# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM35/fasta_for_each_cluster/cluster_194.txt # target HMM database: merged_hmms/CBM35.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM35/CBM35_cluster_194.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 2372|Horwer1_GeneCatalog_proteins_20160803.aa.fasta|GH27|CBM35 [L=570] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-08 20.5 0.3 1.7e-07 18.7 0.1 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.0 0.45 0.9 98 111 .. 77 88 .. 70 94 .. 0.77 2 ! 18.7 0.1 8.7e-08 1.7e-07 1 106 [. 420 537 .. 420 556 .. 0.76 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.45 CBM35.hmm 98 aGkntitiksdwGw 111 aG+nt++i+ Gw 2372|Horwer1_GeneCatalog_proteins_20160803.aa.fasta|GH27|CBM35 77 AGYNTFQIDC--GW 88 8999999987..44 PP == domain 2 score: 18.7 bits; conditional E-value: 8.7e-08 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaG 46 y A+++sl+g+++ ++ +g+s + v++l +a+++vt++ + +++ 2372|Horwer1_GeneCatalog_proteins_20160803.aa.fasta|GH27|CBM35 420 YGAASGSLDGSAAIQDCPGCSEGKKVGYL-TANSSVTIHgIR-TSQT 464 789***********************999.788888888554.4555 PP CBM35.hmm 47 sYelslr.......Yang.tgstktlsvvvnGtkvsevtfpst.gnw 84 + ++++ Y ++ + +++t v+vnG++++ v+fp t +w 2372|Horwer1_GeneCatalog_proteins_20160803.aa.fasta|GH27|CBM35 465 TSNVRFDyvncdvgYLADqKPNYRTAAVSVNGGAAQMVNFPLTgYAW 511 556666622333335555577999*******************6667 PP CBM35.hmm 85 dtwgtaagtvtLk....aGkntitik 106 + ++ v+L+ +G+n+iti+ 2372|Horwer1_GeneCatalog_proteins_20160803.aa.fasta|GH27|CBM35 512 TLDVLTDFLVELSgfdaEGENSITIS 537 66566667788854444788888876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (570 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 138.61 // Query: UJO19822.1|CBM35|GH27 [L=561] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-08 22.5 0.7 2.4e-07 18.2 0.7 2.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.2 0.7 1.2e-07 2.4e-07 2 112 .. 419 548 .. 418 553 .. 0.71 Alignments for each domain: == domain 1 score: 18.2 bits; conditional E-value: 1.2e-07 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslr.......Yangtgstktl.......svvvnGtkvs 74 eAe+++l g + ++ +g+sGs+ v+ ++++g+++t++ + +++ + ++++ Y ++++++++ s++vnG++ + UJO19822.1|CBM35|GH27 419 EAESGTLVGGANTQPCSGCSGSTKVGFITNTGGSLTLSgI-RTSQATQDVRFDyldcevgYLFDPTGSQSNglnvrgaSISVNGGAGQ 505 8********999999*******************999954.45556666666633444444444444444411111116777777777 PP CBM35.hmm 75 evtfpst.gnwdtwgtaagtvtL....kaGkntitiksdwGwi 112 +v fp t nwd+ + v L + G+nti+i+ +G + UJO19822.1|CBM35|GH27 506 SVLFPLTgYNWDKDVAKNHLVRLsgfsTTGTNTIRISGLSGST 548 *******88****777777788844444899999998766655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (561 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.56 // Query: 490491|Macan1_GeneCatalog_proteins_20140424.aa.fasta|GH27|CBM35 [L=553] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-07 17.6 5.3 6.8e-07 16.7 1.0 2.6 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 2.2 0.3 0.011 0.022 31 64 .. 381 414 .. 358 432 .. 0.79 2 ! 16.7 1.0 3.4e-07 6.8e-07 16 107 .. 432 536 .. 417 550 .. 0.63 Alignments for each domain: == domain 1 score: 2.2 bits; conditional E-value: 0.011 CBM35.hmm 31 aagdavtfnvdvpkaGsYelslrYangtgstktl 64 ++++av+f+ +v+++Gs +l+l+ + t++t + 490491|Macan1_GeneCatalog_proteins_20140424.aa.fasta|GH27|CBM35 381 TTQNAVSFSKQVNARGSLALRLSNVKRTSTTTNY 414 56789***************99988864444433 PP == domain 2 score: 16.7 bits; conditional E-value: 3.4e-07 CBM35.hmm 16 nhagysGsgfvdglqaagda.vtfnvdvpkaGsYelslr....... 53 + +g++++ v++l ++++ +t++ +++ + +++ 490491|Macan1_GeneCatalog_proteins_20140424.aa.fasta|GH27|CBM35 432 SCSGCTSTNKVGNLGGPSNGtLTLSNIRTSQATQVVRFDyingevg 477 5566666666666665444323333222333334444441111111 PP CBM35.hmm 54 YangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL.. 96 Y g+ +++ s++vnG+++++v+fp t nwd+ + v+L 490491|Macan1_GeneCatalog_proteins_20140424.aa.fasta|GH27|CBM35 478 YLGGSNNERLASISVNGGAAKTVSFPLTgYNWDKDVLKSYAVELsg 523 66667789999*****************89****888888999944 PP CBM35.hmm 97 ..kaGkntitiks 107 + G+n+i ik 490491|Macan1_GeneCatalog_proteins_20140424.aa.fasta|GH27|CBM35 524 fsTTGTNSIVIKG 536 4447999999986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (553 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.05 // Query: 179534|ChetHAW225_4_GeneCatalog_proteins_20220426.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-08 21.1 2.3 7e-08 19.9 2.3 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.9 2.3 3.5e-08 7e-08 15 107 .. 431 535 .. 418 549 .. 0.77 Alignments for each domain: == domain 1 score: 19.9 bits; conditional E-value: 3.5e-08 CBM35.hmm 15 tnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslr 53 + +g+++s v+++ ++g++vt++ +++ + ++++ 179534|ChetHAW225_4_GeneCatalog_proteins_20220426.aa.fasta|GH27|CBM35 431 SPCSGCTSSNKVGNIGgSNGGRVTLSNIRTSKATQTVRFD 470 4567999999999998678889999966677889999999 PP CBM35.hmm 54 Yang......tgstktlsvvvnGtkvsevtfpst.gnwdt 86 Y ng ++++++ s++vnG+++++v+fp t nw+ 179534|ChetHAW225_4_GeneCatalog_proteins_20220426.aa.fasta|GH27|CBM35 471 YINGnvdymgGTNERVASISVNGGAAKTVSFPLTgYNWNV 510 99975533334678999*****************88***9 PP CBM35.hmm 87 wgtaagtvtL....kaGkntitiks 107 ++ v+L + G ntiti 179534|ChetHAW225_4_GeneCatalog_proteins_20220426.aa.fasta|GH27|CBM35 511 DVSKNYGVELsgfsTTGPNTITIAG 535 9999999999444447999999975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 201.47 // Query: WPH00665.1|CBM35|GH27 [L=540] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-10 26.1 1.0 2.6e-09 24.5 1.0 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 24.5 1.0 1.3e-09 2.6e-09 1 108 [. 403 527 .. 403 538 .. 0.78 Alignments for each domain: == domain 1 score: 24.5 bits; conditional E-value: 1.3e-09 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpkaGsYelslrYang.......tgstktlsvvvnGtkvsevtfp 79 +eAe+++l g++ ++ +g+sG v+++ +ag+++tf+ ++ +++ ++++ Y ng + + ++ s++vnG+++ +v+fp WPH00665.1|CBM35|GH27 403 FEAEQGKLGGAANIQTCSGCSGGYKVGYIGeGAGNTLTFTdIE-TSQSVQDVRFDYINGevgylggGNNVRSASISVNGQAAVTVDFP 489 69********999999************985678889999555.677899999998887332221134668999************** PP CBM35.hmm 80 st.gnwdtwgtaagtvtL....kaGkntitiks....d 108 + nwd v L + G+ntiti + WPH00665.1|CBM35|GH27 490 LSgYNWDVNVARSFLVRLygfkTDGTNTITIAGtsseS 527 99889**9777777888867767899999997655433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (540 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 2 (1); expected 0.0 (0.02) Passed bias filter: 2 (1); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 179.38 // Query: 605243|KdCBS826_1_GeneCatalog_proteins_20190615.aa.fasta|GH27|CBM35 [L=567] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-06 15.3 0.1 4.1e-06 14.2 0.1 1.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 14.2 0.1 2e-06 4.1e-06 50 119 .] 473 549 .. 431 549 .. 