# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM35/fasta_for_each_cluster/cluster_3.txt # target HMM database: merged_hmms/CBM35.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM35/CBM35_cluster_3.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: QPL68026.1|CBM35|GH105 [L=534] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-30 90.8 0.0 1.3e-29 90.0 0.0 1.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 0.0 6.6e-30 1.3e-29 1 118 [. 55 175 .. 55 176 .. 0.98 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.6e-30 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 yeAeda ++ v+++h+g++G+gfvd+ +a+g+ v+f+v ++aG+ l lrYangtgs++ l++ vnG v + f tg+w++ QPL68026.1|CBM35|GH105 55 YEAEDAAISRGVVQSDHPGFTGRGFVDYENAPGGHVEFTVGRETAGTVPLVLRYANGTGSDRPLDLAVNGRTVTaGMPFGPTGSWTD 141 9*********99************************************************************9989*********** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldsle 118 w+ta+++v+L G+ t+++++ G nldsl+ QPL68026.1|CBM35|GH105 142 WRTATVSVPLGRGTSTVRLTArgTGGGPNLDSLT 175 *********************9999999***996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (534 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 145.45 // Query: QPL92400.1|CBM35|GH105 [L=534] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-30 90.8 0.0 1.3e-29 90.0 0.0 1.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 0.0 6.6e-30 1.3e-29 1 118 [. 55 175 .. 55 176 .. 0.98 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.6e-30 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 yeAeda ++ v+++h+g++G+gfvd+ +a+g+ v+f+v ++aG+ l lrYangtgs++ l++ vnG v + f tg+w++ QPL92400.1|CBM35|GH105 55 YEAEDAAISRGVVQSDHPGFTGRGFVDYENAPGGHVEFTVGRETAGTVPLVLRYANGTGSDRPLDLAVNGRTVTaGMPFGPTGSWTD 141 9*********99************************************************************9989*********** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldsle 118 w+ta+++v+L G+ t+++++ G nldsl+ QPL92400.1|CBM35|GH105 142 WRTATVSVPLGRGTSTVRLTArgTGGGPNLDSLT 175 *********************9999999***996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (534 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 198.14 // Query: QPM16168.1|CBM35|GH105 [L=534] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-30 90.8 0.0 1.3e-29 90.0 0.0 1.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 0.0 6.6e-30 1.3e-29 1 118 [. 55 175 .. 55 176 .. 0.98 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.6e-30 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 yeAeda ++ v+++h+g++G+gfvd+ +a+g+ v+f+v ++aG+ l lrYangtgs++ l++ vnG v + f tg+w++ QPM16168.1|CBM35|GH105 55 YEAEDAAISRGVVQSDHPGFTGRGFVDYENAPGGHVEFTVGRETAGTVPLVLRYANGTGSDRPLDLAVNGRTVTaGMPFGPTGSWTD 141 9*********99************************************************************9989*********** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldsle 118 w+ta+++v+L G+ t+++++ G nldsl+ QPM16168.1|CBM35|GH105 142 WRTATVSVPLGRGTSTVRLTArgTGGGPNLDSLT 175 *********************9999999***996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (534 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 181.71 // Query: QPM22408.1|CBM35|GH105 [L=534] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-30 90.8 0.0 1.3e-29 90.0 0.0 1.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 0.0 6.6e-30 1.3e-29 1 118 [. 55 175 .. 55 176 .. 0.98 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.6e-30 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 yeAeda ++ v+++h+g++G+gfvd+ +a+g+ v+f+v ++aG+ l lrYangtgs++ l++ vnG v + f tg+w++ QPM22408.1|CBM35|GH105 55 YEAEDAAISRGVVQSDHPGFTGRGFVDYENAPGGHVEFTVGRETAGTVPLVLRYANGTGSDRPLDLAVNGRTVTaGMPFGPTGSWTD 141 9*********99************************************************************9989*********** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldsle 118 w+ta+++v+L G+ t+++++ G nldsl+ QPM22408.1|CBM35|GH105 142 WRTATVSVPLGRGTSTVRLTArgTGGGPNLDSLT 175 *********************9999999***996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (534 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 188.78 // Query: QPL90030.1|CBM35|GH105 [L=534] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-30 90.8 0.0 1.3e-29 90.0 0.0 1.