# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM35/fasta_for_each_cluster/cluster_44.txt # target HMM database: merged_hmms/CBM35.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM35/CBM35_cluster_44.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: QRD92654.1|CBM35|GH43_24 [L=455] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-14 40.7 2.1 6.9e-14 39.3 2.1 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.3 2.1 3.5e-14 6.9e-14 1 111 [. 329 444 .. 329 449 .. 0.82 Alignments for each domain: == domain 1 score: 39.3 bits; conditional E-value: 3.5e-14 CBM35.hmm 1 yeAedasltg..vsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst 81 yeAe+ t + + +g+sG + v+++ +++d v nv ++++ + +++++Yang+ s++ +v+vnG+++ +++ps QRD92654.1|CBM35|GH43_24 329 YEAESSDSTLsnGAKIISCSGCSGGKSVGYIGGPDDGtiVVNNVASDASTDTTIRVQYANGNNSQRYANVTVNGQSHVLAFLPSG 413 677765444322445557899**********988776535556***********************************9999988 PP CBM35.hmm 82 gnwdtwgtaagtvtLkaGk.ntitiks.dwGw 111 + +t t++ tL++G+ ntit+++ ++Gw QRD92654.1|CBM35|GH43_24 414 -SGNTPFTSTLHTTLEKGDtNTITFSAyEEGW 444 .677778***********559*****997777 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (455 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 112.78 // Query: ATZ50667.1|CBM35|GH43_24 [L=450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-14 40.4 1.1 7.9e-14 39.1 1.1 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.1 1.1 3.9e-14 7.9e-14 2 119 .] 325 447 .. 323 447 .. 0.91 Alignments for each domain: == domain 1 score: 39.1 bits; conditional E-value: 3.9e-14 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq..aagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 eA +++l + +++ + +g+sG v+++ ++g+++t+n v + a + ++++++ ng++ ++ +vvvnG ++ +++p+ + ATZ50667.1|CBM35|GH43_24 325 EASTNTLANGAITLTCSGCSGGVQVGYIGgpSPGGTLTMNgVSSSVATTTSIRIHHTNGDSVQRYANVVVNGVSNILAFLPTA-D 408 6777888888899999*****999999985578999**************************************999999988.7 PP CBM35.hmm 84 wdtwgtaagtvtLkaGk.ntitiks.dwGwi.nldslel 119 +t gt++ t Lk G+ n i+++s ++Gw n+d++++ ATZ50667.1|CBM35|GH43_24 409 GNTPGTSVLTTALKSGTtNVIQFQSyNSGWApNIDRIMV 447 8888************6499**********99****986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (450 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 153.11 // Query: CAE7178317.1|CBM35|GH43_24 [L=447] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-16 46.1 2.1 7.3e-16 45.7 0.6 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.0 0.44 0.88 43 75 .. 108 140 .. 105 146 .. 0.75 2 ! 45.7 0.6 3.7e-16 7.3e-16 1 116 [. 324 441 .. 324 444 .. 0.84 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.44 CBM35.hmm 43 pkaGsYelslrYangtgstktlsvvvnGtkvse 75 +++G+Y l ++ ++++++++ v + +t ++ CAE7178317.1|CBM35|GH43_24 108 KQTGKYLLWMHIDSSDYKEAKIGVAIGDTVCGK 140 678999998888888888888777777776665 PP == domain 2 score: 45.7 bits; conditional E-value: 3.7e-16 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglq..aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst 81 ye e+a+l + + + + +g+sG + +++ + g+ + n ++++aG+ +l+++Y ng+ +++ svvvnG +++ +++p+ CAE7178317.1|CBM35|GH43_24 324 YEGESATLANGAKTISCSGCSGGSAAGYIGgpTVGGVTIANAQSEAAGRTTLRIKYLNGDNGQRYASVVVNGRAQKVAFLPNG 406 899*******7777778888888777777722444555556*****************************************9 PP CBM35.hmm 82 gnwdtwgtaagtvtLkaGkntitiks.dwGwi.nlds 116 g+ g++++ v L+ G n +++ d Gw ++d+ CAE7178317.1|CBM35|GH43_24 407 GSAP--GSSVVHVDLNTGGNEVKVLGvDGGWGpDVDR 441 7555..5****************98889999667776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (447 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 149.73 // Query: CAK45751.1|CBM35|GH43_24 [L=441] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-11 31.4 0.3 2e-11 31.4 0.3 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.7 0.1 0.36 0.72 75 89 .. 225 237 .. 214 254 .. 0.58 2 ! 31.4 0.3 9.8e-12 2e-11 4 108 .. 319 427 .. 316 438 .. 0.78 Alignments for each domain: == domain 1 score: -2.7 bits; conditional E-value: 0.36 CBM35.hmm 75 evtfpstgnwdtwgt 89 ++++ +g+w++w++ CAK45751.1|CBM35|GH43_24 225 STDL--NGTWSDWSD 237 3333..344655544 PP == domain 2 score: 31.4 bits; conditional E-value: 9.8e-12 CBM35.hmm 4 edasltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 + l++ + + +g+sG+ v+ + +++++++++ + ++++ + ++++rY ng+++++ +v+vnG+++ +++ps + +t CAK45751.1|CBM35|GH43_24 319 STSVLSNGAKVISCSGCSGDESVGWIGgSDNGTLEMRnISSDASTTTTIQVRYENGDSTQRYATVTVNGKSQILAFIPSD-SGNT 402 555555544455577888888887776456667888779**********************************9999998.6788 PP CBM35.hmm 87 wgtaagtvtLkaGk.ntitiks..d 108 +t++ +++L+ G+ n it+++ + CAK45751.1|CBM35|GH43_24 403 PATSVLNAQLESGDdNVITFSAyeE 427 89***********648888887543 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (441 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 155.06 // Query: QRV98871.1|CBM35|GH43_24 [L=448] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-17 51.1 2.0 1.5e-17 51.1 2.0 2.3 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.3 0.1 0.55 1.1 14 48 .. 107 141 .. 103 157 .. 0.63 2 ! 51.1 2.0 7.6e-18 1.5e-17 1 119 [] 324 446 .. 324 446 .. 0.90 Alignments for each domain: == domain 1 score: -3.3 bits; conditional E-value: 0.55 CBM35.hmm 14 ntnhagysGsgfvdglqaagdavtfnvdvpkaGsY 48 n ++++y + ++d + +++v ++ + GsY QRV98871.1|CBM35|GH43_24 107 NDSTKQYVMYMHIDSSNYGEAKVGVATSSSVCGSY 141 44555555555555566666666666666666666 PP == domain 2 score: 51.1 bits; conditional E-value: 7.6e-18 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagda.vtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 yeAe+as +g++v ++ +g+sG + v++l ++g+ +tfn v ++++ + +l++++ ng+++++ +++vnG ++ +++p+ + QRV98871.1|CBM35|GH43_24 324 YEAENASRSGAAVVASCSGCSGGSAVGYLGGSGNGvLTFNnVGSNASTRTTLRIKHENGDTAQRYGTITVNGVSQTVAFLPTA-D 407 9****************************988877369999*******************************99887777766.7 PP CBM35.hmm 84 wdtwgtaagtvtLkaGk.ntitiks.dwGwi.nldslel 119 +t g++++ v+L+ G+ nt+ i + G++ ++d+l++ QRV98871.1|CBM35|GH43_24 408 GQTPGSSVVHVSLNSGTsNTVIIAKsGDGYVaDIDRLMV 446 8888************64788777788999989999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (448 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 153.26 // Query: CCT72711.1|CBM35|GH43_24 [L=448] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-15 44.9 0.8 4e-15 43.3 0.8 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.3 0.8 2e-15 4e-15 3 117 .. 327 443 .. 325 444 .. 0.82 Alignments for each domain: == domain 1 score: 43.3 bits; conditional E-value: 2e-15 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 e+a++ + + + +++sG + v+++ ++++++tf+ ++G+ +++++Y+ng+++++ +v vnG++++ +++ ++ ++ CCT72711.1|CBM35|GH43_24 327 GETATMANDARVISCSECSGGKAVGYIGgDKKGTLTFKNIKSSGGTATINVKYRNGDTGSRYATVNVNGESQKLAFLSTS-HLSQ 410 57788888666666778888888888874677889**9666799***************************886666666.5666 PP CBM35.hmm 87 wgtaagtvtLkaGk.ntitiksdwGwi.nldsl 117 g + g + Lk+G+ ntiti++d Gw ++d+l CCT72711.1|CBM35|GH43_24 411 TGLSRGFFDLKEGSdNTITISNDDGWGpDVDAL 443 6************659**********7788876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (448 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 171.75 // Query: APA08821.1|CBM35|GH43_24 [L=450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-12 34.9 0.3 4.8e-12 33.3 0.3 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.3 0.3 2.4e-12 4.8e-12 24 119 .] 350 447 .. 323 447 .. 0.84 Alignments for each domain: == domain 1 score: 33.3 bits; conditional E-value: 2.4e-12 CBM35.hmm 24 gfvdglqaagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGk.ntitik 106 g+++g ++g+++t++ v + a + ++++++ ng+++++ +vvvnG ++ +++p+ + +t gt++ t Lk G+ n i+++ APA08821.1|CBM35|GH43_24 350 GYIGGP-SPGGTLTIDgVSSSVATTTTIRIHHLNGDSTQRYANVVVNGVSNIIAFLPTA-DGNTPGTSVLTTALKSGAgNVIEFE 432 555444.7889999999*********************************997777766.78999************8799**** PP CBM35.hmm 107 s.dwGwi.nldslel 119 s ++Gw ++d++++ APA08821.1|CBM35|GH43_24 433 SyNSGWApDIDRIMV 447 ******99****986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (450 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.35 // Query: VBB85982.1|CBM35|GH43_24 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-12 32.4 0.0 1.9e-11 31.4 0.0 1.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.4 0.0 9.7e-12 1.9e-11 1 119 [] 328 449 .. 328 449 .. 