# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM35/fasta_for_each_cluster/cluster_24.txt # target HMM database: merged_hmms/CBM35.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM35/CBM35_cluster_24.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: ACE85953.1|CBM35|PL1 [L=564] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-25 77.0 3.4 1.8e-25 76.7 1.9 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 76.7 1.9 9.1e-26 1.8e-25 13 117 .. 42 142 .. 36 147 .. 0.89 2 ? -3.8 0.0 0.77 1.5 31 44 .. 277 290 .. 271 291 .. 0.74 Alignments for each domain: == domain 1 score: 76.7 bits; conditional E-value: 9.1e-26 CBM35.hmm 13 vntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkn 101 + t h+gy+G g+vd +a g+ ++++++v +aGsY++s+rYan ++ + +vvnG++ ++++fp t++ ++w+t+++tv+L aG n ACE85953.1|CBM35|PL1 42 ISTAHSGYTGAGYVDIHNAGGQGISYQINVATAGSYNVSFRYANR--GSTSAALVVNGSS-GSLSFPRTASLSSWNTVTKTVNLVAGVN 127 7899****************************************5..889999****988.78************************** PP CBM35.hmm 102 titiksdwGwinldsl 117 ++++++ +G ++ ++ ACE85953.1|CBM35|PL1 128 QLRLRA-TGSQEIANI 142 *****8.555544444 PP == domain 2 score: -3.8 bits; conditional E-value: 0.77 CBM35.hmm 31 aagdavtfnvdvpk 44 + ++v+fnv+++k ACE85953.1|CBM35|PL1 277 PPAGYVKFNVTSNK 290 56788999999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (564 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 151.53 // Query: QEI11222.1|CBM35|PL1 [L=564] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-25 77.0 3.4 1.8e-25 76.7 1.9 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 76.7 1.9 9.1e-26 1.8e-25 13 117 .. 42 142 .. 36 147 .. 0.89 2 ? -3.8 0.0 0.77 1.5 31 44 .. 277 290 .. 271 291 .. 0.74 Alignments for each domain: == domain 1 score: 76.7 bits; conditional E-value: 9.1e-26 CBM35.hmm 13 vntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkn 101 + t h+gy+G g+vd +a g+ ++++++v +aGsY++s+rYan ++ + +vvnG++ ++++fp t++ ++w+t+++tv+L aG n QEI11222.1|CBM35|PL1 42 ISTAHSGYTGAGYVDIHNAGGQGISYQINVATAGSYNVSFRYANR--GSTSAALVVNGSS-GSLSFPRTASLSSWNTVTKTVNLVAGVN 127 7899****************************************5..889999****988.78************************** PP CBM35.hmm 102 titiksdwGwinldsl 117 ++++++ +G ++ ++ QEI11222.1|CBM35|PL1 128 QLRLRA-TGSQEIANI 142 *****8.555544444 PP == domain 2 score: -3.8 bits; conditional E-value: 0.77 CBM35.hmm 31 aagdavtfnvdvpk 44 + ++v+fnv+++k QEI11222.1|CBM35|PL1 277 PPAGYVKFNVTSNK 290 56788999999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (564 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 181.65 // Query: ARU26843.1|CBM35|PL1 [L=561] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-25 74.7 1.1 1.9e-24 73.4 1.1 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.4 1.1 9.4e-25 1.9e-24 13 119 .] 42 147 .. 35 147 .. 0.93 Alignments for each domain: == domain 1 score: 73.4 bits; conditional E-value: 9.4e-25 CBM35.hmm 13 vntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkn 101 + t + gy+G g+vd ++ g ++++v vp++GsY++s+rYan ++ + +vvnG++ ++++fp t++ + w+++ +tv+L aG n ARU26843.1|CBM35|PL1 42 ISTANNGYTGAGYVDIDNSGGMGISYEVSVPASGSYAVSFRYAN--VGSTSAALVVNGSS-GSLSFPRTTSLSAWNSVGKTVNLHAGIN 127 678999********999999999*********************..79999******988.78************************** PP CBM35.hmm 102 titiks..dwGwinldslel 119 ++++++ ++ n+d++++ ARU26843.1|CBM35|PL1 128 QLRLRAtgSQAIANIDAMTV 147 ******87778889999886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (561 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 201.91 // Query: QEI18376.1|CBM35|PL1 [L=564] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-25 77.0 3.4 1.8e-25 76.7 1.9 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 76.7 1.9 9.1e-26 1.8e-25 13 117 .. 