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 0.0 6.6e-30 1.3e-29 1 118 [. 55 175 .. 55 176 .. 0.98 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.6e-30 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 yeAeda ++ v+++h+g++G+gfvd+ +a+g+ v+f+v ++aG+ l lrYangtgs++ l++ vnG v + f tg+w++ QPL90030.1|CBM35|GH105 55 YEAEDAAISRGVVQSDHPGFTGRGFVDYENAPGGHVEFTVGRETAGTVPLVLRYANGTGSDRPLDLAVNGRTVTaGMPFGPTGSWTD 141 9*********99************************************************************9989*********** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldsle 118 w+ta+++v+L G+ t+++++ G nldsl+ QPL90030.1|CBM35|GH105 142 WRTATVSVPLGRGTSTVRLTArgTGGGPNLDSLT 175 *********************9999999***996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (534 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 200.50 // Query: QPL61992.1|CBM35|GH105 [L=534] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-30 90.8 0.0 1.3e-29 90.0 0.0 1.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 0.0 6.6e-30 1.3e-29 1 118 [. 55 175 .. 55 176 .. 0.98 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.6e-30 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 yeAeda ++ v+++h+g++G+gfvd+ +a+g+ v+f+v ++aG+ l lrYangtgs++ l++ vnG v + f tg+w++ QPL61992.1|CBM35|GH105 55 YEAEDAAISRGVVQSDHPGFTGRGFVDYENAPGGHVEFTVGRETAGTVPLVLRYANGTGSDRPLDLAVNGRTVTaGMPFGPTGSWTD 141 9*********99************************************************************9989*********** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldsle 118 w+ta+++v+L G+ t+++++ G nldsl+ QPL61992.1|CBM35|GH105 142 WRTATVSVPLGRGTSTVRLTArgTGGGPNLDSLT 175 *********************9999999***996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (534 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 196.35 // Query: QPM04111.1|CBM35|GH105 [L=534] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-30 90.8 0.0 1.3e-29 90.0 0.0 1.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 0.0 6.6e-30 1.3e-29 1 118 [. 55 175 .. 55 176 .. 0.98 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.6e-30 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 yeAeda ++ v+++h+g++G+gfvd+ +a+g+ v+f+v ++aG+ l lrYangtgs++ l++ vnG v + f tg+w++ QPM04111.1|CBM35|GH105 55 YEAEDAAISRGVVQSDHPGFTGRGFVDYENAPGGHVEFTVGRETAGTVPLVLRYANGTGSDRPLDLAVNGRTVTaGMPFGPTGSWTD 141 9*********99************************************************************9989*********** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldsle 118 w+ta+++v+L G+ t+++++ G nldsl+ QPM04111.1|CBM35|GH105 142 WRTATVSVPLGRGTSTVRLTArgTGGGPNLDSLT 175 *********************9999999***996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (534 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 202.93 // Query: QPL74101.1|CBM35|GH105 [L=534] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-30 90.8 0.0 1.3e-29 90.0 0.0 1.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 0.0 6.6e-30 1.3e-29 1 118 [. 55 175 .. 55 176 .. 0.98 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.6e-30 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 yeAeda ++ v+++h+g++G+gfvd+ +a+g+ v+f+v ++aG+ l lrYangtgs++ l++ vnG v + f tg+w++ QPL74101.1|CBM35|GH105 55 YEAEDAAISRGVVQSDHPGFTGRGFVDYENAPGGHVEFTVGRETAGTVPLVLRYANGTGSDRPLDLAVNGRTVTaGMPFGPTGSWTD 141 9*********99************************************************************9989*********** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldsle 118 w+ta+++v+L G+ t+++++ G nldsl+ QPL74101.1|CBM35|GH105 142 WRTATVSVPLGRGTSTVRLTArgTGGGPNLDSLT 175 *********************9999999***996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (534 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 196.25 // Query: AXU11892.1|CBM35|GH105 [L=534] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-30 90.8 0.0 1.3e-29 90.0 0.0 1.