0.85 Alignments for each domain: == domain 1 score: 14.2 bits; conditional E-value: 2e-06 CBM35.hmm 50 lslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgta 90 ++ Y ++ +++ s++vnG+ ++ v+fp + nw t ++ 605243|KdCBS826_1_GeneCatalog_proteins_20190615.aa.fasta|GH27|CBM35 473 CEVGYLGSGNNERLASISVNGGPAQIVSFPLSgYNWVTDIYT 514 46778888899999****************9988****9999 PP CBM35.hmm 91 agtvtL....kaGkntitiks.dwGwi.nldslel 119 + ++L ++G n+iti+ +Gw ++d++ + 605243|KdCBS826_1_GeneCatalog_proteins_20190615.aa.fasta|GH27|CBM35 515 DYGAELssfnTEGPNSITISGaGTGWApDFDQIAV 549 999999444448*******9999***999999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (567 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 174.01 // Query: 4913|Stely1_GeneCatalog_proteins_20170711.aa.fasta|GH27|CBM35 [L=551] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-08 20.6 2.4 8e-08 19.7 1.7 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.7 1.7 4e-08 8e-08 14 117 .. 430 547 .. 417 549 .. 0.67 Alignments for each domain: == domain 1 score: 19.7 bits; conditional E-value: 4e-08 CBM35.hmm 14 ntnhagysGsgfvdglq.aagdavtfn.vdvpkaGsYelslrYang.. 57 +++ +g+++s v+++ ++++++t++ + +++ + ++ + Y ng 4913|Stely1_GeneCatalog_proteins_20170711.aa.fasta|GH27|CBM35 430 TQTCSGCTSSNKVGNIGgSSNGRLTLSnIR-TTKATQSVLFDYINGqv 476 455667777777777763344556665243.44455566666666533 PP CBM35.hmm 58 ....tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtLk... 97 ++++++ s++vnG+k+++v+fp + nwd +++ v+L+ 4913|Stely1_GeneCatalog_proteins_20170711.aa.fasta|GH27|CBM35 477 dymgGSNERVASISVNGGKAKTVSFPLSgYNWDADVSKDYAVELSgfs 524 2222578999****************9989****9999******9666 PP CBM35.hmm 98 .aGkntitiks..dwGwinldsl 117 G+ntiti+ + +ld++ 4913|Stely1_GeneCatalog_proteins_20170711.aa.fasta|GH27|CBM35 525 iTGTNTITISGvgSAYGPDLDRI 547 67*******97543333367766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (551 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.14 // Query: 5778|Fuspr1_GeneCatalog_proteins_20210318.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-08 22.1 2.3 4.8e-08 20.5 2.3 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.5 2.3 2.4e-08 4.8e-08 5 119 .] 428 549 .. 418 549 .. 0.73 Alignments for each domain: == domain 1 score: 20.5 bits; conditional E-value: 2.4e-08 CBM35.hmm 5 dasltg..vsvntnhagysGsgfvdglqaagdavtfnvdvp.kaGsYe 49 +as +g +s++ + g s +g v + ++++vt nv + +G + 5778|Fuspr1_GeneCatalog_proteins_20210318.aa.fasta|GH27|CBM35 428 TASCSGctSSTKVGNVGGSTNGQVVLSNISTSKVTQNVLFDyING--D 473 555555444445555555666666666666667777766631234..4 PP CBM35.hmm 50 lslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL 96 + +++ +++++ s+ vnG+ +++v+fp t nwd+ ++ v+L 5778|Fuspr1_GeneCatalog_proteins_20210318.aa.fasta|GH27|CBM35 474 VGFSFTG-STNDRLASIKVNGGTAQTVSFPLTgYNWDKDVYKGYAVEL 520 4555554.57999*******************89****9999999*** PP CBM35.hmm 97 ....kaGkntitiks.dwGwi.nldslel 119 + G ntiti+ + Gw ++d+l + 5778|Fuspr1_GeneCatalog_proteins_20210318.aa.fasta|GH27|CBM35 521 sgfkTSGPNTITISGvNGGWApDFDRLAV 549 555558********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 197.31 // Query: 291101|Xylpal124036_1_GeneCatalog_proteins_20190613.aa.fasta|GH27|CBM35 [L=558] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-05 12.8 0.0 2.5e-05 11.7 0.0 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 11.7 0.0 1.2e-05 2.5e-05 53 117 .. 479 552 .. 424 554 .. 0.75 Alignments for each domain: == domain 1 score: 11.7 bits; conditional E-value: 1.2e-05 CBM35.hmm 53 rYang..tgstktlsvvvnGtkvsevtfpst.gnwdtwgt 89 Y g + +++ s++vnG+ +++v+fp + nwdt 291101|Xylpal124036_1_GeneCatalog_proteins_20190613.aa.fasta|GH27|CBM35 479 GYLGGpgNNNERLASISVNGGPAQTVSFPLSgYNWDTGIH 518 455553345667789**************9989****888 PP CBM35.hmm 90 aagtvtLk....aGkntitiks.dwGwi.nldsl 117 a v+L+ + n+i+i+ +Gw ++d++ 291101|Xylpal124036_1_GeneCatalog_proteins_20190613.aa.fasta|GH27|CBM35 519 AGYGVELSgfstQEPNSIRISGaGTGWApDFDRI 552 8888888522225556777766667776666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (558 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 192.11 // Query: 14510|Fusoxvas1_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 [L=550] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-09 23.9 2.8 7.8e-09 23.0 2.5 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.0 2.5 3.9e-09 7.8e-09 8 119 .] 422 547 .. 414 547 .. 0.80 Alignments for each domain: == domain 1 score: 23.0 bits; conditional E-value: 3.9e-09 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYel 50 l+ + +++ +g+++s+ v++l +++++v ++ ++++ + ++ 14510|Fusoxvas1_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 422 LSSGAQTASCSGCTSSTKVGNLGgSSKGQVVLSNISTSKATQNV 465 55555566789999******99844455677776667888999* PP CBM35.hmm 51 slrYang......tgstktlsvvvnGtkvsevtfpst.gnwdtw 87 + Y ng +++++ s+ vnG+ +++v+fp t nwd+ 14510|Fusoxvas1_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 466 LFDYINGdvgfggSTNERLASIKVNGGTAQTVSFPLTgYNWDKD 509 *****9855443346778889****************89****9 PP CBM35.hmm 88 gtaagtvtL....kaGkntitiks.dwGwi.nldslel 119 ++ v+L ++G ntiti+ + Gw ++d+l + 14510|Fusoxvas1_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 510 VYKGYAVELsgfnTNGPNTITISGvNGGWApDFDRLAV 547 999999***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (550 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 77.82 // Query: 334449|Altro1_GeneCatalog_proteins_20180320.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-08 22.4 4.1 2.6e-08 21.3 4.1 1.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.3 4.1 1.3e-08 2.6e-08 3 107 .. 419 535 .. 417 549 .. 0.81 Alignments for each domain: == domain 1 score: 21.3 bits; conditional E-value: 1.3e-08 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGs 47 A ++sl+ +++++ +g+++s v++l +++++vt++ +++ + 334449|Altro1_GeneCatalog_proteins_20180320.aa.fasta|GH27|CBM35 419 ASTGSLSSGATTQSCSGCTSSNKVGNLGgSSNGRVTLSNIRTSKAT 464 88899999999****************9566788999966677889 PP CBM35.hmm 48 YelslrYang......tgstktlsvvvnGtkvsevtfpst.gnwdt 86 ++ + Y ng ++++++ ++vnG+++++v+fp + nwd+ 334449|Altro1_GeneCatalog_proteins_20180320.aa.fasta|GH27|CBM35 465 QTVFFDYINGqvdymgGSNERVAAISVNGGAAKTVSFPLSgYNWDK 510 999999999854333245789999**************9989**** PP CBM35.hmm 87 wgtaagtvtL....kaGkntitiks 107 ++ v+L + G+ntiti+ 334449|Altro1_GeneCatalog_proteins_20180320.aa.fasta|GH27|CBM35 511 DVYKNYGVELsgfsTTGTNTITISG 535 999999****444458******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 193.83 // Query: 344636|Cersp1_GeneCatalog_proteins_20150406.aa.fasta|GH27|CBM35 [L=521] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-09 23.9 1.8 4.1e-09 23.9 1.8 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.1 0.34 0.69 5 34 .. 377 406 .. 376 407 .. 0.85 2 ! 23.9 1.8 2e-09 4.1e-09 2 77 .. 428 510 .. 427 515 .. 