wgtaagtvtLkaGkn 101 ++ G+ + ++ +++++vt++ + +aG+ ++++ Ya+g + s++ +++++nG+kv ++ f+++g+w++ w++ ++ +LkaG+n AWW32692.1|CBM35|GH2 911 RNAAGNAYL-DFRGKEGTVTWYqENDGSAGMFDFEFYYASGdKNSNRPMDLYINGQKVTTMIFKNSGSWNSgWKKIQKAYPLKAGAN 996 456788888.5999*******9455589*************99999***********************9868************** PP CBM35.hmm 102 titiksdw 109 i+++ + AWW32692.1|CBM35|GH2 997 EIELRT-T 1003 ****97.3 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1016 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 297.93 // Query: ANW95878.1|CBM35|GH2 [L=1015] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-26 80.4 0.1 4.4e-23 69.0 0.0 3.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 7.8 0.1 0.0002 0.0004 52 108 .. 105 156 .. 94 160 .. 0.78 2 ! 69.0 0.0 2.2e-23 4.4e-23 2 108 .. 893 1002 .. 892 1013 .. 0.91 Alignments for each domain: == domain 1 score: 7.8 bits; conditional E-value: 0.0002 CBM35.hmm 52 lrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitiksd 108 ++Y + +g + + +v++nGt+ ++ ++ ++++ +Lk+Gknti+++ + ANW95878.1|CBM35|GH2 105 ITYIHFDGVYMNSEVWINGTYLGKRPYGYI-SF----RYDISKYLKQGKNTIAVRVN 156 566666777888899999999997666655.33....5699************9874 PP == domain 2 score: 69.0 bits; conditional E-value: 2.2e-23 CBM35.hmm 2 eAedasltg.vsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang.tgstktlsvvvnGtkvsevtfpstgnwd 85 Ae++ ltg +++ +++ y+Gsgfv ++++++a+tf+ + ++G+Y++++rY+++ + + ++++vn+++v++++f+ tg w+ ANW95878.1|CBM35|GH2 893 AAEEGILTGeAKISKEAHRYKGSGFV-RFDGKEGAITFYqENDGERGDYSIRFRYMHNnPNKLHPMKLYVNDEYVQTLEFKPTGGWE 978 59************************.8***********555589***********9989999***********************6 PP CBM35.hmm 86 .twgtaagtvtLkaGkntitiksd 108 +w+ + + +tLkaG+n+i+i+ d ANW95878.1|CBM35|GH2 979 kEWKFVPTIITLKAGANNIRIETD 1002 269******************983 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1015 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 292.66 // Query: AJR04473.1|CBM35|GH2 [L=1021] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-20 58.6 10.3 4.1e-19 56.2 0.6 3.7 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 7.1 0.1 0.00033 0.00066 54 108 .. 113 162 .. 100 166 .. 0.75 2 ? -1.5 0.7 0.16 0.31 31 74 .. 218 261 .. 198 310 .. 0.61 3 ! 56.2 0.6 2.1e-19 4.1e-19 2 108 .. 899 1010 .. 898 1020 .. 0.89 Alignments for each domain: == domain 1 score: 7.1 bits; conditional E-value: 0.00033 CBM35.hmm 54 YangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitiksd 108 Y n +g + + +v++nG+ ++ ++ ++++ +LkaGknti+++ d AJR04473.1|CBM35|GH2 113 YINFDGVYMNSEVWINGNHLGKRPYGYI-SF----RYDISKYLKAGKNTIAVRVD 162 6666666677778888888876555554.23....56999***********9874 PP == domain 2 score: -1.5 bits; conditional E-value: 0.16 CBM35.hmm 31 aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs 74 ++++a++++ +v + +++ ++ +g++++++++vn+ AJR04473.1|CBM35|GH2 218 NPSNALKYQFTVVTPTGQKIQSDIQKIDGDKSNTTLTVNNPVLW 261 55555555555544444556666666677888888888876655 PP == domain 3 score: 56.2 bits; conditional E-value: 2.1e-19 CBM35.hmm 2 eAedasltg.vsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang.tgstktlsvvvnGtkvsevtfpstgnw. 