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 0.0 6.6e-30 1.3e-29 1 118 [. 55 175 .. 55 176 .. 0.98 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.6e-30 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 yeAeda ++ v+++h+g++G+gfvd+ +a+g+ v+f+v ++aG+ l lrYangtgs++ l++ vnG v + f tg+w++ AXU11892.1|CBM35|GH105 55 YEAEDAAISRGVVQSDHPGFTGRGFVDYENAPGGHVEFTVGRETAGTVPLVLRYANGTGSDRPLDLAVNGRTVTaGMPFGPTGSWTD 141 9*********99************************************************************9989*********** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldsle 118 w+ta+++v+L G+ t+++++ G nldsl+ AXU11892.1|CBM35|GH105 142 WRTATVSVPLGRGTSTVRLTArgTGGGPNLDSLT 175 *********************9999999***996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (534 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 233.85 // Query: BBA98168.1|CBM35|GH105 [L=498] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-35 106.9 0.3 1.3e-34 106.2 0.3 1.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 106.2 0.3 6.3e-35 1.3e-34 1 119 [] 13 133 .. 13 133 .. 0.98 Alignments for each domain: == domain 1 score: 106.2 bits; conditional E-value: 6.3e-35 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw 87 yeAeda++ +v+t+h g++G+gfv+ ++ag++v+f+vd+p+aG+ +l lrY+ngt++ ++ +v vnGt vs f t++wdtw BBA98168.1|CBM35|GH105 13 YEAEDATVFHGTVDTDHLGFTGTGFVNTANEAGAYVEFTVDAPAAGDATLALRYSNGTAAGRQADVGVNGTVVSAPAFAPTTDWDTW 99 9************************************************************************************** PP CBM35.hmm 88 gtaagtvtLkaGkntitiks..dwGwinldslel 119 +++ + vtL+aG+n i++ + G +ldsl++ BBA98168.1|CBM35|GH105 100 AVSRIPVTLRAGANAIRVAAttAGGLPDLDSLTV 133 ********************9888999*****97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (498 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 229.67 // Query: QPL98095.1|CBM35|GH105 [L=534] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-30 90.8 0.0 1.3e-29 90.0 0.0 1.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 0.0 6.6e-30 1.3e-29 1 118 [. 55 175 .. 55 176 .. 0.98 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.6e-30 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 yeAeda ++ v+++h+g++G+gfvd+ +a+g+ v+f+v ++aG+ l lrYangtgs++ l++ vnG v + f tg+w++ QPL98095.1|CBM35|GH105 55 YEAEDAAISRGVVQSDHPGFTGRGFVDYENAPGGHVEFTVGRETAGTVPLVLRYANGTGSDRPLDLAVNGRTVTaGMPFGPTGSWTD 141 9*********99************************************************************9989*********** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldsle 118 w+ta+++v+L G+ t+++++ G nldsl+ QPL98095.1|CBM35|GH105 142 WRTATVSVPLGRGTSTVRLTArgTGGGPNLDSLT 175 *********************9999999***996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (534 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 193.99 // Query: QPL80130.1|CBM35|GH105 [L=534] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-30 90.8 0.0 1.3e-29 90.0 0.0 1.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 0.0 6.6e-30 1.3e-29 1 118 [. 55 175 .. 55 176 .. 0.98 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.6e-30 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 yeAeda ++ v+++h+g++G+gfvd+ +a+g+ v+f+v ++aG+ l lrYangtgs++ l++ vnG v + f tg+w++ QPL80130.1|CBM35|GH105 55 YEAEDAAISRGVVQSDHPGFTGRGFVDYENAPGGHVEFTVGRETAGTVPLVLRYANGTGSDRPLDLAVNGRTVTaGMPFGPTGSWTD 141 9*********99************************************************************9989*********** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldsle 118 w+ta+++v+L G+ t+++++ G nldsl+ QPL80130.1|CBM35|GH105 142 WRTATVSVPLGRGTSTVRLTArgTGGGPNLDSLT 175 *********************9999999***996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (534 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 195.86 // Query: ANW17341.1|CBM35|GH105 [L=534] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-30 90.8 0.0 1.3e-29 90.0 0.0 1.