0.79 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.34 CBM35.hmm 5 dasltgvsvntnhagysGsgfvdglqaagd 34 +a+++++ + ++++g G v+ l a g+ 344636|Cersp1_GeneCatalog_proteins_20150406.aa.fasta|GH27|CBM35 377 SATIENLWTGQKKTGAMGVYSVGSLGARGS 406 688999999999999999999999988876 PP == domain 2 score: 23.9 bits; conditional E-value: 2e-09 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGs 47 eAe+asl+g + ++ +g+sG + v+++ ++g+avtf+ v k+ + 344636|Cersp1_GeneCatalog_proteins_20150406.aa.fasta|GH27|CBM35 428 EAESASLSGGASSASCSGCSGGTKVGNV-GNGGAVTFKNVVAKSTT 472 8********99**************887.999*****966666666 PP CBM35.hmm 48 Yelslr.......Yang.tgstktlsvvvnGtkvsevt 77 +l + Y +g ++++++ls++vnG+++++v+ 344636|Cersp1_GeneCatalog_proteins_20150406.aa.fasta|GH27|CBM35 473 STLLFDyinadigYLAGqGQNARSLSISVNGAAAQNVD 510 66666622222226666677899**********99886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (521 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.85 // Query: 211961|Altal1_GeneCatalog_proteins_20141010.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-08 20.1 4.0 1.4e-07 18.9 4.0 1.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.9 4.0 7.1e-08 1.4e-07 3 107 .. 419 535 .. 417 549 .. 0.80 Alignments for each domain: == domain 1 score: 18.9 bits; conditional E-value: 7.1e-08 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGs 47 A ++sl+ + +++ +g+++s v++l +++++vt++ +++ + 211961|Altal1_GeneCatalog_proteins_20141010.aa.fasta|GH27|CBM35 419 ASTGSLSSGANTQSCSGCTSSNKVGNLGgSSNGRVTISNLRTSKAT 464 7778888887888899**********98566778999977788889 PP CBM35.hmm 48 YelslrYang......tgstktlsvvvnGtkvsevtfpst.gnwdt 86 ++ + Y ng ++++++ ++vnG+++++v+fp + nwd+ 211961|Altal1_GeneCatalog_proteins_20141010.aa.fasta|GH27|CBM35 465 QTVLFDYINGqvdymgGSNERVAAISVNGGAAKTVSFPLSgYNWDK 510 999999999744333246789999**************9989**** PP CBM35.hmm 87 wgtaagtvtL....kaGkntitiks 107 ++ v+L + G+ntiti+ 211961|Altal1_GeneCatalog_proteins_20141010.aa.fasta|GH27|CBM35 511 DVYKNYGVELsgfsTTGTNTITISG 535 999999****444458******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 227.98 // Query: 75398|AurpulNBB1_GeneCatalog_proteins_20190122.aa.fasta|GH27|CBM35 [L=523] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-10 27.4 0.5 1.3e-09 25.5 0.5 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.5 0.5 6.4e-10 1.3e-09 1 106 [. 383 503 .. 383 519 .. 0.77 Alignments for each domain: == domain 1 score: 25.5 bits; conditional E-value: 6.4e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglq.aagdavtfn.vd 41 yeAe ++ g++ ++ +g+sG + v+++ ++g+++tf+ + 75398|AurpulNBB1_GeneCatalog_proteins_20190122.aa.fasta|GH27|CBM35 383 YEAEAGQFAGSAGVASCSGCSGGKKVGNVGnGNGNTLTFSgIR 425 9*********999***************983456668888544 PP CBM35.hmm 42 vpkaGsYelslr.........YangtgstktlsvvvnGtkvse 75 +++ + ++++ ++ g g+ + s++vnG+++++ 75398|AurpulNBB1_GeneCatalog_proteins_20190122.aa.fasta|GH27|CBM35 426 -TSQATQDVRFDyidceigyaFSGGYGNVRGASISVNGGAAQS 467 .3444444444422333442244558888999*********** PP CBM35.hmm 76 vtfpst.gnwdtwgtaagtvtL....kaGkntitik 106 v+fp t nwd+ t+ v L + G+ntiti+ 75398|AurpulNBB1_GeneCatalog_proteins_20190122.aa.fasta|GH27|CBM35 468 VSFPLTgYNWDKDITKGFLVRLsgfkTSGDNTITIS 503 ******89****888888899944444899999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (523 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.24 // Query: UQC90052.1|CBM35|GH27 [L=554] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-08 22.2 3.1 2.5e-08 21.4 2.3 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.4 2.3 1.2e-08 2.5e-08 8 107 .. 425 538 .. 418 552 .. 0.73 Alignments for each domain: == domain 1 score: 21.4 bits; conditional E-value: 1.2e-08 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYelslrYang.......tgstktlsvvvnGtkvsevtfpst.gnwd 85 l+ + ++ +g+++s v++l ++++ v nv kaG+ ++ + Y ng + +++ s++vnG+++++v+fp + nw+ UQC90052.1|CBM35|GH27 425 LSSGANLQSCSGCTSSNKVGNLGGSSNGrvVLSNVSTSKAGTQTVLFDYINGdvgylggSNNERLASISVNGGAAQTVSFPLSgYNWS 512 5555555678999*******99844333336677**************8887332222245678899**************99889*9 PP CBM35.hmm 86 twgtaagtvtLk....aGkntitiks 107 + v+L+ G+nti+i+ UQC90052.1|CBM35|GH27 513 ADVFKGYAVELTgftaGGANTISISG 538 96666677777633334899999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (554 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.68 // Query: USW55247.1|CBM35|GH27 [L=547] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-09 25.7 0.1 3.4e-09 24.2 0.1 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 24.2 0.1 1.7e-09 3.4e-09 2 112 .. 406 529 .. 405 540 .. 0.80 Alignments for each domain: == domain 1 score: 24.2 bits; conditional E-value: 1.7e-09 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslr.......Yang.tgstktlsvvvnGtkvsevtfps 80 eAe++ g + ++ +g+sG + v+++ ++g+ +tf+ + +++ + ++++ Y ++ + +++ +++vnG+ ++v fp USW55247.1|CBM35|GH27 406 EAESGAAAGGANVQSCSGCSGGSKVGYIGNDGGFLTFSgI-RTSQATQNVRFDyldceigYLSDqGPNARGANISVNGGPGQSVIFPL 492 89******9888899**********************954.4566666776664444444777767889999**************** PP CBM35.hmm 81 t.gnwdtwgtaagtvtL....kaGkntitiksdwGwi 112 t nwd+ t+ v L + G+nti+i+ +G++ USW55247.1|CBM35|GH27 493 TgWNWDKDVTKNHLVRLsgfsTTGTNTIKISGLSGNT 529 *889**98889999999555558*******9855554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (547 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 184.99 // Query: 186136|Meimi1_GeneCatalog_proteins_20150112.aa.fasta|GH27|CBM35 [L=566] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-06 15.2 2.5 4.1e-06 14.2 0.4 2.5 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.63 1.3 88 109 .. 62 83 .. 54 89 .. 0.71 2 ? -0.6 0.0 0.082 0.16 8 28 .. 382 402 .. 378 411 .. 0.80 3 ! 14.2 0.4 2.1e-06 4.1e-06 15 112 .. 446 555 .. 432 563 .. 0.68 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.63 CBM35.hmm 88 gtaagtvtLkaGkntitiksdw 109 +t +++ +L aG+ ++i+ w 186136|Meimi1_GeneCatalog_proteins_20150112.aa.fasta|GH27|CBM35 62 NTMQKDGYLAAGYDLFSIDCGW 83 5667777899999999988643 PP == domain 2 score: -0.6 bits; conditional E-value: 0.082 CBM35.hmm 8 ltgvsvntnhagysGsgfvdg 28 +t+++v+ +gy+Gsg ++ 186136|Meimi1_GeneCatalog_proteins_20150112.aa.fasta|GH27|CBM35 382 ITKANVEDLISGYTGSGASSY 402 77888999999*****98765 PP == domain 3 score: 14.2 bits; conditional E-value: 2.1e-06 CBM35.hmm 15 tnhagysGsgfvdglq.aagdavtfn.vdvpkaGsYelslrYang. 