0.89 Alignments for each domain: == domain 1 score: 31.4 bits; conditional E-value: 9.7e-12 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqa.agdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 ye e+a g + n + + +sG+ +++ + + ++vtfn + ++ +G ++++++ ng++s + +v vnG+ ++ f + VBB85982.1|CBM35|GH43_24 328 YEGEKAVYGGKARNVDCSTCSGKVTAGYIGGpDRGSVTFNnIRSDIDGLTTIRIKFLNGDSSPRYANVRVNGDGGRKIAFLPAKG 412 899*******999**********9999998515689****9*********************************99888766654 PP CBM35.hmm 84 wdtwgtaagtvtLkaGk.ntitiks.dwGwi.nldslel 119 ++++ ++L+ G+ nti i+ +Gw ++d+l++ VBB85982.1|CBM35|GH43_24 413 DP--ASSTLHANLRRGSsNTIVIEGfGNGWGpDVDRLMV 449 44..48**********559*****999999879999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 160.91 // Query: QSZ32185.1|CBM35|GH43_24 [L=431] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-15 43.1 0.4 1.1e-14 41.8 0.4 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 41.8 0.4 5.7e-15 1.1e-14 2 119 .] 307 428 .. 305 428 .. 0.88 Alignments for each domain: == domain 1 score: 41.8 bits; conditional E-value: 5.7e-15 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnw 84 eA +++l + + + + +g+sGs+ v+++ +g+++t+n v ++++ + +++++Y ng+ ++ +vvvnG ++ +++p tg+ QSZ32185.1|CBM35|GH43_24 307 EATTNTLANGARTLSCSGCSGSSQVGYIGgPPGGKLTINgVSSTADTQSTIRIHYTNGDLVQRYANVVVNGVSHVVAFLP-TGDV 390 56666666666777889***********9457999*************************************98866665.669* PP CBM35.hmm 85 dtwgtaagtvtLkaG.kntitiks.dwGwi.nldslel 119 +t g ++ t Lk G +n i++ks ++Gw n+d+l++ QSZ32185.1|CBM35|GH43_24 391 NTPGRSVFTTALKSGtSNVIEFKSyNSGWGpNIDRLMV 428 ***************5599**********98***9986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (431 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 161.23 // Query: AEO58304.1|CBM35|GH43_24 [L=451] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-15 42.4 1.1 1.8e-14 41.2 0.0 2.3 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.1 0.32 0.64 42 67 .. 106 131 .. 103 141 .. 0.71 2 ? -2.6 0.0 0.33 0.65 11 29 .. 265 283 .. 252 300 .. 0.59 3 ! 41.2 0.0 8.9e-15 1.8e-14 1 119 [] 327 448 .. 327 448 .. 0.92 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.32 CBM35.hmm 42 vpkaGsYelslrYangtgstktlsvv 67 +k+G+Y l ++ +++++++ + v AEO58304.1|CBM35|GH43_24 106 NDKTGKYVLWMHMDSSNYGEARVAVA 131 56889999988888877777666665 PP == domain 2 score: -2.6 bits; conditional E-value: 0.33 CBM35.hmm 11 vsvntnhagysGsgfvdgl 29 +++ +++a y G+ +v++ AEO58304.1|CBM35|GH43_24 265 LKTSESSAIYMGDRWVKDN 283 4455555566666666544 PP == domain 3 score: 41.2 bits; conditional E-value: 8.9e-15 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 yeAe a+ g + n + +g+sG+ +++ ++++vtf+ + ++ +G ++++++ ng++s + +v vnG++ ++ f + AEO58304.1|CBM35|GH43_24 327 YEAEAATYGGKARNIDCSGCSGKVAAGYIGgPDNGSVTFTgIRSDIDGLTTIRIKFLNGDSSPRYANVRVNGDAGRKIAFLTARG 411 9**********************9999998346789*******************************************999966 PP CBM35.hmm 84 wdtwgtaagtvtLkaGk.ntitiks.dwGwi.nldslel 119 +++ ++Lk+G+ nti i+ + Gw ++d+l++ AEO58304.1|CBM35|GH43_24 412 DPA--SSTLHAQLKKGSdNTIVIEGiNGGWGpDVDRLMV 448 655..9**********659******99999889999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (451 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 140.06 // Query: CEI70638.1|CBM35|GH43_24 [L=447] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-16 47.7 0.7 7.3e-16 45.7 0.1 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.1 0.16 0.32 42 74 .. 109 141 .. 106 152 .. 0.76 2 ! 45.7 0.1 3.6e-16 7.3e-16 16 117 .. 340 442 .. 325 443 .. 0.80 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.16 CBM35.hmm 42 vpkaGsYelslrYangtgstktlsvvvnGtkvs 74 +++G+Y l l+ +++++++ + v ++ + CEI70638.1|CBM35|GH43_24 109 NDETGKYVLYLHIDSSDYKDARVGVATGDSVCG 141 578999999999999888888877776666555 PP == domain 2 score: 45.7 bits; conditional E-value: 3.6e-16 CBM35.hmm 16 nhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaG 99 + ++sG++ v+++ ++++++tf+ ++G +++++Y+ng+++++ +v+vnG++++ +++ st ++ g + g + L+ G CEI70638.1|CBM35|GH43_24 340 SCNECSGDKAVGYIGgDKKGTLTFKNIKSSGGLSTINIKYRNGDTGSRYATVSVNGESQKLAFL-STRHLSETGLSRGFFDLEDG 423 4567888888888874677889**9666799***************************885555.55577777************ PP CBM35.hmm 100 kntitiksdwGwi.nldsl 117 +nti i++d Gw ++d+l CEI70638.1|CBM35|GH43_24 424 DNTIVISNDDGWGpDVDAL 442 ************7788765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (447 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 166.21 // Query: QBZ64930.1|CBM35|GH43_24 [L=458] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-07 18.4 0.0 4.4e-07 17.3 0.0 1.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 17.3 0.0 2.2e-07 4.4e-07 1 107 [. 331 440 .. 331 455 .. 0.67 Alignments for each domain: == domain 1 score: 17.3 bits; conditional E-value: 2.2e-07 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglq.aagdavtfn...vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst 81 ye e a+l g + + +g+s+ + +++ + ++ vt++ +p++ ++++r+ang+g+ + +v+vnG+ + f+ t QBZ64930.1|CBM35|GH43_24 331 YEGEVAQLGGGARVVSCSGCSAGSAAGYIGgDVNGIVTISgvrSSAPDGTLTTVRIRFANGDGNPRYANVTVNGGPPTRLAFEPT 415 66777777773333344455444444444412344455555124578888999*****************************999 PP CBM35.hmm 82 gnwdtwgtaagtvtLka.Gkntitiks 107 + +++ +v+L+ +nti ++ QBZ64930.1|CBM35|GH43_24 416 RGGVS--DSTLNVQLRPsTDNTIVVSG 440 54444..79999999851457777666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (458 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 176.97 // Query: QRW13423.1|CBM35|GH43_24 [L=449] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-17 49.3 1.7 5.3e-17 49.3 1.7 2.3 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.3 0.1 0.55 1.1 14 48 .. 107 141 .. 103 157 .. 0.63 2 ! 49.3 1.7 2.7e-17 5.3e-17 1 119 [] 324 446 .. 324 446 .. 0.90 Alignments for each domain: == domain 1 score: -3.3 bits; conditional E-value: 0.55 CBM35.hmm 14 ntnhagysGsgfvdglqaagdavtfnvdvpkaGsY 48 n ++++y + ++d + +++v ++ + GsY QRW13423.1|CBM35|GH43_24 107 NDSTKQYVMYMHIDSSNYGEAKVGVATSSSVCGSY 141 44555555555555566666666666666666666 PP == domain 2 score: 49.3 bits; conditional E-value: 2.7e-17 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagda.vtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 yeAe+as +g++v ++ +g+sG v++l ++g+ +tfn v ++++ + +l++++ ng+++++ +++vnG ++ +++p+ + QRW13423.1|CBM35|GH43_24 324 YEAENASRSGAAVVASCSGCSGGFAVGYLGGSGNGvLTFNnVGSNASTRTTLRIKHENGDTAQRYGTITVNGVSQTVAFLPTA-D 407 9****************************988877369999*******************************99887777766.7 PP CBM35.hmm 84 wdtwgtaagtvtLkaGk.ntitiks.dwGwi.nldslel 119 +t g++++ v+L+ G+ nt+ i + G++ ++d+l++ QRW13423.1|CBM35|GH43_24 408 GQTPGSSVVHVSLNSGTsNTVIIAKsGDGYVaDIDRLMV 446 8888************64788777788999989999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (449 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.21 // Query: QGA20789.1|CBM35|GH43_24 [L=450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-09 25.1 0.9 5.8e-09 23.4 0.9 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.4 0.9 2.9e-09 5.8e-09 19 112 .. 349 438 .. 328 444 .. 0.79 Alignments for each domain: == domain 1 score: 23.4 bits; conditional E-value: 2.9e-09 CBM35.hmm 19 gysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGk.n 101 + ++ g+++g +g++ tf+ ++++++ ++++ Y+ng+++++ +v+vnG + ++ps + gt++++ +L+aG+ n QGA20789.1|CBM35|GH43_24 349 DNEAAGYIGGP--SGGTATFTgITATSSALSTVQIVYRNGDSTARYADVTVNGVTQLIEFLPSLS----PGTSVINCHLNAGSsN 427 44566777655..778889999*********************************9999999994....5678*********648 PP CBM35.hmm 102 titiksdwGwi 112 i i+ G + QGA20789.1|CBM35|GH43_24 428 EIVITTTDGTY 438 99999877765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (450 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 169.49 // Query: QGI68348.1|CBM35|GH43_24 [L=464] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-15 45.0 0.8 4.2e-15 43.2 0.8 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.2 0.8 2.1e-15 4.2e-15 3 117 .. 343 459 .. 341 460 .. 0.82 Alignments for each domain: == domain 1 score: 43.2 bits; conditional E-value: 2.1e-15 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 e+a++ + + + +++sG + v+++ ++++++tf+ ++G+ +++++Y+ng+++++ +v vnG++++ +++ ++ ++ QGI68348.1|CBM35|GH43_24 343 GETATMANDARVISCSECSGGKAVGYIGgDKKGTLTFKNIKSSGGTATINVKYRNGDTGSRYATVNVNGESQKLAFLSTS-HLSQ 426 57788888666666778888888888874677889**9666799***************************886666666.5666 PP CBM35.hmm 87 wgtaagtvtLkaGk.ntitiksdwGwi.nldsl 117 g + g + Lk+G+ ntiti++d Gw ++d+l QGI68348.1|CBM35|GH43_24 427 TGLSRGFFDLKEGSdNTITISNDDGWGpDVDAL 459 6************659**********7788876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (464 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 182.78 // Query: BAE66404.1|CBM35|GH43_24 [L=460] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-15 43.6 1.3 8.3e-15 42.3 1.3 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 1.3 4.1e-15 8.3e-15 1 117 [. 