42 142 .. 36 147 .. 0.89 2 ? -3.8 0.0 0.77 1.5 31 44 .. 277 290 .. 271 291 .. 0.74 Alignments for each domain: == domain 1 score: 76.7 bits; conditional E-value: 9.1e-26 CBM35.hmm 13 vntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkn 101 + t h+gy+G g+vd +a g+ ++++++v +aGsY++s+rYan ++ + +vvnG++ ++++fp t++ ++w+t+++tv+L aG n QEI18376.1|CBM35|PL1 42 ISTAHSGYTGAGYVDIHNAGGQGISYQINVATAGSYNVSFRYANR--GSTSAALVVNGSS-GSLSFPRTASLSSWNTVTKTVNLVAGVN 127 7899****************************************5..889999****988.78************************** PP CBM35.hmm 102 titiksdwGwinldsl 117 ++++++ +G ++ ++ QEI18376.1|CBM35|PL1 128 QLRLRA-TGSQEIANI 142 *****8.555544444 PP == domain 2 score: -3.8 bits; conditional E-value: 0.77 CBM35.hmm 31 aagdavtfnvdvpk 44 + ++v+fnv+++k QEI18376.1|CBM35|PL1 277 PPAGYVKFNVTSNK 290 56788999999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (564 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 195.44 // Query: QEI14796.1|CBM35|PL1 [L=564] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-25 77.0 3.4 1.8e-25 76.7 1.9 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 76.7 1.9 9.1e-26 1.8e-25 13 117 .. 42 142 .. 36 147 .. 0.89 2 ? -3.8 0.0 0.77 1.5 31 44 .. 277 290 .. 271 291 .. 0.74 Alignments for each domain: == domain 1 score: 76.7 bits; conditional E-value: 9.1e-26 CBM35.hmm 13 vntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkn 101 + t h+gy+G g+vd +a g+ ++++++v +aGsY++s+rYan ++ + +vvnG++ ++++fp t++ ++w+t+++tv+L aG n QEI14796.1|CBM35|PL1 42 ISTAHSGYTGAGYVDIHNAGGQGISYQINVATAGSYNVSFRYANR--GSTSAALVVNGSS-GSLSFPRTASLSSWNTVTKTVNLVAGVN 127 7899****************************************5..889999****988.78************************** PP CBM35.hmm 102 titiksdwGwinldsl 117 ++++++ +G ++ ++ QEI14796.1|CBM35|PL1 128 QLRLRA-TGSQEIANI 142 *****8.555544444 PP == domain 2 score: -3.8 bits; conditional E-value: 0.77 CBM35.hmm 31 aagdavtfnvdvpk 44 + ++v+fnv+++k QEI14796.1|CBM35|PL1 277 PPAGYVKFNVTSNK 290 56788999999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (564 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 225.12 // Query: ARU26673.1|CBM35|PL3_5 [L=460] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-27 81.8 1.9 9.8e-27 80.8 1.9 1.5 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 80.8 1.9 4.9e-27 9.8e-27 13 119 .] 43 148 .. 36 148 .. 0.93 Alignments for each domain: == domain 1 score: 80.8 bits; conditional E-value: 4.9e-27 CBM35.hmm 13 vntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaG 99 + t++ gy+Gsg+vd ++ g+++ ++++vp +G+Y ls+rYan +++ + +vvnG++ ++++fp t++ +tw+ a + v+L aG ARU26673.1|CBM35|PL3_5 43 ISTSNNGYTGSGYVDLDNSGGKRINYDIQVPVSGTYHLSFRYAN--TGSTSSALVVNGSS-GSLSFPRTASLSTWSAAGKHVNLYAG 126 78999**********99999999*********************..57888899***988.78************************ PP CBM35.hmm 100 kntitiks..dwGwinldslel 119 +nt+++++ ++ n+dsl++ ARU26673.1|CBM35|PL3_5 127 NNTVRLQAtgSQAIANIDSLTV 148 ********9888888****997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (460 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 209.34 // [ok]