57 + + + G + v+++ ++++++tf+ +v++a ++ + Y n 186136|Meimi1_GeneCatalog_proteins_20150112.aa.fasta|GH27|CBM35 446 QVCSACPGGKKVGYIGnGTNNSLTFDnLKVNSAN-ATILFDYLNCd 490 4445566666666665245667888877876654.46666666543 PP CBM35.hmm 58 .....tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL. 96 +++ +t s++vnG++ +v+fp + nwd t+ v L 186136|Meimi1_GeneCatalog_proteins_20150112.aa.fasta|GH27|CBM35 491 vtvtsSTNMRTGSISVNGGEPVDVSFPISgYNWDASITHNYRVALs 536 322125677899***************9989****99999999994 PP CBM35.hmm 97 ..kaG.kntitiksdwGwi 112 k G +n+i+i+s +G+ 186136|Meimi1_GeneCatalog_proteins_20150112.aa.fasta|GH27|CBM35 537 gfKPGsSNSINITSTSGYA 555 4446745999999999986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (566 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 2 (1); expected 0.0 (0.02) Passed bias filter: 2 (1); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.50 // Query: 284684|Rhodsp1_GeneCatalog_proteins_20150111.aa.fasta|GH27|CBM35 [L=556] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-08 20.7 1.2 1.5e-07 18.9 1.2 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.9 1.2 7.3e-08 1.5e-07 1 86 [. 422 512 .. 422 524 .. 0.78 Alignments for each domain: == domain 1 score: 18.9 bits; conditional E-value: 7.3e-08 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpka 45 yeAe a+l++ +v + ag+sG ++v+++ +++tfn + k+ 284684|Rhodsp1_GeneCatalog_proteins_20150111.aa.fasta|GH27|CBM35 422 YEAEAATLSAGAVAQACAGCSGGKNVGYV----GTLTFNNVASKG 462 9*************************998....899999888999 PP CBM35.hmm 46 GsYelslrYang....tgstkt....lsvvvnGtkvsevtfpst. 81 + ++ + Y n+ g+++t +v vnG++ +ev fp + 284684|Rhodsp1_GeneCatalog_proteins_20150111.aa.fasta|GH27|CBM35 463 TTQTVFFDYVNAnisyLGTNSTsaigANVRVNGGSPQEVLFPLSg 507 9999999998874432122222112257899***********997 PP CBM35.hmm 82 gnwdt 86 nw++ 284684|Rhodsp1_GeneCatalog_proteins_20150111.aa.fasta|GH27|CBM35 508 YNWGE 512 78988 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (556 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 219.00 // Query: 297980|Acain1_GeneCatalog_proteins_20150309.aa.fasta|GH27|CBM35 [L=553] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-08 20.4 0.0 1.3e-07 19.1 0.0 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.1 0.0 6.4e-08 1.3e-07 2 87 .. 421 514 .. 420 550 .. 0.78 Alignments for each domain: == domain 1 score: 19.1 bits; conditional E-value: 6.4e-08 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaG 46 eAe+a +g+ + + +g+sG v+++++ g+++ fn v++ ++ 297980|Acain1_GeneCatalog_proteins_20150309.aa.fasta|GH27|CBM35 421 EAENAAREGTVAVAPCSGCSGGEKVGDISGYGNNLIFNnVEASQSS 466 9********99999***********************999998886 PP CBM35.hmm 47 s.....Y.elslrYangtgstktlsvvvnGtkvsevtfpst.gnwd 85 Y + ++ Y ++ ++++ ++ vnG++ ++v+fp t +wd 297980|Acain1_GeneCatalog_proteins_20150309.aa.fasta|GH27|CBM35 467 VtvlfdYvNCEIGYLGNGLNERKARIAVNGGDPQDVNFPITgYSWD 512 5111112255788999999********************9977888 PP CBM35.hmm 86 tw 87 297980|Acain1_GeneCatalog_proteins_20150309.aa.fasta|GH27|CBM35 513 GD 514 64 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (553 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 193.43 // Query: 71536|Aurpu_var_sub1_GeneCatalog_proteins_20120515.aa.fasta|GH27|CBM35 [L=523] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-10 29.0 0.5 3.9e-10 27.2 0.5 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.2 0.5 2e-10 3.9e-10 1 106 [. 383 503 .. 383 519 .. 0.77 Alignments for each domain: == domain 1 score: 27.2 bits; conditional E-value: 2e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglq.aagdavtfn 39 yeAe a++ g++ ++ +g+sG + v+++ +ag+++tf+ 71536|Aurpu_var_sub1_GeneCatalog_proteins_20120515.aa.fasta|GH27|CBM35 383 YEAEAAKVAGSAGVASCSGCSGGKKVGNVGnGAGNTLTFT 422 9*********99****************984677789999 PP CBM35.hmm 40 .vdvpkaGsYelslr.........Yangtgstktlsvvvn 69 + +++ + ++++ ++ g g+ + s++vn 71536|Aurpu_var_sub1_GeneCatalog_proteins_20120515.aa.fasta|GH27|CBM35 423 gIR-TSQATQDVRFDyidceigyaFSGGYGNVRGASISVN 461 644.4444444444422444442244457888999***** PP CBM35.hmm 70 Gtkvsevtfpst.gnwdtwgtaagtvtL....kaGkntit 104 G+++++v+fp t nwd+ t+ v L + G+nti+ 71536|Aurpu_var_sub1_GeneCatalog_proteins_20120515.aa.fasta|GH27|CBM35 462 GGAAQSVSFPLTgYNWDKDVTKGFLVRLsgfsTSGDNTIS 501 ************88****7777778899444447999998 PP CBM35.hmm 105 ik 106 i+ 71536|Aurpu_var_sub1_GeneCatalog_proteins_20120515.aa.fasta|GH27|CBM35 502 IS 503 86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (523 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.44 // Query: 4341|Fuspro1_GeneCatalog_proteins_20210311.aa.fasta|GH27|CBM35 [L=494] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-06 15.2 1.3 1.4e-05 12.5 0.3 2.7 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.0 0.067 0.13 49 85 .. 108 142 .. 87 148 .. 0.85 2 ? -3.3 0.0 0.53 1.1 41 56 .. 282 297 .. 266 310 .. 0.62 3 ! 12.5 0.3 6.9e-06 1.4e-05 21 86 .. 371 446 .. 357 457 .. 0.74 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.067 CBM35.hmm 49 elslrYangtgstktlsvvvnGtkvsevtfpstgnwd 85 +l rY n s++ ++v +nG v e +p++g+ d 4341|Fuspro1_GeneCatalog_proteins_20210311.aa.fasta|GH27|CBM35 108 TLVQRYTN--LSNALRDVGINGMMVCEWALPANGDVD 142 57778998..5999999*****999999999998765 PP == domain 2 score: -3.3 bits; conditional E-value: 0.53 CBM35.hmm 41 dvpkaGsYelslrYan 56 ++ k+G+Y l ++ n 4341|Fuspro1_GeneCatalog_proteins_20210311.aa.fasta|GH27|CBM35 282 QSGKGGNYYLDFNSLN 297 4567777777777666 PP == domain 3 score: 12.5 bits; conditional E-value: 6.9e-06 CBM35.hmm 21 sGsgfvdglq.aagdavtfn.vdvpkaGsYelslr.......Yang. 57 ++ g+v+g q + g++vtf+ ++ +++ + +++++ Y n+ 4341|Fuspro1_GeneCatalog_proteins_20210311.aa.fasta|GH27|CBM35 371 KAAGYVGGKQsDGGGSVTFTgIK-TSKATQNIKINyinceiiYPNEs 416 5789999998456778****665.45566677777224444455655 PP CBM35.hmm 58 tgstktlsvvvnGtkvsevtfpst.gnwdt 86 + +++ +++vnG+++ ++ fp + +w+ 4341|Fuspro1_GeneCatalog_proteins_20210311.aa.fasta|GH27|CBM35 417 GPNARGARISVNGANSVNILFPVSgYSWTA 446 67888899**************99667765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (494 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.22 // Query: 11640|Ustma2_2_GeneCatalog_proteins_20171205.aa.fasta|GH27|CBM35 [L=573] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-07 17.4 1.0 4.3e-07 17.4 1.0 2.8 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 0.0 0.86 1.7 108 117 .. 249 258 .. 230 258 .. 0.79 2 ? -1.7 0.0 0.18 0.35 63 84 .. 375 396 .. 361 430 .. 0.57 3 ! 17.4 1.0 2.1e-07 4.3e-07 2 107 .. 438 557 .. 437 569 .. 0.73 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 0.86 CBM35.hmm 108 dwGwinldsl 117 +Gwin++++ 11640|Ustma2_2_GeneCatalog_proteins_20171205.aa.fasta|GH27|CBM35 249 ATGWINVERI 258 6899999876 PP == domain 2 score: -1.7 bits; conditional E-value: 0.18 CBM35.hmm 63 tlsvvvnGtkvsevtfpstgnw 84 ++++vn ++ + ++ + + w 11640|Ustma2_2_GeneCatalog_proteins_20171205.aa.fasta|GH27|CBM35 375 RNTITVNFSELGIASADVADLW 396 4444444444443333333333 PP == domain 3 score: 17.4 bits; conditional E-value: 2.1e-07 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpk 44 +Ae+++l g ++++ +g+sG v+++ ++g+++t+n ++ + 11640|Ustma2_2_GeneCatalog_proteins_20171205.aa.fasta|GH27|CBM35 438 QAESGTLAGRAAKSFCSGCSGGAKVGNVGgGSGNTLTLNgLQA-S 481 7**************************9845566688885555.5 PP CBM35.hmm 45 aGsYelslrYang........tgstktlsvvvnGtkvsevtfpst 81 + + l + Y n+ ++++t ++vnG++ ++v+fp + 11640|Ustma2_2_GeneCatalog_proteins_20171205.aa.fasta|GH27|CBM35 482 GNEAVLYFDYINAdvgfsfvgATNDRTAHISVNGGSPQTVSFPLS 526 5566677777775221111125799******************99 PP CBM35.hmm 82 .gnwdtwgtaagtvtL...kaGk.ntitiks 107 +w++ +v L +aG+ n+iti++ 11640|Ustma2_2_GeneCatalog_proteins_20171205.aa.fasta|GH27|CBM35 527 gYDWSQDVIRGYKVRLtgfTAGQsNSITISN 557 7899996666667777333588448888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (573 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.62 // Query: 416402|XylFL0255_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 [L=553] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-08 20.8 0.8 9.7e-08 19.5 0.8 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.5 0.8 4.8e-08 9.7e-08 3 118 .. 