334 456 .. 334 458 .. 0.83 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 4.1e-15 CBM35.hmm 1 yeAeda..sltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst 81 yeAe+ +l++ + + +g+sG + v+++ +++d v nv ++++ + +++++Yang+ s++ +v+vnG+++ +++ps BAE66404.1|CBM35|GH43_24 334 YEAESSdnTLSNGAKIISCSGCSGGKSVGYIGGPDDGtiVVNNVASDASTDTTIRVQYANGNNSQRYANVTVNGQSHVLAFLPSG 418 67776511445555556789***********988776535556***********************************9999988 PP CBM35.hmm 82 gnwdtwgtaagtvtLkaGk.ntitiks.dwGwi.nldsl 117 + +t t++ tL++G+ ntit+++ ++Gw +ld+l BAE66404.1|CBM35|GH43_24 419 -SGNTPFTSTLHTTLEKGDtNTITFSAyEEGWGpDLDQL 456 .677778***********559******999998788887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (460 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 176.43 // Query: QPC63035.1|CBM35|GH43_24 [L=447] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-17 49.4 1.7 6.3e-17 49.1 0.3 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.2 0.1 0.52 1 64 94 .. 270 300 .. 254 303 .. 0.52 2 ! 49.1 0.3 3.1e-17 6.3e-17 3 117 .. 327 442 .. 325 443 .. 0.78 Alignments for each domain: == domain 1 score: -3.2 bits; conditional E-value: 0.52 CBM35.hmm 64 lsvvvnGtkvsevtfpstgnwdtwgtaagtv 94 + +++ + vs+ st w +++ ++v QPC63035.1|CBM35|GH43_24 270 NAIYIGDRWVSTNLAASTYVWLPLKVEGTKV 300 3455555555555555555555555555555 PP == domain 2 score: 49.1 bits; conditional E-value: 3.1e-17 CBM35.hmm 3 Aedasltg...vsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 e+a + + v + ++sGs+ v+++ ++++++tf+ ++G +++++Y+ng+++++ +v+vnG++++ +++ + QPC63035.1|CBM35|GH43_24 327 GENAVMANdarVISC---NECSGSKAVGYIGgDKKGTLTFKSVKSSGGLSTINIKYRNGDTGSRYATVSVNGKSQKLAFLSTR-H 407 567777774334444...4556666666555368889****666799***************************886666555.6 PP CBM35.hmm 84 wdtwgtaagtvtLkaGkntitiksdwGwi.nldsl 117 ++ g + g + ++G+ntiti++++Gw ++d+l QPC63035.1|CBM35|GH43_24 408 LSQTGLSRGFFDMEEGDNTITISNSEGWGpDVDAL 442 6666************************7788876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (447 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 146.79 // Query: QRW25798.1|CBM35|GH43_24 [L=447] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-17 51.2 2.2 1.5e-17 51.2 2.2 2.6 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.1 0.64 1.3 9 28 .. 28 47 .. 25 50 .. 0.70 2 ? -3.0 0.0 0.46 0.92 69 97 .. 60 88 .. 58 89 .. 0.81 3 ? -1.8 0.0 0.19 0.38 82 108 .. 253 275 .. 210 281 .. 0.66 4 ! 51.2 2.2 7.3e-18 1.5e-17 1 101 [. 325 426 .. 325 431 .. 0.93 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.64 CBM35.hmm 9 tgvsvntnhagysGsgfvdg 28 ++s +++h + G g++++ QRW25798.1|CBM35|GH43_24 28 WTASGTNQHIQAHGGGMIKE 47 45667788999999988865 PP == domain 2 score: -3.0 bits; conditional E-value: 0.46 CBM35.hmm 69 nGtkvsevtfpstgnwdtwgtaagtvtLk 97 nG++ ++++ s++n +w+++ +tL+ QRW25798.1|CBM35|GH43_24 60 NGSAFQSINCYSSTNLVEWKYVGALLTLQ 88 89999999999999999998887777775 PP == domain 3 score: -1.8 bits; conditional E-value: 0.19 CBM35.hmm 82 gnwdtwgtaagtvtLkaGkntitiksd 108 +wd+ ++t+ L G+n i +++ QRW25798.1|CBM35|GH43_24 253 RTWDS----QTTFVLPIGNNFIYMGDR 275 33444....566677888887777665 PP == domain 4 score: 51.2 bits; conditional E-value: 7.3e-18 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagda.vtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 yeAe+asl+g++v+++ +g+sG++ v+++ ++g+ +tfn v +++a + +l++++ ng+++++ +++vnG ++ +++p+t + QRW25798.1|CBM35|GH43_24 325 YEAESASLSGSAVKASCSGCSGTSAVGYIGGSGNGvLTFNnVASNAATRTTLRIKHLNGDTAQRYGTITVNGVAQTVAFLPTT-D 408 9****************************988877369999*********************************999999988.6 PP CBM35.hmm 84 wdtwgtaagtvtLkaGkn 101 +t g++++ v+L+ G+ QRW25798.1|CBM35|GH43_24 409 GQTPGSSVVHVNLNSGSS 426 7888************75 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (447 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 148.06 // Query: QMW36340.1|CBM35|GH43_24 [L=460] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-15 43.6 1.1 8e-15 42.3 1.1 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 1.1 4e-15 8e-15 1 117 [. 334 456 .. 334 458 .. 0.83 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 4e-15 CBM35.hmm 1 yeAedasltg..vsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst 81 yeAe+ t + + +g+sG + v+++ +++d v nv ++++ + +++++Yang+ s++ +v+vnG+++ +++ps QMW36340.1|CBM35|GH43_24 334 YEAESSDSTLsnGAKIISCSGCSGGKSVGYIGGPDDGtiVVNNVASDASTDTTIRVQYANGNNSQRYANVTVNGQSHVLAFLPSG 418 677765444322445557899**********988776535556***********************************9999988 PP CBM35.hmm 82 gnwdtwgtaagtvtLkaGk.ntitiks.dwGwi.nldsl 117 + +t t++ tL++G+ ntit+++ ++Gw +ld+l QMW36340.1|CBM35|GH43_24 419 -SGNTPFTSTLHTTLEKGDtNTITFSAyEEGWGpDLDQL 456 .677778***********559******999998788887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (460 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 172.45 // Query: BCS13419.1|CBM35|GH43_24 [L=449] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-12 33.0 0.4 6.2e-12 33.0 0.4 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.3 0.21 0.42 62 81 .. 230 249 .. 219 280 .. 0.55 2 ! 33.0 0.4 3.1e-12 6.2e-12 3 107 .. 326 432 .. 324 446 .. 0.79 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.21 CBM35.hmm 62 ktlsvvvnGtkvsevtfpst 81 t+s +nGt ++ +f + BCS13419.1|CBM35|GH43_24 230 YTTSTDLNGTWSDWSNFATA 249 33344444444443333333 PP == domain 2 score: 33.0 bits; conditional E-value: 3.1e-12 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwd 85 A ++ l++ + + +g+sG+ v+ + +++++++++ + ++++ + ++++rY ng+++++ ++v+vnG+++ +++ps n + BCS13419.1|CBM35|GH43_24 326 ASTNVLSNGAKVISCSGCSGDESVGWIGgSDNGTLEMRnISSDASTTTTIQVRYENGDSTQRYTTVTVNGKSQILAFLPSD-NGN 409 5666666655555678899988887776456667888779**********************************9999998.889 PP CBM35.hmm 86 twgtaagtvtLkaGk.ntitiks 107 t +t++ +++L+ G+ n it+++ BCS13419.1|CBM35|GH43_24 410 TPATSVLNAQLESGDdNIITFSA 432 999***********736677776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (449 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 154.62 // Query: QRV84826.1|CBM35|GH43_24 [L=370] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-09 25.5 0.8 1.3e-09 25.5 0.8 2.3 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.8 0.1 0.76 1.5 10 26 .. 29 45 .. 24 53 .. 0.64 2 ? -3.2 0.1 0.52 1 54 85 .. 121 153 .. 107 159 .. 0.57 3 ! 25.5 0.8 6.6e-10 1.3e-09 3 82 .. 265 348 .. 263 359 .. 0.89 Alignments for each domain: == domain 1 score: -3.8 bits; conditional E-value: 0.76 CBM35.hmm 10 gvsvntnhagysGsgfv 26 ++s +++h + G g++ QRV84826.1|CBM35|GH43_24 29 TASGTNQHVQAHGGGII 45 44555667777777665 PP == domain 2 score: -3.2 bits; conditional E-value: 0.52 CBM35.hmm 54 YangtgstktlsvvvnGtkvsevtfpst.gnwd 85 +n + +++ + + +n+ +++ +++ s+ +w+ QRV84826.1|CBM35|GH43_24 121 SSNYGEAKRANGLRINKLSSDYLSVVSNvYTWS 153 444455666677777766666555544434454 PP == domain 3 score: 25.5 bits; conditional E-value: 6.6e-10 CBM35.hmm 3 Aedasltg..vsvntnhagysGsgfvdglqaagda.vtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstg 82 A ++s+t+ ++v ++ +g+sG v++l ++g+ +tfn v ++++ + +l++++ ng+++++ +++vnG ++ +++p+ + QRV84826.1|CBM35|GH43_24 265 ANSGSMTAgrAAVVASCSGCSGGFAVGYLGGSGNGvLTFNnVGSNASTRTTLRIKHENGDTAQRYGTITVNGVSQTVAFLPTAD 348 88999999999999***************988877369999*********************************9988888763 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (370 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 144.58 // Query: CAJ81228.1|CBM35|GH43_24 [L=456] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-15 45.2 0.4 3.5e-15 43.5 0.4 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.5 0.4 1.7e-15 3.5e-15 2 119 .] 332 453 .. 331 453 .. 0.85 Alignments for each domain: == domain 1 score: 43.5 bits; conditional E-value: 1.7e-15 CBM35.hmm 2 eAedasltg...vsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstg 82 e eda+l+g + +++ +g +G g+ +g ++++ vtf+ v++++a + +++++Y+n +++++ +v+vnG++++ + f t+ CAJ81228.1|CBM35|GH43_24 332 EGEDATLSGgarTVTCSGCSGGEGAGYLGG--TDSGVVTFAgVTSDAATKSSVRVKYQNLDSTARYADVSVNGGAKQRIAFLPTA 414 6799*****665556666666666666654..47788*********************************************998 PP CBM35.hmm 83 nwdtwgtaagtvtLkaGk.ntitiks.dwGwi.nldslel 119 n + g++++++ LkaG+ n + i+ + Gw ++d++++ CAJ81228.1|CBM35|GH43_24 415 NGTP-GSSVVNLDLKAGSaNEVVIEGaNGGWGpDVDRIMV 453 7776.************64899999989999889999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (456 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 191.96 // Query: QPC80356.1|CBM35|GH43_24 [L=447] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-17 48.9 0.4 7.6e-17 48.9 0.4 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.4 0.1 0.29 0.59 48 96 .. 