84 Ae+a l+g +++ ++++ ++G+gfv +++++++++tf+ + +aG+ ++++ Y+++ +g+t ++++vn+ ++++ +f++tg w AJR04473.1|CBM35|GH2 899 AAEEAILKGgAKTSKDAKHFKGTGFV-KFDNEEGSITFYqENDGEAGDFSIRFGYMHNdEGKTYPMKLFVNDIYIKTFEFEATGGWi 984 59*******9****************.7***********555589***********99999**********************9994 PP CBM35.hmm 85 dtwgtaagtvtLkaGkntitiks..d 108 ++w+++ + v+ k G+n+i+++ + AJR04473.1|CBM35|GH2 985 QNWQYVNTIVNFKSGANNIRLETtgQ 1010 568******************98533 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1021 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 235.61 // Query: BAX79082.1|CBM35|GH2 [L=1010] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-18 52.4 0.2 3.2e-17 50.1 0.0 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.7 0.0 0.35 0.7 33 46 .. 139 152 .. 136 180 .. 0.68 2 ! 50.1 0.0 1.6e-17 3.2e-17 2 116 .. 888 1006 .. 888 1009 .. 0.82 Alignments for each domain: == domain 1 score: -2.7 bits; conditional E-value: 0.35 CBM35.hmm 33 gdavtfnvdvpkaG 46 +d++tf+v v+++ BAX79082.1|CBM35|GH2 139 SDSITFAVRVDNDK 152 67888888886654 PP == domain 2 score: 50.1 bits; conditional E-value: 1.6e-17 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdv.pkaGsYelslrYang.tgstk.tlsvvvnGtkvsevtfpstgnw. 84 +Aedas +g+++++n ++++G+g++d ++g++v+++ + + G+ +l++rY+++ + + + +++nG+k +ev +p+ +n+ BAX79082.1|CBM35|GH2 888 QAEDASFDGANIESNGSDFKGKGYIDFGRNSGGYVEWYQENdGSPGEFTLQIRYSANdKIRPEyKALLTINGKK-QEVVLPALTNYr 973 69************************************6552788***********943333313447889998.568888887762 PP CBM35.hmm 85 dtwgtaagtvtLkaGkntitiks..dwGwinlds 116 ++w++ + +++L G+nti+i++ d G +d+ BAX79082.1|CBM35|GH2 974 KDWAVFELKAKLGSGANTIRITAleDDGLS-IDE 1006 679*******************99766654.555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1010 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 278.33 // Query: APY11646.1|CBM35|GH2 [L=1009] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-25 75.3 1.2 1.1e-22 67.7 0.0 3.6 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 4.0 0.1 0.003 0.006 52 108 .. 99 150 .. 89 154 .. 0.80 2 ? -1.7 0.0 0.18 0.36 67 94 .. 669 696 .. 650 701 .. 0.74 3 ! 67.7 0.0 5.4e-23 1.1e-22 2 108 .. 887 998 .. 886 1008 .. 0.89 Alignments for each domain: == domain 1 score: 4.0 bits; conditional E-value: 0.003 CBM35.hmm 52 lrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitiksd 108 ++Y n +g + + +v+vnG++ ++ ++ ++++ Lk+Gknt++++ d APY11646.1|CBM35|GH2 99 TTYINFDGVYMNSEVWVNGNYLGKRPYGYI-SF----RYDISKFLKEGKNTVAVRVD 150 568888888889999999999997666655.33....5699999********99874 PP == domain 2 score: -1.7 bits; conditional E-value: 0.18 CBM35.hmm 67 vvnGtkvsevtfpstgnwdtwgtaagtv 94 + +G++v++++f+++++ ++++t+ +++ APY11646.1|CBM35|GH2 669 YKDGKEVKQTSFTTSKQPSKLNTTLKKL 696 449999******9999888877666554 PP == domain 3 score: 67.7 bits; conditional E-value: 5.4e-23 CBM35.hmm 2 eAedasltg.vsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang.tgstktlsvvvnGtkvsevtfpstgnwd.t 