419 549 .. 416 550 .. 0.76 Alignments for each domain: == domain 1 score: 19.5 bits; conditional E-value: 4.8e-08 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglqaagda..vtfnvdvp 43 A +++l++ +v ++ +g+s +v++l +++d v ++ + 416402|XylFL0255_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 419 ATTGTLSNGAVVQSCSGCSNGENVGYLGGSEDGklVLSGITTT 461 7788999989999999999999999998666655433335544 PP CBM35.hmm 44 kaGsY......elslrYangtgstktlsvvvnGtkvsevtfps 80 +a + + + Y g+++++ s++vn +++ +v+fp 416402|XylFL0255_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 462 EASQNvlfdyiNCDVDYGGGGSNERLASISVNEGAAVTVSFPM 504 443320000024455688889999******************* PP CBM35.hmm 81 t.gnwdtwgtaagtvtL....kaGkntitiks.dwGwi.nlds 116 t nw + ++ v L + G+ntiti+ +G+ +ld+ 416402|XylFL0255_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 505 TgYNWVEDIYKSYPVALsgfsTTGTNTITISGsGTGYApDLDR 547 *88****9999******555558*******9989999989999 PP CBM35.hmm 117 le 118 + 416402|XylFL0255_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 548 IG 549 85 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (553 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 86.95 // Query: 688696|Fusco1_GeneCatalog_proteins_20180421.aa.fasta|GH27|CBM35 [L=550] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-09 24.2 2.9 8.2e-09 22.9 2.9 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.9 2.9 4.1e-09 8.2e-09 7 119 .] 421 547 .. 414 547 .. 0.81 Alignments for each domain: == domain 1 score: 22.9 bits; conditional E-value: 4.1e-09 CBM35.hmm 7 sltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYels 51 sl+ + +++ +g+++s+ v++l +++++v ++ ++++ + ++ 688696|Fusco1_GeneCatalog_proteins_20180421.aa.fasta|GH27|CBM35 421 SLSSGAKTASCSGCTSSTKVGNLGgSSNGQVVLSNISTSKATQNVL 466 5555556677899*********985556667777666788999*** PP CBM35.hmm 52 lrYang......tgstktlsvvvnGtkvsevtfpst.gnwdtwgta 90 + Y ng +++++ s+ vnG+ +++v+fp t nwd+ ++ 688696|Fusco1_GeneCatalog_proteins_20180421.aa.fasta|GH27|CBM35 467 FDYINGdvgfggSTNERLASIKVNGGTAQTVSFPLTgYNWDKDVYK 512 ****9855443346778889****************89****9999 PP CBM35.hmm 91 agtvtL....kaGkntitiks.dwGwi.nldslel 119 v+L ++G ntiti+ + Gw ++d+l + 688696|Fusco1_GeneCatalog_proteins_20180421.aa.fasta|GH27|CBM35 513 GYAVELsgfnTNGPNTITISGvNGGWApDFDRLAV 547 999***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (550 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 184.19 // Query: 474952|Xyldig1_GeneCatalog_proteins_20190718.aa.fasta|GH27|CBM35 [L=575] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-05 13.0 0.5 2e-05 12.0 0.5 1.5 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 12.0 0.5 9.9e-06 2e-05 18 118 .. 447 551 .. 423 552 .. 0.68 Alignments for each domain: == domain 1 score: 12.0 bits; conditional E-value: 9.9e-06 CBM35.hmm 18 agysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstk 62 g s++g v + +++v +v+ + + ++ Y ++ +++ 474952|Xyldig1_GeneCatalog_proteins_20190718.aa.fasta|GH27|CBM35 447 IGGSSNGSVVLSNVRTSQVNQTVKF---DYINCEVGYLGSGNNER 488 3444444444444444445555544...3447788899999999* PP CBM35.hmm 63 tlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtLk....aGknt 102 s++vnG+ ++ v+fp + nw t ++ v+L+ + n+ 474952|Xyldig1_GeneCatalog_proteins_20190718.aa.fasta|GH27|CBM35 489 LASISVNGKPAQIVSFPLSgYNWATDIYKGYGVELSgfntEKPNS 533 *****************9988****88888999996111133466 PP CBM35.hmm 103 itiks.dwGwi.nldsle 118 i+i+ +Gw +ld++ 474952|Xyldig1_GeneCatalog_proteins_20190718.aa.fasta|GH27|CBM35 534 IRISGvGTGWApDLDQIA 551 777768888887888876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (575 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 211.95 // Query: 241924|Hyparg1_GeneCatalog_proteins_20190711.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-09 25.0 2.1 4.7e-09 23.7 1.1 2.3 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.18 0.36 60 99 .. 385 424 .. 373 433 .. 0.58 2 ! 23.7 1.1 2.3e-09 4.7e-09 17 118 .. 435 551 .. 421 552 .. 0.73 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.18 CBM35.hmm 60 stktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaG 99 s+++ s vnG+ + + + + + +t +t+ + +L++G 241924|Hyparg1_GeneCatalog_proteins_20190711.aa.fasta|GH27|CBM35 385 SASSYSKLVNGHGSMALRLSNIQRASTSATTYTYSSLTKG 424 5556666777777775555555555444444444444444 PP == domain 2 score: 23.7 bits; conditional E-value: 2.3e-09 CBM35.hmm 17 hagysGsgfvdglq.aagdavtfn.vdvpkaGsYelslr...... 53 +g+ +s+ v++l a++++v ++ + +++ s +++++ 241924|Hyparg1_GeneCatalog_proteins_20190711.aa.fasta|GH27|CBM35 435 CSGCASSSKVGNLGgASNGSVVLSnIR-TSQASQTVRFNyingev 478 567777777777763334445444144.45566677777223333 PP CBM35.hmm 54 .YangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL 96 Y n++++++ s++vnG+ +++v+fp + nwd+ ++ v L 241924|Hyparg1_GeneCatalog_proteins_20190711.aa.fasta|GH27|CBM35 479 aYTNSGSNERLASISVNGGPAQTVSFPLSgYNWDSDIYSGYGVDL 523 355666778889***************9989****999999**** PP CBM35.hmm 97 ....kaGkntitiks.dwGwi.nldsle 118 ++G+n+iti+ +Gw ++d++ 241924|Hyparg1_GeneCatalog_proteins_20190711.aa.fasta|GH27|CBM35 524 sgfnTQGSNSITISGsGTGWApDFDQIG 551 555559*******99899**98999985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 73.08 // Query: 16131|Fuspro1_GeneCatalog_proteins_20210311.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-08 22.2 1.5 4.6e-08 20.5 1.5 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.5 1.5 2.3e-08 4.6e-08 5 119 .] 428 549 .. 420 549 .. 0.75 Alignments for each domain: == domain 1 score: 20.5 bits; conditional E-value: 2.3e-08 CBM35.hmm 5 dasltg..vsvntnhagysGsgfvdglqaagdavtfnvdvp.kaGs 47 +as +g +s++ + g s +g v + ++++vt nv + +G+ 16131|Fuspro1_GeneCatalog_proteins_20210311.aa.fasta|GH27|CBM35 428 TASCSGctSSTKVGNVGGSTNGQVVLSNISTSKVTQNVLFDfINGD 473 5555554445555556666666666666677777777766413444 PP CBM35.hmm 48 YelslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaag 92 + +++ +++++ s+ vnG+ +++v+fp t nwd+ ++ 16131|Fuspro1_GeneCatalog_proteins_20210311.aa.fasta|GH27|CBM35 474 --VGFSFTG-STNDRLASIKVNGGTAQTVSFPLTgYNWDKDVYKGY 516 ..5555554.679*********************89****999999 PP CBM35.hmm 93 tvtL....kaGkntitiks.dwGwi.nldslel 119 v+L + G ntiti+ + Gw ++d+l + 16131|Fuspro1_GeneCatalog_proteins_20210311.aa.fasta|GH27|CBM35 517 AVELsgfkTSGPNTITISGvNGGWApDFDRLAV 549 9***555558********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 199.91 // Query: 169182|ChetPR9b_4_GeneCatalog_proteins_20220623.