256 302 .. 252 303 .. 0.68 2 ! 48.9 0.4 3.8e-17 7.6e-17 3 117 .. 327 442 .. 325 443 .. 0.78 Alignments for each domain: == domain 1 score: -2.4 bits; conditional E-value: 0.29 CBM35.hmm 48 YelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtL 96 Y+ +++Y + + + +++ + vs+ + st w +++ ++vtL QPC80356.1|CBM35|GH43_24 256 YQSQVSYIQP-L-GNGNAIYIGDRWVSTNLVASTYVWLPLKVEGTKVTL 302 5556666662.3.334568888888888888888888887887777777 PP == domain 2 score: 48.9 bits; conditional E-value: 3.8e-17 CBM35.hmm 3 Aedasltg...vsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 e+a + + v + ++sGs+ v+++ ++++++tf+ ++G +++++Y+ng+++++ +v+vnG++++ +++ + QPC80356.1|CBM35|GH43_24 327 GENAVMANdarVISC---NECSGSKAVGYIGgDKKGTLTFKSVKSSGGLSTINIKYRNGDTGSRYATVSVNGKSQKLAFLSTR-H 407 567777774334444...4556666666555368889****666799***************************886666555.6 PP CBM35.hmm 84 wdtwgtaagtvtLkaGkntitiksdwGwi.nldsl 117 ++ g + g + ++G+ntiti+++ Gw ++d+l QPC80356.1|CBM35|GH43_24 408 LSQTGLSHGFFDMEEGDNTITISNNDGWGpDVDAL 442 6666***********************97788765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (447 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 171.21 // Query: QGI85565.1|CBM35|GH43_24 [L=464] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-15 45.0 0.8 4.2e-15 43.2 0.8 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.2 0.8 2.1e-15 4.2e-15 3 117 .. 343 459 .. 341 460 .. 0.82 Alignments for each domain: == domain 1 score: 43.2 bits; conditional E-value: 2.1e-15 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 e+a++ + + + +++sG + v+++ ++++++tf+ ++G+ +++++Y+ng+++++ +v vnG++++ +++ ++ ++ QGI85565.1|CBM35|GH43_24 343 GETATMANDARVISCSECSGGKAVGYIGgDKKGTLTFKNIKSSGGTATINVKYRNGDTGSRYATVNVNGESQKLAFLSTS-HLSQ 426 57788888666666778888888888874677889**9666799***************************886666666.5666 PP CBM35.hmm 87 wgtaagtvtLkaGk.ntitiksdwGwi.nldsl 117 g + g + Lk+G+ ntiti++d Gw ++d+l QGI85565.1|CBM35|GH43_24 427 TGLSRGFFDLKEGSdNTITISNDDGWGpDVDAL 459 6************659**********7788876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (464 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 176.80 // Query: QMW48394.1|CBM35|GH43_24 [L=460] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-15 43.6 1.3 8.3e-15 42.3 1.3 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 1.3 4.1e-15 8.3e-15 1 117 [. 334 456 .. 334 458 .. 0.83 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 4.1e-15 CBM35.hmm 1 yeAeda..sltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst 81 yeAe+ +l++ + + +g+sG + v+++ +++d v nv ++++ + +++++Yang+ s++ +v+vnG+++ +++ps QMW48394.1|CBM35|GH43_24 334 YEAESSdnTLSNGAKIISCSGCSGGKSVGYIGGPDDGtiVVNNVASDASTDTTIRVQYANGNNSQRYANVTVNGQSHVLAFLPSG 418 67776511445555556789***********988776535556***********************************9999988 PP CBM35.hmm 82 gnwdtwgtaagtvtLkaGk.ntitiks.dwGwi.nldsl 117 + +t t++ tL++G+ ntit+++ ++Gw +ld+l QMW48394.1|CBM35|GH43_24 419 -SGNTPFTSTLHTTLEKGDtNTITFSAyEEGWGpDLDQL 456 .677778***********559******999998788887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (460 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 162.59 // Query: CEF86826.1|CBM35|GH43_24 [L=447] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-18 53.9 1.6 2.9e-18 53.4 0.3 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.2 0.1 0.52 1 64 94 .. 270 300 .. 254 303 .. 0.52 2 ! 53.4 0.3 1.4e-18 2.9e-18 3 117 .. 327 442 .. 325 443 .. 0.79 Alignments for each domain: == domain 1 score: -3.2 bits; conditional E-value: 0.52 CBM35.hmm 64 lsvvvnGtkvsevtfpstgnwdtwgtaagtv 94 + +++ + vs+ st w +++ ++v CEF86826.1|CBM35|GH43_24 270 NAIYIGDRWVSTNLAASTYVWLPLKVEGTKV 300 3455555555555555555555555555555 PP == domain 2 score: 53.4 bits; conditional E-value: 1.4e-18 CBM35.hmm 3 Aedasltg...vsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 e+a + + v + ++sGs+ v+++ ++++++tf+ ++G +++++Y+ng+++++ +v+vnG++++ +++ + CEF86826.1|CBM35|GH43_24 327 GENAVMANdarVISC---NECSGSKAVGYIGgDKKGTLTFKSVKSSGGLSTINIKYRNGDTGSRYATVSVNGKSQKLAFLSTR-H 407 567777774334444...4556666666555368889****666799***************************886666555.6 PP CBM35.hmm 84 wdtwgtaagtvtLkaGkntitiksdwGwi.nldsl 117 ++ g + g + L++G+ntiti+++ Gw ++d+l CEF86826.1|CBM35|GH43_24 408 LSQTGLSRGFFDLEEGDNTITISNNDGWSpDVDAL 442 6666************************9899876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (447 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 149.48 // Query: QGI99241.1|CBM35|GH43_24 [L=464] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-15 45.0 0.8 4.2e-15 43.2 0.8 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.2 0.8 2.1e-15 4.2e-15 3 117 .. 343 459 .. 341 460 .. 0.82 Alignments for each domain: == domain 1 score: 43.2 bits; conditional E-value: 2.1e-15 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 e+a++ + + + +++sG + v+++ ++++++tf+ ++G+ +++++Y+ng+++++ +v vnG++++ +++ ++ ++ QGI99241.1|CBM35|GH43_24 343 GETATMANDARVISCSECSGGKAVGYIGgDKKGTLTFKNIKSSGGTATINVKYRNGDTGSRYATVNVNGESQKLAFLSTS-HLSQ 426 57788888666666778888888888874677889**9666799***************************886666666.5666 PP CBM35.hmm 87 wgtaagtvtLkaGk.ntitiksdwGwi.nldsl 117 g + g + Lk+G+ ntiti++d Gw ++d+l QGI99241.1|CBM35|GH43_24 427 TGLSRGFFDLKEGSdNTITISNDDGWGpDVDAL 459 6************659**********7788876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (464 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 185.87 // Query: BCS01711.1|CBM35|GH43_24 [L=449] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-12 33.0 0.4 6.2e-12 33.0 0.4 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.3 0.21 0.42 62 81 .. 230 249 .. 219 280 .. 0.55 2 ! 33.0 0.4 3.1e-12 6.2e-12 3 107 .. 326 432 .. 324 446 .. 0.79 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.21 CBM35.hmm 62 ktlsvvvnGtkvsevtfpst 81 t+s +nGt ++ +f + BCS01711.1|CBM35|GH43_24 230 YTTSTDLNGTWSDWSNFATA 249 33344444444443333333 PP == domain 2 score: 33.0 bits; conditional E-value: 3.1e-12 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwd 85 A ++ l++ + + +g+sG+ v+ + +++++++++ + ++++ + ++++rY ng+++++ ++v+vnG+++ +++ps n + BCS01711.1|CBM35|GH43_24 326 ASTNVLSNGAKVISCSGCSGDESVGWIGgSDNGTLEMRnISSDASTTTTIQVRYENGDSTQRYTTVTVNGKSQILAFLPSD-NGN 409 5666666655555678899988887776456667888779**********************************9999998.889 PP CBM35.hmm 86 twgtaagtvtLkaGk.ntitiks 107 t +t++ +++L+ G+ n it+++ BCS01711.1|CBM35|GH43_24 410 TPATSVLNAQLESGDdNIITFSA 432 999***********736677776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (449 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.58 // Query: CZS86037.1|CBM35|GH43_24 [L=447] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-18 52.5 1.7 7.6e-18 52.1 0.3 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.2 0.1 0.52 1 64 94 .. 270 300 .. 254 303 .. 0.52 2 ! 52.1 0.3 3.8e-18 7.6e-18 3 117 .. 327 442 .. 325 443 .. 0.78 Alignments for each domain: == domain 1 score: -3.2 bits; conditional E-value: 0.52 CBM35.hmm 64 lsvvvnGtkvsevtfpstgnwdtwgtaagtv 94 + +++ + vs+ st w +++ ++v CZS86037.1|CBM35|GH43_24 270 NAIYIGDRWVSTNLAASTYVWLPLKVEGTKV 300 3455555555555555555555555555555 PP == domain 2 score: 52.1 bits; conditional E-value: 3.8e-18 CBM35.hmm 3 Aedasltg...vsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 e+a + + v + ++sGs+ v+++ ++++++tf+ ++G +++++Y+ng+++++ +v+vnG++++ +++ + CZS86037.1|CBM35|GH43_24 327 GENAVMANdarVISC---NECSGSKAVGYIGgDKKGTLTFKSVKSSGGLSTINIKYRNGDTGSRYATVSVNGKSQKLAFLSTR-H 407 567777774334444...4556666666555368889****666799***************************886666555.6 PP CBM35.hmm 84 wdtwgtaagtvtLkaGkntitiksdwGwi.nldsl 117 ++ g + g + L++G+ntiti+++ Gw ++d+l CZS86037.1|CBM35|GH43_24 408 LSQTGLSRGFFDLEEGDNTITISNNDGWGpDVDAL 442 6666***********************97788765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (447 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.86 // Query: CCD49133.2|CBM35|GH43_24 [L=450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-14 40.4 1.1 7.9e-14 39.1 1.1 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.1 1.1 3.9e-14 7.9e-14 2 119 .] 325 447 .. 323 447 .. 