86 Aed+ l+g +++ +++ y+Gsgfv ++++++avtf+ + +aG+Y++++rY+++ +g+ ++++vn++++ +++f+ tg w+ + APY11646.1|CBM35|GH2 887 AAEDGILEGgAKISDDARRYKGSGFV-RFDGKEGAVTFYqENDGEAGDYSIRFRYMHNnEGELHPMKLYVNDEYIRTLEFKPTGGWEkE 974 59******99****************.8***********555589***********9989999***********************626 PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..d 108 w+ + + ++LkaG+n+i+i+ + APY11646.1|CBM35|GH2 975 WRFVPTIINLKAGANNIKIETtgE 998 9******************98533 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1009 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 272.52 // Query: QXP68773.1|CBM35|GH2 [L=1031] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-14 41.6 4.4 2.9e-14 40.5 1.6 3.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.1 0.08 0.16 26 47 .. 153 174 .. 149 205 .. 0.76 2 ! 40.5 1.6 1.5e-14 2.9e-14 2 116 .. 908 1027 .. 907 1030 .. 0.87 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.08 CBM35.hmm 26 vdglqaagdavtfnvdvpkaGs 47 v++l+++ +++tf+v v+++ + QXP68773.1|CBM35|GH2 153 VSELANTAETITFAVRVDNDKQ 174 7889999999****99987654 PP == domain 2 score: 40.5 bits; conditional E-value: 1.5e-14 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang..tgstktlsvvvnGtkvs.evtfpst.gn 83 +Ae+a+l+++ + ++ ++++G+gfv l++++++++++ + +aG+ el++rY+++ +++ + ++v v G+ v e+ + +t + QXP68773.1|CBM35|GH2 908 QAEEATLENAIISSKGKNFNGKGFV-SLKSKNASISWYqENDGSAGNAELTIRYSTNvaNKDGAYVKVNVSGKVVRkELLLANTkQL 993 7************************.799*********555589************987888889999999*999888888888677 PP CBM35.hmm 84 wdtwgtaagtvtLkaGkntitiks.dwGwinlds 116 ++w+t+ + ++ + G+nti i+s + +d+ QXP68773.1|CBM35|GH2 994 GNNWKTVIIPIKIDRGANTILIESlGDQEVLIDE 1027 8999*****************9986444555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1031 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 291.45 // Query: ANQ51586.1|CBM35|GH2 [L=1010] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-20 60.0 2.6 2.9e-20 59.9 0.1 2.4 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 0.0 0.85 1.7 32 44 .. 138 150 .. 135 153 .. 0.83 2 ? -3.5 0.1 0.65 1.3 58 78 .. 221 241 .. 190 251 .. 0.61 3 ! 59.9 0.1 1.4e-20 2.9e-20 2 108 .. 888 998 .. 888 1008 .. 0.86 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 0.85 CBM35.hmm 32 agdavtfnvdvpk 44 ++d++tf+v v++ ANQ51586.1|CBM35|GH2 138 ENDEITFAVRVDN 150 6899*****9975 PP == domain 2 score: -3.5 bits; conditional E-value: 0.65 CBM35.hmm 58 tgstktlsvvvnGtkvsevtf 78 + + + ++v++G+ ++e+t ANQ51586.1|CBM35|GH2 221 EVAVADSKFVIDGNGHQEITQ 241 333444455666666665554 PP == domain 3 score: 59.9 bits; conditional E-value: 1.4e-20 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang..tgstktlsvvvnGtkvsevtfpstgnw.dt 86 +Aedas +gv++ ++ a+++G+gf+d+ ++g++v+f+ + ++G+Y+l+lrY+++ + ++ tl++ vnG+k+ + +ps +n+ ++ ANQ51586.1|CBM35|GH2 888 QAEDASFDGVTISNEGANFNGKGFIDYGRNEGGYVEFYqENDGSEGEYTLKLRYSAAkrDIKEHTLTLDVNGEKQV-IALPSCDNYrKE 975 69************************************4555899**********996677788888889*99965.999999777367 PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks.d 108 w++ +++v+L G+nti++++ + ANQ51586.1|CBM35|GH2 976 WREFEVKVQLGMGANTIRLTAlN 998 9******************9863 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1010 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 277.87 // Query: AZQ63933.1|CBM35|GH2 [L=1011] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-18 51.9 0.1 8.9e-18 51.9 0.1 3.2 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.1 0.1 0.49 0.99 60 77 .. 691 708 .. 685 723 .. 0.71 2 ? -0.0 0.1 0.053 0.11 59 110 .. 817 873 .. 770 878 .. 0.77 3 ! 51.9 0.1 4.4e-18 8.9e-18 2 115 .. 889 1006 .. 889 1010 .. 0.87 Alignments for each domain: == domain 1 score: -3.1 bits; conditional E-value: 0.49 CBM35.hmm 60 stktlsvvvnGtkvsevt 77 + ++l+++v+G++ +++t AZQ63933.1|CBM35|GH2 691 NPSKLKLTVDGESLNTTT 708 677889999999887543 PP == domain 2 score: -0.0 bits; conditional E-value: 0.053 CBM35.hmm 59 gstktlsvvvnGtkvsevtfpstgnwdtw..gtaagtvtLkaGkntitiks....dwG 110 ++ t +v+G+k + + + t+++d +t++ vtL +Gkn +t+ + d+G AZQ63933.1|CBM35|GH2 817 NGKVTIFYTVDGSKPTTSSKKYTTAFDVElgTTVKALVTL-NGKNALTMHEtfstDEG 873 5566666789999999888888988887553444555555.59998888776666666 PP == domain 3 score: 51.9 bits; conditional E-value: 4.4e-18 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang..tgstktlsvvvnGtkvsevtfpstgnwd 85 +Aeda +gv++ t+ a+++G+g++d ++g++v+++ + ++G+ +l++rY++g ++ +++++vnG++++ v ++g + AZQ63933.1|CBM35|GH2 889 QAEDARFDGVTIATKGANFNGKGYIDFGRNTGGYVEWYqENDGSEGEFTLQIRYSAGidVRKEHKVKLTVNGKEQELVLPANKGFRK 975 69************************************4555899***********9866778899*******97766655667778 PP CBM35.hmm 86 twgtaagtvtLkaGkntitiks..dwGwinld 115 tw+ ++ v G+nti+i++ ++G +d AZQ63933.1|CBM35|GH2 976 TWQIIEIPVIMGSGANTIRITAlqSNGLC-ID 1006 99*******************98766654.55 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1011 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 250.21 // Query: AWG23282.1|CBM35|GH2 [L=1012] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-14 39.9 0.9 4.5e-14 39.9 0.9 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.1 0.32 0.63 56 56 .. 167 167 .. 135 240 .. 0.57 2 ! 39.9 0.9 2.2e-14 4.5e-14 2 117 .. 888 1009 .. 888 1011 .. 0.88 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.32 CBM35.hmm 56 n 56 n AWG23282.1|CBM35|GH2 167 N 167 2 PP == domain 2 score: 39.9 bits; conditional E-value: 2.2e-14 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaG.sYelslrYang..tgstktlsvvvnGtkvs.evtfpst.gn 83 +Ae+a+ tgvs+ t+ a+++G+g+ +++++av++ + + ++ + e+ +rY+++ +++++ +++vnG+ + ++++p+t + AWG23282.1|CBM35|GH2 888 QAEQAKFTGVSIVTKGADFNGTGYLLFDKKQSGAVEWCQENDGGEaKAEIWIRYSAKveGKTASAIKLTVNGKVLNeKLELPNTkNL 974 69***********************9999********9776554415689******9977788889********9989******445 PP CBM35.hmm 84 wdtwgtaagtvtLkaGkntitiksdwGwi.nldsl 117 ++w+ ++++++L G+n+ +i+ G + +d++ AWG23282.1|CBM35|GH2 975 GSDWNIVKVKIKLGRGANNYKIEPADGSTfAIDEI 1009 678********************977777699987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1012 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 2 (1); expected 0.0 (0.02) Passed bias filter: 2 (1); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 227.65 // Query: ANW95447.1|CBM35|GH2 [L=1015] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-19 58.0 0.5 4.5e-17 49.6 0.2 2.