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-08 21.1 2.3 7e-08 19.9 2.3 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.9 2.3 3.5e-08 7e-08 15 107 .. 431 535 .. 418 549 .. 0.77 Alignments for each domain: == domain 1 score: 19.9 bits; conditional E-value: 3.5e-08 CBM35.hmm 15 tnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYa 55 + +g+++s v+++ ++g++vt++ +++ + ++++ Y 169182|ChetPR9b_4_GeneCatalog_proteins_20220623.aa.fasta|GH27|CBM35 431 SPCSGCTSSNKVGNIGgSNGGRVTLSNIRTSKATQTVRFDYI 472 456799999999999867888999996667788999999999 PP CBM35.hmm 56 ng......tgstktlsvvvnGtkvsevtfpst.gnwdtwgta 90 ng ++++++ s++vnG+++++v+fp t nw+ ++ 169182|ChetPR9b_4_GeneCatalog_proteins_20220623.aa.fasta|GH27|CBM35 473 NGnvdymgGTNERVASISVNGGAAKTVSFPLTgYNWNVDVSK 514 975533334678999*****************88***99999 PP CBM35.hmm 91 agtvtL....kaGkntitiks 107 v+L + G ntiti 169182|ChetPR9b_4_GeneCatalog_proteins_20220623.aa.fasta|GH27|CBM35 515 NYGVELsgfsTTGPNTITIAG 535 999999444447999999975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 192.55 // Query: 519366|Xylcas124033_1_GeneCatalog_proteins_20190614.aa.fasta|GH27|CBM35 [L=564] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-07 19.4 0.4 2.3e-07 18.3 0.4 1.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.3 0.4 1.2e-07 2.3e-07 18 119 .] 436 552 .. 422 552 .. 0.69 Alignments for each domain: == domain 1 score: 18.3 bits; conditional E-value: 1.2e-07 CBM35.hmm 18 agysGsgfvdglq.aagda.vtfnvdvpkaGsYelslr.. 53 +g+ +s+ v++l +++++ v nv + + ++++ 519366|Xylcas124033_1_GeneCatalog_proteins_20190614.aa.fasta|GH27|CBM35 436 TGCASSTKVGNLGgSSNGSvVLSNVRTS-QANQTVKFDyi 474 5666666777666322333134445543.33444444411 PP CBM35.hmm 54 .....YangtgstktlsvvvnGtkvsevtfpst.gnwdtw 87 Y ++ +++ s++vnG ++ v+fp + nw t 519366|Xylcas124033_1_GeneCatalog_proteins_20190614.aa.fasta|GH27|CBM35 475 ncevgYLGSSNNERLASISVNGRPAQIVSFPLSgYNWATD 514 1111166678889999***************9989****9 PP CBM35.hmm 88 gtaagtvtL....kaGkntitiks.dwGwi.nldslel 119 +++ v+L ++G+n+i+i+ Gw ++d++ + 519366|Xylcas124033_1_GeneCatalog_proteins_20190614.aa.fasta|GH27|CBM35 515 TYVGYGVELsgfnTEGSNSIRISGaGAGWApDFDRIAV 552 99999****555559*******99999**999999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (564 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 193.51 // Query: 449530|NeFL0031_2_GeneCatalog_proteins_20191109.aa.fasta|GH27|CBM35 [L=554] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-07 18.2 0.3 6.3e-07 16.8 0.3 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.8 0.3 3.2e-07 6.3e-07 17 119 .] 434 551 .. 419 551 .. 0.71 Alignments for each domain: == domain 1 score: 16.8 bits; conditional E-value: 3.2e-07 CBM35.hmm 17 hagysGsgfvdglq.aagda.vtfnvdvpkaGsYelslr... 53 ag+ +s+ v++l +++++ v nv ++ + ++++ 449530|NeFL0031_2_GeneCatalog_proteins_20191109.aa.fasta|GH27|CBM35 434 CAGCASSSKVGNLGgSSNGSvVLSNVRT-SQANQTVKFDyin 474 5667777777777632333314444554.3344455555111 PP CBM35.hmm 54 ....YangtgstktlsvvvnGtkvsevtfpst.gnwdtwgta 90 Y ++++++ s++vnG+ ++ v+fp + nw +a 449530|NeFL0031_2_GeneCatalog_proteins_20191109.aa.fasta|GH27|CBM35 475 cevaYTGSGSNERLASISVNGNPAKVVSFPLSgYNWAIDISA 516 222266668889999***************998899998999 PP CBM35.hmm 91 agtvtL....kaGkntitiks.dwGwi.nldslel 119 v+L ++G n+iti+ +Gw ++d++ + 449530|NeFL0031_2_GeneCatalog_proteins_20191109.aa.fasta|GH27|CBM35 517 GYGVELsgfsTEGPNSITISGaGTGWApDFDRIAV 551 9*****555559*******9999***999999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (554 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 187.32 // Query: 511762|Lepor2_GeneCatalog_proteins_20171210.aa.fasta|GH27|CBM35 [L=525] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-08 22.3 0.1 5e-08 20.4 0.0 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.0 0.34 0.68 59 84 .. 321 346 .. 318 354 .. 0.73 2 ! 20.4 0.0 2.5e-08 5e-08 2 119 .] 388 522 .. 387 522 .. 0.79 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.34 CBM35.hmm 59 gstktlsvvvnGtkvsevtfpstgnw 84 +s+k +++ vn t+v+ + ++ + w 511762|Lepor2_GeneCatalog_proteins_20171210.aa.fasta|GH27|CBM35 321 HSNKARTLAVNLTAVGISSATARDLW 346 57889999999888886655555555 PP == domain 2 score: 20.4 bits; conditional E-value: 2.5e-08 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdgl.qaagdavtfnvdvpkaG 46 eAe+a+l + ++ ++ +g+s + v++l +++++++tf+ ++++ 511762|Lepor2_GeneCatalog_proteins_20171210.aa.fasta|GH27|CBM35 388 EAESATLANGAAIASCPGCSNGQKVGNLlSGSTASLTFTGIATSQS 433 8********99999999999888888861578888****8899999 PP CBM35.hmm 47 sYelslrYangtg........stktlsvvvnGtkvsevtfpst.gn 83 + ++ + Y n + + +t s++vnG+++ +v fp + n 511762|Lepor2_GeneCatalog_proteins_20171210.aa.fasta|GH27|CBM35 434 TVDVLFDYINCEVqylgssvpNVRTASISVNGGAAVTVLFPLSgYN 479 9999999888643112222225699****************99889 PP CBM35.hmm 84 wdtwgtaagtvtLk....aGkntitiks..dwGwi.nldslel 119 w+ +v L+ G+nti+i+s +G ++d++++ 511762|Lepor2_GeneCatalog_proteins_20171210.aa.fasta|GH27|CBM35 480 WSGDVLPSYKVRLSgfksGGQNTISIQSasGQGHApDIDRIRV 522 *998888999999633336*********776666568998876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (525 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.75 // Query: 257216|Horac1_GeneCatalog_proteins_20160326.aa.fasta|GH27|CBM35 [L=521] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 0.00011 9.6 7.9 2.8e-05 11.5 2.5 2.7 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.19 0.37 26 70 .. 116 158 .. 112 174 .. 0.76 2 ? -1.5 0.1 0.15 0.3 63 86 .. 322 345 .. 316 372 .. 0.61 3 ! 11.5 2.5 1.4e-05 2.8e-05 5 97 .. 388 487 .. 384 510 .. 0.64 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.19 CBM35.hmm 26 vdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnG 70 v +++ ++ +vt n d+pk+ + ++ rY n +s++ + v ++G 257216|Horac1_GeneCatalog_proteins_20160326.aa.fasta|GH27|CBM35 116 VAYMKVDNCYVTANEDAPKTPMTDFPSRYGN--MSNALRAVGIEG 158 6677778888999999999999999999999..466666666666 PP == domain 2 score: -1.5 bits; conditional E-value: 0.15 CBM35.hmm 63 tlsvvvnGtkvsevtfpstgnwdt 86 ++s++v+ ++v+ ++ ++t+ w+ 257216|Horac1_GeneCatalog_proteins_20160326.aa.fasta|GH27|CBM35 322 SRSLTVDFEQVDVASATATNLWTG 345 556666666666666555555554 PP == domain 3 score: 11.5 bits; conditional E-value: 1.4e-05 CBM35.hmm 5 dasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYe 49 ++++ g + ++ +g+ + v++l ++g+++tfn v+ ++a + + 257216|Horac1_GeneCatalog_proteins_20160326.aa.fasta|GH27|CBM35 388 TGTIAGGANVQSCSGCANGQKVGYL-GSGGTLTFNnVE-TSATTQN 431 5555554444455555555666666.666666666344.4444555 PP CBM35.hmm 50 lslr.......YangtgstktlsvvvnGtkvsevtfpst.gnwdtw 87 +++ Y n++ + + s++vnG++ v fp t nw+ 257216|Horac1_GeneCatalog_proteins_20160326.aa.fasta|GH27|CBM35 432 VRFDyincdvsYTNDGENVRGASISVNGGAGVPVLFPLTgYNWSAN 477 55542222222777788888999****************889*997 PP CBM35.hmm 88 gtaagtvtLk 97 t+ v+L+ 257216|Horac1_GeneCatalog_proteins_20160326.aa.fasta|GH27|CBM35 478 VTQNFLVELS 487 7777777774 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (521 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 147.46 // Query: 627374|Fusre1_GeneCatalog_proteins_20170625.aa.fasta|GH27|CBM35 [L=550] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-08 22.4 2.3 2.7e-08 21.2 2.3 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.2 2.3 1.4e-08 2.7e-08 7 119 .] 