0.91 Alignments for each domain: == domain 1 score: 39.1 bits; conditional E-value: 3.9e-14 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq..aagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 eA +++l + +++ + +g+sG v+++ ++g+++t+n v + a + ++++++ ng++ ++ +vvvnG ++ +++p+ + CCD49133.2|CBM35|GH43_24 325 EASTNTLANGAITLTCSGCSGGVQVGYIGgpSPGGTLTMNgVSSSVATTTSIRIHHTNGDSVQRYANVVVNGVSNILAFLPTA-D 408 6777888888899999*****999999985578999**************************************999999988.7 PP CBM35.hmm 84 wdtwgtaagtvtLkaGk.ntitiks.dwGwi.nldslel 119 +t gt++ t Lk G+ n i+++s ++Gw n+d++++ CCD49133.2|CBM35|GH43_24 409 GNTPGTSVLTTALKSGTtNVIQFQSyNSGWApNIDRIMV 447 8888************6499**********99****986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (450 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 168.78 // Query: BAG80558.1|CBM35|GH43_24|3.2.1.145 [L=449] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-14 39.5 0.8 5.8e-14 39.5 0.8 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.2 0.1 0.51 1 64 94 .. 271 301 .. 255 304 .. 0.52 2 ! 39.5 0.8 2.9e-14 5.8e-14 4 117 .. 329 444 .. 326 445 .. 0.81 Alignments for each domain: == domain 1 score: -3.2 bits; conditional E-value: 0.51 CBM35.hmm 64 lsvvvnGtkvsevtfpstgnwdtwgtaagtv 94 + +++ + vs+ st w +++ ++v BAG80558.1|CBM35|GH43_24|3.2.1.145 271 NAIYIGDRWVSTNLAASTYVWLPLKVDGTKV 301 3455555555555555555555555555555 PP == domain 2 score: 39.5 bits; conditional E-value: 2.9e-14 CBM35.hmm 4 edasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevt 77 e+a++ + + + +++sG + v+++ ++++++tf+ ++G+ +++++Y+ng+ +++ +v vnG++++ ++ BAG80558.1|CBM35|GH43_24|3.2.1.145 329 ETATMGNDARIISCSECSGGQAVGYIGgDKKGTLTFKNIKSSGGTATINVKYRNGDNGSRYATVNVNGESQKLAF 403 5666666444555678889888988874677889**9666799***************************88666 PP CBM35.hmm 78 fpstgnwdtwgtaagtvtLkaGk.ntitiksdwGwi.nldsl 117 + ++ ++ g + g + Lk+G+ ntiti++ Gw ++d+l BAG80558.1|CBM35|GH43_24|3.2.1.145 404 LSTS-HLSQTGLSRGFFDLKEGSdNTITISNGDGWGpDVDAL 444 6666.56666************659******99997688876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (449 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 148.27 // Query: QKD61909.1|CBM35|GH43_24 [L=448] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-14 40.3 0.6 3.5e-14 40.3 0.6 1.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.3 0.0 0.55 1.1 65 93 .. 271 299 .. 255 303 .. 0.51 2 ! 40.3 0.6 1.7e-14 3.5e-14 4 117 .. 328 443 .. 325 444 .. 0.81 Alignments for each domain: == domain 1 score: -3.3 bits; conditional E-value: 0.55 CBM35.hmm 65 svvvnGtkvsevtfpstgnwdtwgtaagt 93 +++ + vs+ st w +++ ++ QKD61909.1|CBM35|GH43_24 271 AIYIGDRWVSTNLAASTYVWLPLKVDGTK 299 44555555555555555555444444444 PP == domain 2 score: 40.3 bits; conditional E-value: 1.7e-14 CBM35.hmm 4 edasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw 87 e+a++ + + + +++sG + v+++ ++++++tf+ ++G+ +++++Y+ng+++++ +v vnG++++ +++ ++ ++ QKD61909.1|CBM35|GH43_24 328 ETATMGNDARVISCSECSGGQAVGYIGgDKKGTLTFKNIKSSGGTATINVKYRNGDTGSRYATVNVNGESQKLAFLSTS-HLSQT 411 6777777555566778888888888874677889**9666799***************************886666666.56666 PP CBM35.hmm 88 gtaagtvtLkaGk.ntitiksdwGwi.nldsl 117 g + g + Lk+G+ n iti++d Gw ++d+l QKD61909.1|CBM35|GH43_24 412 GLSRGFFDLKEGSdNIITISNDDGWGpDVDAL 443 ************648899*******7788876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (448 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 166.72 // Query: CAP62345.1|CBM35|GH43_24 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.4e-12 32.4 0.0 1.9e-11 31.4 0.0 1.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.4 0.0 9.7e-12 1.9e-11 1 119 [] 328 449 .. 328 449 .. 0.89 Alignments for each domain: == domain 1 score: 31.4 bits; conditional E-value: 9.7e-12 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqa.agdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 ye e+a g + n + + +sG+ +++ + + ++vtfn + ++ +G ++++++ ng++s + +v vnG+ ++ f + CAP62345.1|CBM35|GH43_24 328 YEGEKAVYGGKARNVDCSTCSGKVTAGYIGGpDRGSVTFNnIRSDIDGLTTIRIKFLNGDSSPRYANVRVNGDGGRKIAFLPAKG 412 899*******999**********9999998515689****9*********************************99888766654 PP CBM35.hmm 84 wdtwgtaagtvtLkaGk.ntitiks.dwGwi.nldslel 119 ++++ ++L+ G+ nti i+ +Gw ++d+l++ CAP62345.1|CBM35|GH43_24 413 DP--ASSTLHANLRRGSsNTIVIEGfGNGWGpDVDRLMV 449 44..48**********559*****999999879999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 186.14 // Query: CDP31625.1|CBM35|GH43_24 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.4e-12 32.4 0.0 1.9e-11 31.4 0.0 1.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.4 0.0 9.7e-12 1.9e-11 1 119 [] 328 449 .. 328 449 .. 0.89 Alignments for each domain: == domain 1 score: 31.4 bits; conditional E-value: 9.7e-12 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqa.agdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 ye e+a g + n + + +sG+ +++ + + ++vtfn + ++ +G ++++++ ng++s + +v vnG+ ++ f + CDP31625.1|CBM35|GH43_24 328 YEGEKAVYGGKARNVDCSTCSGKVTAGYIGGpDRGSVTFNnIRSDIDGLTTIRIKFLNGDSSPRYANVRVNGDGGRKIAFLPAKG 412 899*******999**********9999998515689****9*********************************99888766654 PP CBM35.hmm 84 wdtwgtaagtvtLkaGk.ntitiks.dwGwi.nldslel 119 ++++ ++L+ G+ nti i+ +Gw ++d+l++ CDP31625.1|CBM35|GH43_24 413 DP--ASSTLHANLRRGSsNTIVIEGfGNGWGpDVDRLMV 449 44..48**********559*****999999879999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 170.94 // Query: QRC93152.1|CBM35|GH43_24 [L=445] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-16 47.4 0.6 5.3e-16 46.1 0.6 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.1 0.6 2.6e-16 5.3e-16 2 119 .] 324 442 .. 323 442 .. 0.81 Alignments for each domain: == domain 1 score: 46.1 bits; conditional E-value: 2.6e-16 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagda.vtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnw 84 e e+++l++ + ++ + +sG v+++ ++g+a v nv++ ++ + +l++++ ng+ ++++ +v+vnG+ + +++p g QRC93152.1|CBM35|GH43_24 324 EGESGTLSNGAKVQSCSSCSGGNAVGYIGgSTGGAvVLANVQSASSTRTTLRIKHLNGDNGQRVADVSVNGKTQRVAFLPHGG-- 406 5699999996666667777777777777633444526666***********************************99999995.. PP CBM35.hmm 85 dtwgtaagtvtLkaGkntitiks..dwGwinldslel 119 ++ gt+++ + Lk+G+n ++i++ +wG ++d++++ QRC93152.1|CBM35|GH43_24 407 GDPGTSVVHADLKQGNNEVKISMqgSWG-PDVDRIMV 442 44469******************55554.37888765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (445 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 168.14 // Query: BCS17391.1|CBM35|GH43_24 [L=360] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-10 28.6 0.1 4e-10 27.2 0.0 1.7 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.1 0.31 0.62 14 49 .. 97 132 .. 92 154 .. 0.60 2 ! 27.2 0.0 2e-10 4e-10 24 110 .. 256 346 .. 239 358 .. 0.80 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.31 CBM35.hmm 14 ntnhagysGsgfvdglqaagdavtfnvdvpkaGsYe 49 n++ a y + ++d+ + ++++v ++ + +G+Ye BCS17391.1|CBM35|GH43_24 97 NEQMATYVMYVHIDNEDYTDARVGVATCKTVTGTYE 132 444455555555555555555555555555555555 PP == domain 2 score: 27.2 bits; conditional E-value: 2e-10 CBM35.hmm 24 gfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst...gnwdtwgtaagtvtLkaGkntiti 105 g v q+ ++ +++ + +aG +l++rY+n +++++++ v vnG+++ ++p+ + ++ g+++ L G+n++ i BCS17391.1|CBM35|GH43_24 256 GTVAPSQGREKDFSCHLRSSTAGLTTLRIRYRNPSAKSQQVAVEVNGKRQTVDFLPTGarkQGVQEEGESVLHCALVSGDNSVVI 340 67777788888899999********************************9866666652114455558899999*********** PP CBM35.hmm 106 ks.dwG 110 ++ ++G BCS17391.1|CBM35|GH43_24 341 QDaKTG 346 996444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (360 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 120.23 // Query: CCT61079.1|CBM35|GH43_24 [L=446] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-17 51.0 0.2 5.7e-17 49.2 0.2 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.2 0.2 2.9e-17 5.7e-17 1 119 [] 323 443 .. 323 443 .. 0.89 Alignments for each domain: == domain 1 score: 49.2 bits; conditional E-value: 2.9e-17 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 ye e a+l+ + + +g+sG+ +++ ++++av f+ v++ +a + +++++++ng++s++ +v+vnG+++ +++p+ g CCT61079.1|CBM35|GH43_24 323 YEGEAATLSDGARSISCSGCSGTNAAGYIGgSTNGAVVFSdVQSSAATRTTIRIKHMNGDSSQRFANVSVNGKSQRIAFLPNGG- 406 89999999997777778888888777777645677888888***********************************99999995. PP CBM35.hmm 84 wdtwgtaagtvtLkaGkntitiks.dwGwi.nldslel 119 ++ gt+++ + Lk+G+n ++i+ ++Gw ++d+l++ CCT61079.1|CBM35|GH43_24 407 -SEPGTSVVHADLKQGANEVKISGfNNGWGpDVDRLMV 443 .66679*****************99****889999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (446 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 176.08 // Query: QDS74835.1|CBM35|GH43_24 [L=528] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-15 43.5 0.0 4.8e-14 39.8 0.0 2.3 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.7 0.2 0.032 0.065 42 76 .. 186 220 .. 182 235 .. 0.86 2 ! 39.8 0.0 2.4e-14 4.8e-14 1 118 [. 403 525 .. 403 526 .. 