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 0.0 6.6e-30 1.3e-29 1 118 [. 55 175 .. 55 176 .. 0.98 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.6e-30 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 yeAeda ++ v+++h+g++G+gfvd+ +a+g+ v+f+v ++aG+ l lrYangtgs++ l++ vnG v + f tg+w++ ANW17341.1|CBM35|GH105 55 YEAEDAAISRGVVQSDHPGFTGRGFVDYENAPGGHVEFTVGRETAGTVPLVLRYANGTGSDRPLDLAVNGRTVTaGMPFGPTGSWTD 141 9*********99************************************************************9989*********** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldsle 118 w+ta+++v+L G+ t+++++ G nldsl+ ANW17341.1|CBM35|GH105 142 WRTATVSVPLGRGTSTVRLTArgTGGGPNLDSLT 175 *********************9999999***996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (534 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 214.20 // Query: QCS04671.1|CBM35|GH105 [L=534] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-30 90.8 0.0 1.3e-29 90.0 0.0 1.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 0.0 6.6e-30 1.3e-29 1 118 [. 55 175 .. 55 176 .. 0.98 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.6e-30 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 yeAeda ++ v+++h+g++G+gfvd+ +a+g+ v+f+v ++aG+ l lrYangtgs++ l++ vnG v + f tg+w++ QCS04671.1|CBM35|GH105 55 YEAEDAAISRGVVQSDHPGFTGRGFVDYENAPGGHVEFTVGRETAGTVPLVLRYANGTGSDRPLDLAVNGRTVTaGMPFGPTGSWTD 141 9*********99************************************************************9989*********** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldsle 118 w+ta+++v+L G+ t+++++ G nldsl+ QCS04671.1|CBM35|GH105 142 WRTATVSVPLGRGTSTVRLTArgTGGGPNLDSLT 175 *********************9999999***996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (534 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 197.18 // Query: QPM13897.1|CBM35|GH105 [L=534] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-30 90.8 0.0 1.3e-29 90.0 0.0 1.4 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 0.0 6.6e-30 1.3e-29 1 118 [. 55 175 .. 55 176 .. 0.98 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.6e-30 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 yeAeda ++ v+++h+g++G+gfvd+ +a+g+ v+f+v ++aG+ l lrYangtgs++ l++ vnG v + f tg+w++ QPM13897.1|CBM35|GH105 55 YEAEDAAISRGVVQSDHPGFTGRGFVDYENAPGGHVEFTVGRETAGTVPLVLRYANGTGSDRPLDLAVNGRTVTaGMPFGPTGSWTD 141 9*********99************************************************************9989*********** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldsle 118 w+ta+++v+L G+ t+++++ G nldsl+ QPM13897.1|CBM35|GH105 142 WRTATVSVPLGRGTSTVRLTArgTGGGPNLDSLT 175 *********************9999999***996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (534 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 205.35 // Query: QFR93884.1|CBM35|GH105 [L=547] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-26 80.2 0.5 2.3e-26 79.6 0.5 1.3 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.6 0.5 1.1e-26 2.3e-26 1 119 [] 66 186 .. 66 186 .. 0.98 Alignments for each domain: == domain 1 score: 79.6 bits; conditional E-value: 1.1e-26 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw 87 y+Ae+a+++g++v + ++gy+G g+ + +g++ +++v++ G+ els+rYa+++++++ ls++vnG v fp tg + w QFR93884.1|CBM35|GH105 66 YQAESATVSGAQVASGNSGYTGGGYLAFAARSGAYAQWTVEAAGHGRQELSFRYASEGTTERPLSLTVNGRTVAGSLFPPTGGASHW 152 9************************************************************************************** PP CBM35.hmm 88 gtaagtvtLkaGkntitiks..dwGwinldslel 119 +t+++ + L+ G nt++++ G ld+l + QFR93884.1|CBM35|GH105 153 RTVTVRAALRSGVNTVRVTTtsAAGGPALDWLAV 186 ******************999999999***9976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (547 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 230.43 // [ok]