421 547 .. 414 547 .. 0.79 Alignments for each domain: == domain 1 score: 21.2 bits; conditional E-value: 1.4e-08 CBM35.hmm 7 sltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpkaGsYel 50 sl+ + +++ +g+++s+ v++l +++++v ++ + +++ + ++ 627374|Fusre1_GeneCatalog_proteins_20170625.aa.fasta|GH27|CBM35 421 SLSSGAKTASCSGCTSSTKVGNLGgSSNGQVVLSnIR-TSKATQNV 465 5555556677899999****99984444555555266.56688999 PP CBM35.hmm 51 slrYang......tgstktlsvvvnGtkvsevtfpst.gnwdtwgt 89 + Y ng +++++ s+ vnG+ +++v+fp + nwd+ + 627374|Fusre1_GeneCatalog_proteins_20170625.aa.fasta|GH27|CBM35 466 LFDYINGdvgfggSTNERLASIKVNGGTAQTVSFPLSgYNWDKDVY 511 9***99855443346778889**************9989****999 PP CBM35.hmm 90 aagtvtL....kaGkntitiks.dwGwi.nldslel 119 + v+L ++G ntiti+ + Gw ++d+l + 627374|Fusre1_GeneCatalog_proteins_20170625.aa.fasta|GH27|CBM35 512 KGYAVELsgfnTNGPNTITISGvNGGWApDFDRLAV 547 9999***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (550 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 173.54 // Query: 348373|Xylgra1_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 [L=560] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-06 14.9 0.1 7.1e-06 13.5 0.1 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 13.5 0.1 3.5e-06 7.1e-06 18 118 .. 436 552 .. 423 553 .. 0.64 Alignments for each domain: == domain 1 score: 13.5 bits; conditional E-value: 3.5e-06 CBM35.hmm 18 agysGsgfvdglq.aagdavtfn.vdvpkaGsYelslrYan.... 56 ag+ +s+ v++l +++++v ++ v +++ + ++++ Y n 348373|Xylgra1_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 436 AGCASSTKVGNLGgSSNGSVVLSnVR-TSRANQTVKFDYINcevg 479 55666666666653223333333144.344455555555441111 PP CBM35.hmm 57 ...g.tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL 96 + +++ s++vnG+ +++v+fp + nwdt ++ v+L 348373|Xylgra1_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 480 ylgSgINNERLASISVNGGPAQTVSFPLSgYNWDTDIHTDYGVEL 524 111335678899***************9989****9899999999 PP CBM35.hmm 97 kaGk....ntitiks.dwGwi.nldsle 118 + + n+i+i++ +Gw ++d++ 348373|Xylgra1_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 525 SGFNadepNSIRISAaGTGWApDFDRIA 552 7433333488888888888887888876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (560 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.12 // Query: 172870|Meimi1_GeneCatalog_proteins_20150112.aa.fasta|GH27|CBM35 [L=565] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-09 23.9 3.6 8.2e-09 22.9 1.1 2.6 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.1 0.1 0.057 0.11 31 56 .. 394 422 .. 366 429 .. 0.70 2 ! 22.9 1.1 4.1e-09 8.2e-09 3 117 .. 433 560 .. 431 562 .. 0.74 Alignments for each domain: == domain 1 score: -0.1 bits; conditional E-value: 0.057 CBM35.hmm 31 aagdavtfnvdvpkaGsYelslr...Yan 56 +++da +++ +v++ Gs +l+l+ Y+n 172870|Meimi1_GeneCatalog_proteins_20150112.aa.fasta|GH27|CBM35 394 TKQDASSYTANVDEHGSIALRLSsikYSN 422 67788889999999999999887444555 PP == domain 2 score: 22.9 bits; conditional E-value: 4.1e-09 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpkaG 46 A +++l g + ++ +g++G + v+++ ++g++vtf+ ++ +++ 172870|Meimi1_GeneCatalog_proteins_20150112.aa.fasta|GH27|CBM35 433 ATSGKLAGDTNVQDCSGCTGGKKVGDIGnGSGNTVTFDnIN-TSGS 477 7899999999999*************983456669999554.3444 PP CBM35.hmm 47 sYelslr.......YangtgstktlsvvvnGtkvsevtfpst.gnw 84 + ++ + Y n ++++++ +++vnG++ +v+fp + nw 172870|Meimi1_GeneCatalog_proteins_20150112.aa.fasta|GH27|CBM35 478 TATILFDyinceigYLNMGTNARNATISVNGGSPVTVNFPLSgYNW 523 44443332233333999999********************9988** PP CBM35.hmm 85 dtwgtaagtvtL...kaGk.ntitiksdwGwinldsl 117 d + v+L kaG+ n+i+i+ ++ +ld++ 172870|Meimi1_GeneCatalog_proteins_20150112.aa.fasta|GH27|CBM35 524 DADIAHNYRVSLdgfKAGSgNSIQIGGSTYGPDLDRI 560 *987777888884445776577777776666666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (565 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.02 // Query: 4425|FusoxFo47_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 [L=550] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-09 24.2 2.9 8.2e-09 22.9 2.9 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.9 2.9 4.1e-09 8.2e-09 7 119 .] 421 547 .. 414 547 .. 0.81 Alignments for each domain: == domain 1 score: 22.9 bits; conditional E-value: 4.1e-09 CBM35.hmm 7 sltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYel 50 sl+ + +++ +g+++s+ v++l +++++v ++ ++++ + ++ 4425|FusoxFo47_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 421 SLSSGAKTASCSGCTSSTKVGNLGgSSNGQVVLSNISTSKATQNV 465 5555556677899*********985556667777666788999** PP CBM35.hmm 51 slrYang......tgstktlsvvvnGtkvsevtfpst.gnwdtwg 88 + Y ng +++++ s+ vnG+ +++v+fp t nwd+ 4425|FusoxFo47_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 466 LFDYINGdvgfggSTNERLASIKVNGGTAQTVSFPLTgYNWDKDV 510 *****9855443346778889****************89****99 PP CBM35.hmm 89 taagtvtL....kaGkntitiks.dwGwi.nldslel 119 ++ v+L ++G ntiti+ + Gw ++d+l + 4425|FusoxFo47_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 511 YKGYAVELsgfnTNGPNTITISGvNGGWApDFDRLAV 547 99999***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (550 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 188.67 // Query: 118752|Xylven1_GeneCatalog_proteins_20190325.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-06 15.9 0.2 2.9e-06 14.7 0.2 1.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 14.7 0.2 1.5e-06 2.9e-06 49 117 .. 475 550 .. 423 551 .. 0.81 Alignments for each domain: == domain 1 score: 14.7 bits; conditional E-value: 1.5e-06 CBM35.hmm 49 elslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaag 92 + ++ Y ++ +++ s+ vnG+ +++v+fp + +w + ++ 118752|Xylven1_GeneCatalog_proteins_20190325.aa.fasta|GH27|CBM35 475 NCEIGYLGSSNNERLASIRVNGGPAQTVSFPISgYDWASDVYKGY 519 5567898889999******************99789999888888 PP CBM35.hmm 93 tvtL....kaGkntitiks.dwGwi.nldsl 117 v+L + G+n+i+i+ +Gw +ld++ 118752|Xylven1_GeneCatalog_proteins_20190325.aa.fasta|GH27|CBM35 520 GVELsgfiTGGSNSISISGeGTGWApDLDQI 550 9999333347*******99999**9899987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 204.21 // Query: 11306|Colab1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-08 22.4 3.0 2.2e-08 21.5 2.3 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.5 2.3 1.1e-08 2.2e-08 8 109 .. 