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.3 0.0 0.0012 0.0024 66 108 .. 116 153 .. 98 157 .. 0.73 2 ! 49.6 0.2 2.2e-17 4.5e-17 3 110 .. 900 1003 .. 898 1012 .. 0.86 Alignments for each domain: == domain 1 score: 5.3 bits; conditional E-value: 0.0012 CBM35.hmm 66 vvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitiksd 108 v++nG++ ++ ++ ++++ +Lk+Gknti+++ d ANW95447.1|CBM35|GH2 116 VWINGHYLGKRPYGYI-SF----RYEISKYLKEGKNTIAVRVD 153 5566666554444333.22....56999***********9975 PP == domain 2 score: 49.6 bits; conditional E-value: 2.2e-17 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt.w 87 A++a + gvsv +++ ++fv +++++++++t++ + ++G +l+++Ya+++++ + ++++vn+++++ ++f++tg+w+ w ANW95447.1|CBM35|GH2 900 AAEADIVGVSVVSKNE----NSFV-DFKSKEGKITWYqENDGSSGVFTLKFSYASNDSKPRPMDLFVNNKRIGVLDFKNTGSWNAnW 981 6677777776666554....6899.5999*******94555899***************************************9648 PP CBM35.hmm 88 gtaagtvtLkaGkntitiksdwG 110 +++ ++ +L+aG+n i+++s +G ANW95447.1|CBM35|GH2 982 KEVNIKSQLQAGANYIELRS-KG 1003 ******************98.33 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1015 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 305.05 // Query: AQS94325.1|CBM35|GH2 [L=1009] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-24 73.3 1.0 1.8e-20 60.5 0.0 3.8 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 8.0 0.0 0.00018 0.00035 52 108 .. 99 150 .. 95 154 .. 0.83 2 ? 0.2 0.0 0.046 0.093 64 92 .. 666 694 .. 650 697 .. 0.78 3 ? -2.7 0.1 0.36 0.72 13 48 .. 820 854 .. 810 859 .. 0.63 4 ! 60.5 0.0 9.1e-21 1.8e-20 2 108 .. 887 998 .. 886 1008 .. 0.87 Alignments for each domain: == domain 1 score: 8.0 bits; conditional E-value: 0.00018 CBM35.hmm 52 lrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitiksd 108 ++Y n +g + + +v+vnG+ ++ ++ ++++ +Lk+Gknti+++ d AQS94325.1|CBM35|GH2 99 ITYINFDGVYMNSEVWVNGNHLGKRPYGYI-SF----RYDISKYLKEGKNTIAVRVD 150 789998999999999****99997766665.33....569*************9875 PP == domain 2 score: 0.2 bits; conditional E-value: 0.046 CBM35.hmm 64 lsvvvnGtkvsevtfpstgnwdtwgtaag 92 +++G++v++++f ++++ ++++t+ + AQS94325.1|CBM35|GH2 666 AVAYIDGKEVKSTSFSTSKQPSKLKTSLQ 694 5679************9998888777666 PP == domain 3 score: -2.7 bits; conditional E-value: 0.36 CBM35.hmm 13 vntnhagysGsgfvdglqaagdavtfnvdvpkaGsY 48 +n +++ +G+ + + + + +d++t++ v+++G+ AQS94325.1|CBM35|GH2 820 TNGGNPETNGKVYNGAF-EIKDNITVKAIVKQNGEI 854 44555666666666666.667777777777777765 PP == domain 4 score: 60.5 bits; conditional E-value: 9.1e-21 CBM35.hmm 2 eAedasltg.vsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang.tgstktlsvvvnGtkvsevtfpstgnwdt. 