0.90 Alignments for each domain: == domain 1 score: 0.7 bits; conditional E-value: 0.032 CBM35.hmm 42 vpkaGsYelslrYangtgstktlsvvvnGtkvsev 76 +++ +Y l ++ n+t++++++ v v +t +++ QDS74835.1|CBM35|GH43_24 186 NKSTKKYVLYMHVENSTYKEAKMGVAVGDTVCGQY 220 57889999*****************9999988766 PP == domain 2 score: 39.8 bits; conditional E-value: 2.4e-14 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagda.vtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 yeAe+a+l+g + n +g+sG + ++l ++g+ vtf+ v ++ a++ ++++ ng+ +++ v+vnG+++ + f ++ QDS74835.1|CBM35|GH43_24 403 YEAENATLSGGARILNCTGCSGGKLAGYLGGPGKGcVTFEnVLSDRAERKSVRIFAPNGDRTQRFAMVTVNGGQAVRIAFLPSAM 487 9*********889999**************998877***99*********************************99998888877 PP CBM35.hmm 84 wdtwgtaagtvtLkaGkntitiks....dwGwi.nldsle 118 ++++ + +aG+nt++i+s +w +ld+l+ QDS74835.1|CBM35|GH43_24 488 GAVPAVSVAHLDFNAGANTVRIDSmgdgSW--GpDLDRLM 525 77779*******************974444..34777776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (528 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 2 (1); expected 0.0 (0.02) Passed bias filter: 2 (1); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.88 // Query: CCA72743.1|CBM35|GH43_24 [L=366] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-16 47.5 1.2 2e-16 47.5 1.2 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.1 0.08 0.16 84 99 .. 139 155 .. 117 196 .. 0.54 2 ! 47.5 1.2 1e-16 2e-16 1 118 [. 239 362 .. 239 363 .. 0.87 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.08 CBM35.hmm 84 wdtw.gtaagtvtLkaG 99 wdt ++++++ +L+ G CCA72743.1|CBM35|GH43_24 139 WDTNdNKYTTSTSLTGG 155 44433333333333333 PP == domain 2 score: 47.5 bits; conditional E-value: 1e-16 CBM35.hmm 1 yeAedasltg...vsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst 81 ye e as++g + ++ +g s+ g+++ +++g++++++ v ++++ +l+++++ng+++++ v+vnG+++ +++pst CCA72743.1|CBM35|GH43_24 239 YEGEAASMSGgakSVSCSGCSGSSAAGYIGATSGSGGTIRWSsVSSTASTLTTLRFKHQNGDAKQRFAVVTVNGQSQTVAFLPST 323 899999*99977656677778888899999999*********9****************************************99 PP CBM35.hmm 82 gnwdtwgtaagtvtLkaGk.ntitiks.dwGwi.nldsle 118 + +t +++a+tv+L+ G+ n it++ +Gw ++d+++ CCA72743.1|CBM35|GH43_24 324 -DGNTPASSAVTVSLNSGSsNVITVSGtGSGWGpDIDRVM 362 .677779***********7366777668888876888765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (366 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 146.23 // Query: BCS19911.1|CBM35|GH43_24 [L=457] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-16 46.7 1.3 3.5e-16 46.7 1.3 1.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.62 1.2 42 66 .. 109 133 .. 107 143 .. 0.72 2 ! 46.7 1.3 1.7e-16 3.5e-16 1 117 [. 326 453 .. 326 455 .. 0.80 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.62 CBM35.hmm 42 vpkaGsYelslrYangtgstktlsv 66 +++G+Y + l+ +++++++ + v BCS19911.1|CBM35|GH43_24 109 NDDTGKYVMWLHIDSSDYQDARVGV 133 5678999998888887777766655 PP == domain 2 score: 46.7 bits; conditional E-value: 1.7e-16 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagda.........vtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsev 76 ye ed++l+g + + + +++sG +++ +++d+ ++ ++ ++++ +l++rY ng+++ + v+vnG++++++ BCS19911.1|CBM35|GH43_24 326 YEGEDGELSGGARTIDCSQCSGGVAAGYIGGDSDSdnngvvvldADVDTQSGESERVTLNIRYLNGNTNPRYAAVSVNGGEAQTA 410 899*******6666677777776666666666666667886533344444556677899*************************9 PP CBM35.hmm 77 tfpst.gnwdtwgtaagtvtLkaGkntitiksdwGwi.nldsl 117 f st dt g++a+ v+Lk G+nt++i+ Gw ++d+l BCS19911.1|CBM35|GH43_24 411 AFISTaHHSDTAGSSAVHVKLKSGANTVQISGTGGWGpDIDEL 453 999995666777********************99997788876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (457 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 155.31 // Query: AEO68051.1|CBM35|GH43_24 [L=463] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-12 35.3 1.6 1.2e-11 32.0 0.3 2.7 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.3 0.0 0.021 0.042 42 77 .. 111 146 .. 107 163 .. 0.85 2 ! 32.0 0.3 6.2e-12 1.2e-11 15 118 .. 356 459 .. 342 460 .. 0.84 Alignments for each domain: == domain 1 score: 1.3 bits; conditional E-value: 0.021 CBM35.hmm 42 vpkaGsYelslrYangtgstktlsvvvnGtkvsevt 77 +k+G+Y + ++ +++++++++ v v +t + ++ AEO68051.1|CBM35|GH43_24 111 NDKTGKYVMWMHVDSSDYGEAKVGVAVGDTVCGAYK 146 5799********99999*****99999999887665 PP == domain 2 score: 32.0 bits; conditional E-value: 6.2e-12 CBM35.hmm 15 tnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLka 98 + ag s+ g+ +g +a+++v+++ v ++++ +++lrYang+++ + v vnG+++ +v f+ t+ ++++t+++ v+L+ AEO68051.1|CBM35|GH43_24 356 SACAGGSAAGYLGG--SADGQVRVAgVRSDADVVSTVQLRYANGDSTPRYAGVAVNGGQKIKVAFEPTA--GKVATSVVHVPLRS 436 44555566666654..5788899999***************************************9994..44557********* PP CBM35.hmm 99 Gk.ntitiks.dwGwi.nldsle 118 G+ n i i+ d Gw ++d+l AEO68051.1|CBM35|GH43_24 437 GSgNEIVIGGvDGGWApDVDWLV 459 *8799****99****999**985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (463 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 173.48 // Query: EAA61364.1|CBM35|GH43_24 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-15 44.6 0.8 3.4e-15 43.5 0.8 1.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.5 0.8 1.7e-15 3.4e-15 1 117 [. 343 471 .. 343 473 .. 0.80 Alignments for each domain: == domain 1 score: 43.5 bits; conditional E-value: 1.7e-15 CBM35.hmm 1 yeAedasltg...vsvntnhagysGsgfvdglq..aagdavtfnvdv....pkaGsYelslrYangtgstktlsvvvnGtkvsev 76 ye ed+ l+g + ++ +g ++ g+++g ++++avt++vd +++ + +l+++Y ng+++ + v+vnG++++++ EAA61364.1|CBM35|GH43_24 343 YEGEDGALSGgarLIDCSRCSGSTAAGYIGGAGdgENDGAVTLQVDYatqsTDSARITLNIHYLNGDTDPRYAAVSVNGGEAQTI 427 89999999997776667778888888888877633444556666654111166677899999*********************** PP CBM35.hmm 77 tfpstgnwdtwgtaagtvtLkaGkntitiks..dwGwi.nldsl 117 f st++ + g++a+ v L +G nt++i+ Gw ++d++ EAA61364.1|CBM35|GH43_24 428 AFLSTNQLSGSGSSAVHVDLVQGVNTVQISGveGGGWGpDIDQV 471 *********99******************998777776677766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 188.83 // Query: 550910|NeFL0031_2_GeneCatalog_proteins_20191109.aa.fasta|GH43_24|GH43_24|CBM35 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-17 50.8 0.7 1.9e-17 50.8 0.7 1.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.8 0.1 0.38 0.76 37 56 .. 38 57 .. 23 85 .. 0.54 2 ! 50.8 0.7 9.4e-18 1.9e-17 2 119 .] 328 448 .. 327 448 .. 0.89 Alignments for each domain: == domain 1 score: -2.8 bits; conditional E-value: 0.38 CBM35.hmm 37 tfnvdvpkaGsYelslrYan 56 +v++ aG ++ +Y 550910|NeFL0031_2_GeneCatalog_proteins_20191109.aa.fasta|GH43_24|GH43_24|CBM35 38 GTHVQAHGAGIIKVGSTYYM 57 44555555555544444443 PP == domain 2 score: 50.8 bits; conditional E-value: 9.4e-18 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn. 39 eAe a++ + + + + +g+sGs+ v+++ ++g++vtf+ 550910|NeFL0031_2_GeneCatalog_proteins_20191109.aa.fasta|GH43_24|GH43_24|CBM35 328 EAEAATIANGAKTLSCSGCSGSTSVGYIGgSSGGSVTFSs 367 8********999999************98678999****9 PP CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfp 79 v +++a + +++++Y ng+++++ +v+vnG++++ +++p 550910|NeFL0031_2_GeneCatalog_proteins_20191109.aa.fasta|GH43_24|GH43_24|CBM35 368 VSSNAATKSSIRIKYLNGDSTQRFATVTVNGASQKIAFLP 407 ***********************************99999 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiksdwGwi..nlds 116 + g +t g+++ +v Lk G+ nt+ i+ G ++d+ 550910|NeFL0031_2_GeneCatalog_proteins_20191109.aa.fasta|GH43_24|GH43_24|CBM35 408 TAG--GTPGSSVLNVDLKSGAtNTVVITTTDGTWgpDIDR 445 995..6778***********65999999955544368888 PP CBM35.hmm 117 lel 119 +++ 550910|NeFL0031_2_GeneCatalog_proteins_20191109.aa.fasta|GH43_24|GH43_24|CBM35 446 IMV 448 875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.79 // Query: 587920|Xylcur114988_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_24|GH43_24|CBM35 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-18 51.9 0.5 2.2e-17 50.6 0.5 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 50.6 0.5 1.1e-17 2.2e-17 2 119 .] 328 448 .. 327 448 .. 0.89 Alignments for each domain: == domain 1 score: 50.6 bits; conditional E-value: 1.1e-17 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn. 39 eAe+as ++ + + +g+sG + v+++ ++g++vtf+ 587920|Xylcur114988_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_24|GH43_24|CBM35 328 EAESASFSNGAKVLSCSGCSGGSSVGYIGgSSGGSVTFSs 367 8********8888889***********98678999***** PP CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfp 79 v++++a + +++++Y ng+++++ +v+vnG++++ +++p 587920|Xylcur114988_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_24|GH43_24|CBM35 368 VNSNAATKTSVRIKYLNGDSTQRFATVTVNGASQKIAFLP 407 **************************************** PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiksdwGwi..nlds 116 + + +t g+++ +v Lk G+ nt++i+ G ++d+ 587920|Xylcur114988_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_24|GH43_24|CBM35 408 TVA--GTPGSSVLNVDLKSGSsNTVSIGTTDGSWgpDVDR 445 995..6778***********559******44443357888 PP CBM35.hmm 117 lel 119 +++ 587920|Xylcur114988_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_24|GH43_24|CBM35 446 IMV 448 865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 171.32 // Query: 349410|Xylgra1_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-18 51.9 1.0 2.1e-17 50.7 1.0 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 50.7 1.0 1e-17 2.1e-17 2 119 .] 328 448 .. 327 448 .. 0.92 Alignments for each domain: == domain 1 score: 50.7 bits; conditional E-value: 1e-17 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn. 39 eAe a++ + + + + +g+sG + v+++ ++g++vtf+ 349410|Xylgra1_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 328 EAEAATIANGAKTLSCSGCSGGTSVGYIGgSTGGSVTFSg 367 8********999999************99678999***** PP CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfp 79 v + +a + +++++Y ng+++++ +v+vnG++++ +++p 349410|Xylgra1_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 368 VSSSAATKSSIRIKYLNGDSTQRFATVTVNGASQKVAFLP 407 **************************************** PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiksdwGwi..nlds 116 + g +t g+++ +v Lk G+ nt+ i+ G + ++d+ 349410|Xylgra1_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 408 TAG--GTPGSSVLNVDLKSGAtNTVVITTTDGTYgpDIDR 445 995..6777***********659******88988788999 PP CBM35.hmm 117 lel 119 +++ 349410|Xylgra1_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 446 IMV 448 876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 179.42 // Query: 198669|Xylscr1_GeneCatalog_proteins_20190612.aa.fasta|GH43_24|GH43_24|CBM35 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-17 49.7 0.4 4.1e-17 49.7 0.4 1.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.1 0.34 0.68 29 55 .. 30 56 .. 17 79 .. 0.66 2 ! 49.7 0.4 2e-17 4.1e-17 2 119 .] 328 448 .. 327 448 .. 0.90 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.34 CBM35.hmm 29 lqaagdavtfnvdvpkaGsYelslrYa 55 +++ ++ +v++ aG ++ +Y 198669|Xylscr1_GeneCatalog_proteins_20190612.aa.fasta|GH43_24|GH43_24|CBM35 30 ATWTATNTGAHVQAHGAGAIKVGSTYY 56 455555566667777666666666654 PP == domain 2 score: 49.7 bits; conditional E-value: 2e-17 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn. 39 eAe a+ + + + + +g+sG + v+++ ++g++vtf+ 198669|Xylscr1_GeneCatalog_proteins_20190612.aa.fasta|GH43_24|GH43_24|CBM35 328 EAEAATFANGAKTLSCSGCSGGSSVGYIGgSSGGSVTFSg 367 89******99899999***********99678999***** PP CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfp 79 v +++a + +++++Y ng++s++ +v+vnG++++ +++p 198669|Xylscr1_GeneCatalog_proteins_20190612.aa.fasta|GH43_24|GH43_24|CBM35 368 VSSNAATKSSIRIKYLNGDSSQRFATVTVNGASQKLAFLP 407 **************************************** PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiksdwGwi..nlds 116 + g +t g+++ +v Lk G+ nt++i+ G ++d+ 198669|Xylscr1_GeneCatalog_proteins_20190612.aa.fasta|GH43_24|GH43_24|CBM35 408 TAG--GTPGSSVLNVDLKSGTtNTVSISTTDGTWgpDIDR 445 995..6777***********559******55544368888 PP CBM35.hmm 117 lel 119 +++ 198669|Xylscr1_GeneCatalog_proteins_20190612.aa.fasta|GH43_24|GH43_24|CBM35 446 IMV 448 875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 140.53 // Query: 116695|Xyltel121673_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_24|GH43_24|CBM35 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-15 42.9 0.4 5.4e-15 42.9 0.4 1.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.8 0.1 0.39 0.79 30 55 .. 31 56 .. 20 70 .. 0.64 2 ! 42.9 0.4 2.7e-15 5.4e-15 2 119 .] 328 448 .. 327 448 .. 0.88 Alignments for each domain: == domain 1 score: -2.8 bits; conditional E-value: 0.39 CBM35.hmm 30 qaagdavtfnvdvpkaGsYelslrYa 55 +++ ++ +v++ aG ++ +Y 116695|Xyltel121673_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_24|GH43_24|CBM35 31 TWTATNTGTHVQAHGAGAIKVGSTYY 56 45555566667777666666666654 PP == domain 2 score: 42.9 bits; conditional E-value: 2.7e-15 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn. 39 eAe+a++ + + + + + +sG + v+++ ++g++v f+ 116695|Xyltel121673_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_24|GH43_24|CBM35 328 EAESATIANGARTLSCSACSGGTSVGYIGgSSGGSVAFAg 367 8********88888889999999999988578999***** PP CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfp 79 v + +a + +++++Y ng+++++ +v+vnG++++ +++p 116695|Xyltel121673_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_24|GH43_24|CBM35 368 VSSGAATRSSVRIKYVNGDSTQRFATVTVNGASQKIAFLP 407 ***********************************99999 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiksdwGwi..nlds 116 + g +t g++ +v Lk G+ nt+ i+ G ++d+ 116695|Xyltel121673_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_24|GH43_24|CBM35 408 TAG--GTPGSSILNVDLKSGAaNTVVITTTDGTWgpDVDR 445 995..6777***********54999999955544368888 PP CBM35.hmm 117 lel 119 +++ 116695|Xyltel121673_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_24|GH43_24|CBM35 446 IMV 448 865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.62 // Query: 484447|XylFL1651_GeneCatalog_proteins_20190321.aa.fasta|GH43_24|GH43_24|CBM35 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-16 47.2 0.4 7.7e-16 45.6 0.4 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 45.6 0.4 3.9e-16 7.7e-16 2 118 .. 328 447 .. 327 448 .. 0.89 Alignments for each domain: == domain 1 score: 45.6 bits; conditional E-value: 3.9e-16 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn. 39 eAe a++ + + + + +g+sG + v+++ ++g++vtf+ 484447|XylFL1651_GeneCatalog_proteins_20190321.aa.fasta|GH43_24|GH43_24|CBM35 328 EAEAATIANGAKTLSCSGCSGGTSVGYIGgSSGGSVTFSg 367 8********999999************99678999***** PP CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfp 79 v + +a + +++++Y ng++s++ +v+vnG+ ++ +++p 484447|XylFL1651_GeneCatalog_proteins_20190321.aa.fasta|GH43_24|GH43_24|CBM35 368 VSSSAATRTTVRIKYLNGDSSQRFATVSVNGAGQKIAFLP 407 ***********************************99999 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiksdwGwi..nlds 116 + + +t g++ +v Lk G+ nt+ i+ G ++d+ 484447|XylFL1651_GeneCatalog_proteins_20190321.aa.fasta|GH43_24|GH43_24|CBM35 408 TDS--GTPGSSSLNVDLKSGAvNTVVITTTDGTWgpDIDR 445 985..6668***********879****9955543357887 PP CBM35.hmm 117 le 118 l+ 484447|XylFL1651_GeneCatalog_proteins_20190321.aa.fasta|GH43_24|GH43_24|CBM35 446 LM 447 76 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 174.83 // Query: 447349|Xylcub1_GeneCatalog_proteins_20181030.aa.fasta|GH43_24|GH43_24|CBM35 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-17 51.1 0.3 4.2e-17 49.7 0.3 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.7 0.3 2.1e-17 4.2e-17 2 119 .] 328 448 .. 327 448 .. 0.90 Alignments for each domain: == domain 1 score: 49.7 bits; conditional E-value: 2.1e-17 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn. 39 eAe a+ + + + + +g+sG + v+++ ++g++vtf+ 447349|Xylcub1_GeneCatalog_proteins_20181030.aa.fasta|GH43_24|GH43_24|CBM35 328 EAEAATFANGAKTLSCSGCSGGSSVGYIGgSSGGSVTFSg 367 89******99899999***********99678999***** PP CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfp 79 v + +a + +++++Y ng++s++ +v+vnG++++ +++p 447349|Xylcub1_GeneCatalog_proteins_20181030.aa.fasta|GH43_24|GH43_24|CBM35 368 VSSSAATKSSIRIKYLNGDSSQRFATVTVNGASQKLAFLP 407 **************************************** PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaG.kntitiksdwGwi..nlds 116 + g +t g+++ +v Lk G +nt++i+ G ++d+ 447349|Xylcub1_GeneCatalog_proteins_20181030.aa.fasta|GH43_24|GH43_24|CBM35 408 TAG--GTPGSSVLNVDLKSGtANTVSISTTDGTWgpDIDR 445 995..6777***********559******55544368888 PP CBM35.hmm 117 lel 119 +++ 447349|Xylcub1_GeneCatalog_proteins_20181030.aa.fasta|GH43_24|GH43_24|CBM35 446 IMV 448 875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 178.15 // Query: 277723|Xyldig1_GeneCatalog_proteins_20190718.aa.fasta|GH43_24|GH43_24|CBM35 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-17 49.2 1.3 1.6e-16 47.8 1.3 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.8 1.3 8.1e-17 1.6e-16 2 119 .] 328 448 .. 327 448 .. 