86 Ae++ l+g +++ +++ ++G+gfvd +++++++v+f+ + +aG+Y++++rY+++ g+ ++++vn++++ +++f++tg wd+ AQS94325.1|CBM35|GH2 887 SAEEGILKGsATASRKARRFKGTGFVD-FKDKEGSVEFYqENDGEAGDYSIRFRYMHNnIGEFHPMKLFVNDEYIRTLKFKATGGWDKs 974 59*******888889999********5.99*********555589***********9978999***********************974 PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..d 108 w+ + + + LkaG+n+i+++ + AQS94325.1|CBM35|GH2 975 WKFVPTIIRLKAGANNIRLETtgK 998 799999*************98533 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1009 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 277.52 // Query: QWG05364.1|CBM35|GH2 [L=1010] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-20 59.6 1.6 6.6e-20 58.7 0.2 2.3 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.3 0.1 0.54 1.1 59 77 .. 222 240 .. 189 249 .. 0.51 2 ! 58.7 0.2 3.3e-20 6.6e-20 2 108 .. 888 998 .. 888 1008 .. 0.85 Alignments for each domain: == domain 1 score: -3.3 bits; conditional E-value: 0.54 CBM35.hmm 59 gstktlsvvvnGtkvsevt 77 + + +++++G+ ++e+t QWG05364.1|CBM35|GH2 222 VAVADSKFTIDGNGHQEIT 240 2222333344444444333 PP == domain 2 score: 58.7 bits; conditional E-value: 3.3e-20 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang..tgstktlsvvvnGtkvsevtfpstgnw.dt 86 +Aeda +gv++ ++ a+++G+gf+d+ ++g++v+f+ + ++G+Y+l+lrY+++ + ++ tl++ vnG+k+ + +ps +n+ ++ QWG05364.1|CBM35|GH2 888 QAEDAAFDGVTISNEGANFNGKGFIDYGRNEGGYVEFYqENDGSEGEYTLKLRYSAAkrDIKEHTLTLDVNGEKQV-IALPSFDNYrKE 975 69************************************4555899**********996677788888889*99966.888888666267 PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks.d 108 w++ +++v+L G+nti++++ + QWG05364.1|CBM35|GH2 976 WREFEVKVQLGMGANTIRLTAlN 998 999****************9863 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1010 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 298.24 // Query: BAX78826.1|CBM35|GH2 [L=1032] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-15 44.8 3.2 3.4e-15 43.5 1.3 2.6 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.0 0.079 0.16 28 46 .. 153 171 .. 142 219 .. 0.83 2 ! 43.5 1.3 1.7e-15 3.4e-15 2 116 .. 908 1028 .. 907 1031 .. 0.88 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.079 CBM35.hmm 28 glqaagdavtfnvdvpkaG 46 ++ +++d++tf+v v+++ BAX78826.1|CBM35|GH2 153 EIVQKSDKITFAVRVDNDK 171 5668999*****9998754 PP == domain 2 score: 43.5 bits; conditional E-value: 1.7e-15 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdv.pkaGsYelslrYang..tgstktlsvvvnGtkvs.evtfpst.gn 83 +Aeda++ +v+++ a+++G+g+v+ ++ g++v ++ + aG+ +l +rY+++ ++s ++ vnG+ v+ + ++p+t + BAX78826.1|CBM35|GH2 908 QAEDANIISGKVQSKGAKFNGTGYVSMDKKIGASVAWYQENdGGAGNADLYIRYSSKiqNASGTFIKINVNGKVVEnKFFLPNTdNL 994 79************************************6552789***********98667777889********978889999444 PP CBM35.hmm 84 wdtwgtaagtvtLkaGkntitiks..dwGwinlds 116 ++w+++++ ++ + G+nti+i+ d+G + +d+ BAX78826.1|CBM35|GH2 995 GGSWNKVKVPIQIDRGANTIKIETleDKGLL-IDE 1028 6799*******************99888865.665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1032 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 267.98 // [ok]