0.92 Alignments for each domain: == domain 1 score: 47.8 bits; conditional E-value: 8.1e-17 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn. 39 eAe a++ + + + + +g+sG + v+++ ++g++vtf+ 277723|Xyldig1_GeneCatalog_proteins_20190718.aa.fasta|GH43_24|GH43_24|CBM35 328 EAEAATVANGARTLSCSGCSGGTSVGYIGgSTGGSVTFSg 367 89*******9999999***********98678999***** PP CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfp 79 v +++a + +++++Y ng+++++ +v+vnG++++ +++p 277723|Xyldig1_GeneCatalog_proteins_20190718.aa.fasta|GH43_24|GH43_24|CBM35 368 VSSNAATKTSVRIKYLNGDSTQRFATVTVNGASQKIAFLP 407 ***********************************99999 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiksdwGwi..nlds 116 + g +t g+++ +v Lk G+ nt+ i+ G + ++d+ 277723|Xyldig1_GeneCatalog_proteins_20190718.aa.fasta|GH43_24|GH43_24|CBM35 408 TAG--GTPGSSVLNVDLKSGAtNTVVITTTDGTYgpDIDR 445 995..6778***********659******88988788999 PP CBM35.hmm 117 lel 119 +++ 277723|Xyldig1_GeneCatalog_proteins_20190718.aa.fasta|GH43_24|GH43_24|CBM35 446 IMV 448 876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 171.40 // Query: 167718|Xylcube1_GeneCatalog_proteins_20190615.aa.fasta|GH43_24|GH43_24|CBM35 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-17 51.3 0.2 3.8e-17 49.8 0.2 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.8 0.2 1.9e-17 3.8e-17 2 119 .] 328 448 .. 327 448 .. 0.90 Alignments for each domain: == domain 1 score: 49.8 bits; conditional E-value: 1.9e-17 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn. 39 eAe a+ + + + + +g+sG + v+++ ++g++vtf+ 167718|Xylcube1_GeneCatalog_proteins_20190615.aa.fasta|GH43_24|GH43_24|CBM35 328 EAEAATFANGAKTLSCSGCSGGSSVGYIGgSSGGSVTFSg 367 89******99899999***********99678999***** PP CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfp 79 v + +a + +++++Y ng++s++ +v+vnG++++ +++p 167718|Xylcube1_GeneCatalog_proteins_20190615.aa.fasta|GH43_24|GH43_24|CBM35 368 VSSSAATKSSIRIKYLNGDSSQRFATVTVNGASQKLAFLP 407 **************************************** PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiksdwGwi..nlds 116 + g +t g+++ +v Lk G+ nt++i+ G ++d+ 167718|Xylcube1_GeneCatalog_proteins_20190615.aa.fasta|GH43_24|GH43_24|CBM35 408 TAG--GTPGSSVLNVDLKSGAaNTVSISTTDGTWgpDIDR 445 995..6777***********559******55544368888 PP CBM35.hmm 117 lel 119 +++ 167718|Xylcube1_GeneCatalog_proteins_20190615.aa.fasta|GH43_24|GH43_24|CBM35 446 IMV 448 875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 168.61 // Query: 532072|XyAK1471_1_GeneCatalog_proteins_20191118.aa.fasta|GH43_24|GH43_24|CBM35 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-15 44.7 0.7 1.5e-15 44.7 0.7 1.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.6 0.0 0.7 1.4 33 54 .. 34 55 .. 25 70 .. 0.62 2 ! 44.7 0.7 7.4e-16 1.5e-15 2 119 .] 328 448 .. 327 448 .. 0.88 Alignments for each domain: == domain 1 score: -3.6 bits; conditional E-value: 0.7 CBM35.hmm 33 gdavtfnvdvpkaGsYelslrY 54 ++ +v++ aG ++ +Y 532072|XyAK1471_1_GeneCatalog_proteins_20191118.aa.fasta|GH43_24|GH43_24|CBM35 34 ATNTGAHVQAHGAGVIKVGSTY 55 4445556666666666665555 PP == domain 2 score: 44.7 bits; conditional E-value: 7.4e-16 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn. 39 eAe a+ + + + + +g+sGs+ v+++ +++++vtf+ 532072|XyAK1471_1_GeneCatalog_proteins_20191118.aa.fasta|GH43_24|GH43_24|CBM35 328 EAEAATFANGAKTLSCSGCSGSTSVGYIGgSTSGSVTFSg 367 89*****998899999***********99567789***** PP CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfp 79 v + +a + +++++Y ng++s++ +v++nG++++ +++p 532072|XyAK1471_1_GeneCatalog_proteins_20191118.aa.fasta|GH43_24|GH43_24|CBM35 368 VSSGAATRTSIRIKYLNGDSSQRFATVSINGASQKVAFLP 407 ***********************************99999 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiksdwGwi..nlds 116 + + +t g+++ ++ Lk G+ nt+ i+ G ++d+ 532072|XyAK1471_1_GeneCatalog_proteins_20191118.aa.fasta|GH43_24|GH43_24|CBM35 408 TEN--GTPGSSTLNADLKSGTtNTVVITTTDGTWgpDVDR 445 984..56689**********54999999955544368888 PP CBM35.hmm 117 lel 119 +++ 532072|XyAK1471_1_GeneCatalog_proteins_20191118.aa.fasta|GH43_24|GH43_24|CBM35 446 IMV 448 865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 149.18 // Query: 427099|XylFL0594_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-17 49.1 0.6 1.7e-16 47.7 0.6 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.7 0.6 8.7e-17 1.7e-16 2 119 .] 328 448 .. 327 448 .. 0.89 Alignments for each domain: == domain 1 score: 47.7 bits; conditional E-value: 8.7e-17 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn. 39 eAe+a+ + + + + +g+sG + v+++ ++g++vtf+ 427099|XylFL0594_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 328 EAESATYGNGARTLSCSGCSGGSSVGYIGgSSGGSVTFSg 367 89*****999899999***********98678999***** PP CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfp 79 v +++a + +++++Y ng++s++ +v+vnG++++ +++p 427099|XylFL0594_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 368 VSSDAATRTSIRIKYLNGDSSQRFATVTVNGASQKIAFLP 407 ***********************************99999 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiksdwGwi..nlds 116 + + +t g+++ +v+L+ G+ nt+ i+ G ++d+ 427099|XylFL0594_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 408 TVN--GTPGSSVLNVNLNSGSsNTVVITTTDGTWgpDIDR 445 994..56689**********5599***9955544368888 PP CBM35.hmm 117 lel 119 +++ 427099|XylFL0594_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 446 IMV 448 875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 185.19 // Query: 452576|Xylhel2_GeneCatalog_proteins_20191119.aa.fasta|GH43_24|GH43_24|CBM35 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-16 47.6 1.2 1.9e-16 47.6 1.2 1.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.4 0.1 0.59 1.2 38 56 .. 39 57 .. 28 76 .. 0.60 2 ! 47.6 1.2 9.3e-17 1.9e-16 2 119 .] 328 448 .. 327 448 .. 0.88 Alignments for each domain: == domain 1 score: -3.4 bits; conditional E-value: 0.59 CBM35.hmm 38 fnvdvpkaGsYelslrYan 56 +v++ aG ++ +Y 452576|Xylhel2_GeneCatalog_proteins_20191119.aa.fasta|GH43_24|GH43_24|CBM35 39 AHVQAHGAGAIKVGSTYYI 57 4566666666555555544 PP == domain 2 score: 47.6 bits; conditional E-value: 9.3e-17 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn. 39 eAe a++ + + + + +g+sG + v+++ ++ ++vtf+ 452576|Xylhel2_GeneCatalog_proteins_20191119.aa.fasta|GH43_24|GH43_24|CBM35 328 EAEAATIANGAKTLSCSGCSGGTSVGYIGgSTAGSVTFSg 367 8********999999*************9456678***** PP CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfp 79 v +++a + +++++Y ng+++++ +v+vnG++++ +++p 452576|Xylhel2_GeneCatalog_proteins_20191119.aa.fasta|GH43_24|GH43_24|CBM35 368 VSSNAATKSSIRIKYLNGDSTQRYATVTVNGASQKLAFLP 407 **************************************** PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiksdwGwi..nlds 116 + g +t g+++ +++L+ G+ nt+ i+ G ++d+ 452576|Xylhel2_GeneCatalog_proteins_20191119.aa.fasta|GH43_24|GH43_24|CBM35 408 TAG--GTPGSSVLNANLNSGAtNTVVISTTDGSWgpDIDR 445 995..6777***********65999999944443357888 PP CBM35.hmm 117 lel 119 +++ 452576|Xylhel2_GeneCatalog_proteins_20191119.aa.fasta|GH43_24|GH43_24|CBM35 446 IMV 448 865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 163.67 // Query: 298811|XylFL1042_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 [L=451] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-17 49.6 0.5 4.5e-17 49.6 0.5 2.0 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.1 0.44 0.89 39 56 .. 40 57 .. 28 85 .. 0.52 2 ? -3.6 0.2 0.68 1.4 43 64 .. 112 133 .. 109 147 .. 0.64 3 ! 49.6 0.5 2.2e-17 4.5e-17 2 119 .] 328 449 .. 327 449 .. 0.92 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.44 CBM35.hmm 39 nvdvpkaGsYelslrYan 56 +v++ aG ++ +Y 298811|XylFL1042_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 40 HVQAHGAGIIKVGSTYYM 57 444444444444444433 PP == domain 2 score: -3.6 bits; conditional E-value: 0.68 CBM35.hmm 43 pkaGsYelslrYangtgstktl 64 +++G+Y l ++ +++++++++ 298811|XylFL1042_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 112 DSTGKYVLYMHIDSSSYGEAKV 133 5677777777766665555544 PP == domain 3 score: 49.6 bits; conditional E-value: 2.2e-17 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn. 39 eAe a++ + + + + +g+sGs+ v+++ ++g++vtfn 298811|XylFL1042_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 328 EAEAATIANGARTLSCSGCSGSTSVGYIGgSSGGSVTFNd 367 8********9999999***********98678999***** PP CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfp 79 v +++a + ++++++ ng++s++ +v+vnG +++ +++p 298811|XylFL1042_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 368 VSSQAATKTSIRIKHLNGDSSQRFATVTVNGVSQKLAFLP 407 *********************************9999888 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiksdwGwi..nlds 116 + + +t g+++ +v+L+ G+ nt+ i+ G + ++d+ 298811|XylFL1042_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 408 TD-DGSTPGSSVLNVNLNSGAvNTVVITTTDGTYgpDIDR 446 87.67888************879******88988788999 PP CBM35.hmm 117 lel 119 +++ 298811|XylFL1042_GeneCatalog_proteins_20190320.aa.fasta|GH43_24|GH43_24|CBM35 447 IMV 449 876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (451 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 158.72 // [ok]