425 541 .. 417 552 .. 0.73 Alignments for each domain: == domain 1 score: 21.5 bits; conditional E-value: 1.1e-08 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYelsl 52 l+ + ++ +g+++s v++l ++++ v nv kaG+ ++ + 11306|Colab1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 425 LSSGANLQSCSGCTSSNKVGNLGGSSNGrvVLSNVSTSKAGTQTVLF 471 5555555678999*******99844333336677************* PP CBM35.hmm 53 rYang.......tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaa 91 Y ng + +++ s++vnG+++++v+fp + nw+ + 11306|Colab1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 472 DYINGdvgylggSNNERLASISVNGGAAQTVSFPLSgYNWSADVFKG 518 *8887332222245678899**************99889*9966666 PP CBM35.hmm 92 gtvtLk....aGkntitiks.dw 109 v+L+ G+nti+i+ ++ 11306|Colab1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 519 YAVELTgftaGGANTISISGvES 541 77787633334899999986544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.14 // Query: 508580|Colph1_GeneCatalog_proteins_20160704.aa.fasta|GH27|CBM35 [L=526] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-08 21.8 3.2 2.4e-08 21.4 1.9 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.4 1.9 1.2e-08 2.4e-08 8 108 .. 396 511 .. 389 523 .. 0.74 Alignments for each domain: == domain 1 score: 21.4 bits; conditional E-value: 1.2e-08 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYels 51 l+ + ++ +g+++s v++l ++++ v nv kaG+ ++ 508580|Colph1_GeneCatalog_proteins_20160704.aa.fasta|GH27|CBM35 396 LSSGANLQSCSGCTSSNKVGNLGGSSNGrvVLSNVSTSKAGTQTVL 441 5555555678999*******99844333336677************ PP CBM35.hmm 52 lrYang.......tgstktlsvvvnGtkvsevtfpst.gnwdtwgt 89 + Y ng + +++ s++v+G+++++v+fp + nw+ 508580|Colph1_GeneCatalog_proteins_20160704.aa.fasta|GH27|CBM35 442 FDYINGdvgylggSNNERLASISVDGGAAQTVSFPLSgYNWSADVF 487 **8887332222245678899**************9988**99888 PP CBM35.hmm 90 aagtvtLk....aGkntitiks.d 108 +a v+L+ G+nti+i+ 508580|Colph1_GeneCatalog_proteins_20160704.aa.fasta|GH27|CBM35 488 KAYAVELTgftaGGANTISISGvG 511 888999973333589999998643 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (526 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.18 // Query: 232323|Jamsp1_GeneCatalog_proteins_20141226.aa.fasta|GH27|CBM35 [L=551] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-05 12.1 0.2 9.8e-05 9.8 0.1 2.3 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.0 0.24 0.49 61 77 .. 152 167 .. 144 187 .. 0.51 2 ! 9.8 0.1 4.9e-05 9.8e-05 13 96 .. 426 517 .. 418 547 .. 0.67 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.24 CBM35.hmm 61 tktlsvvvnGtkvsevt 77 k+ + +v+G+++s + 232323|Jamsp1_GeneCatalog_proteins_20141226.aa.fasta|GH27|CBM35 152 VKVDNCFVDGKDNS-PK 167 45555666666554.22 PP == domain 2 score: 9.8 bits; conditional E-value: 4.9e-05 CBM35.hmm 13 vntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYang. 57 v ++ +g+sG++ v+g+++a + n+++ a +l + Y n+ 232323|Jamsp1_GeneCatalog_proteins_20141226.aa.fasta|GH27|CBM35 426 VRADCSGCSGKSKVGGIDDAAVYRLDNITAARAK-STLLFDYINAe 470 5667788888888888887777766777765544.34444444431 PP CBM35.hmm 58 .......tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvt 95 +++++ + vnG++ ++v+fp + nwdt + v 232323|Jamsp1_GeneCatalog_proteins_20141226.aa.fasta|GH27|CBM35 471 vqfsfqgETNERGALIRVNGGEEQSVSFPLSgYNWDTDVWKNYRVD 516 11111116778888899************9988**99444444555 PP CBM35.hmm 96 L 96 L 232323|Jamsp1_GeneCatalog_proteins_20141226.aa.fasta|GH27|CBM35 517 L 517 5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (551 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 83.62 // Query: 483858|Xylcube1_GeneCatalog_proteins_20190615.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-08 20.9 0.2 8.5e-08 19.7 0.2 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.7 0.2 4.2e-08 8.5e-08 49 119 .] 475 552 .. 422 552 .. 0.77 Alignments for each domain: == domain 1 score: 19.7 bits; conditional E-value: 4.2e-08 CBM35.hmm 49 elslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaa 91 + ++ Y ++ +++ s++vnG +++v+fp + nw t ++ 483858|Xylcube1_GeneCatalog_proteins_20190615.aa.fasta|GH27|CBM35 475 NCEVGYLGSSNNERLASISVNGRPAQTVSFPLSgYNWATDIYTG 518 345667777889999****************9989****99999 PP CBM35.hmm 92 gtvtL....kaGkntitiks.dwGwi.nldslel 119 v+L ++G+n+i+i+ +Gw ++d++ + 483858|Xylcube1_GeneCatalog_proteins_20190615.aa.fasta|GH27|CBM35 519 YGVELsgfnTEGANSIRISGaGSGWApDFDRIAV 552 9****555559*******99999**999999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 200.09 // Query: 463928|Xylhel2_GeneCatalog_proteins_20191119.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-06 14.7 1.3 9.2e-06 13.1 1.3 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 13.1 1.3 4.6e-06 9.2e-06 18 118 .. 436 551 .. 421 552 .. 0.67 Alignments for each domain: == domain 1 score: 13.1 bits; conditional E-value: 4.6e-06 CBM35.hmm 18 agysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYang.... 57 +g+ +s+ v++l +++++v ++ +++ + ++++ Y ng 463928|Xylhel2_GeneCatalog_proteins_20191119.aa.fasta|GH27|CBM35 436 SGCASSTKVGNLGgSSNGNVLLSNIRTSQATQTVKFDYINGdvgy 480 555556666666533334444443334445555555555542211 PP CBM35.hmm 58 ...tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtLk. 97 + +++ s++vnG+ +++v+fp + nw t ++ vtL+ 463928|Xylhel2_GeneCatalog_proteins_20191119.aa.fasta|GH27|CBM35 481 lgsSNNERLASISVNGGPAQTVSFPLSgYNWVTDIYKGYGVTLSg 525 1115678889***************9988****9999999***62 PP CBM35.hmm 98 ...aGkntitiks.dwGwi.nldsle 118 +nti+i+ ++Gw ++d++ 463928|Xylhel2_GeneCatalog_proteins_20191119.aa.fasta|GH27|CBM35 526 fstDKTNTIKISGvSTGWApDFDRIG 551 22256899999999999998899885 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 194.73 // Query: 981611|Colsi1_GeneCatalog_proteins_20160329.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-08 21.8 3.2 2.9e-08 21.1 2.3 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.1 2.3 1.5e-08 2.9e-08 8 107 .. 425 538 .. 417 552 .. 0.73 Alignments for each domain: == domain 1 score: 21.1 bits; conditional E-value: 1.5e-08 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYels 51 l+ + ++ +g+++s v++l ++++ v nv kaG+ ++ 981611|Colsi1_GeneCatalog_proteins_20160329.aa.fasta|GH27|CBM35 425 LSSGANLQSCSGCTSSNKVGNLGGSSNGrvVLSNVSTSKAGTQTVL 470 5555555678999*******99844333336677************ PP CBM35.hmm 52 lrYang.......tgstktlsvvvnGtkvsevtfpst.gnwdtwgt 89 + Y ng + +++ s++vnG+++++v+fp + nw+ 981611|Colsi1_GeneCatalog_proteins_20160329.aa.fasta|GH27|CBM35 471 FDYINGdvgylggSNNERLASISVNGGAAQTVSFPLSgYNWSADVF 516 **8887332222245678899**************99889*99766 PP CBM35.hmm 90 aagtvtLk....aGkntitiks 107 + v+L+ G+nti+i+ 981611|Colsi1_GeneCatalog_proteins_20160329.aa.fasta|GH27|CBM35 517 KGYAVELSgftaGGANTISISG 538 6777888633334899999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.11 // Query: 417632|Cadsp1_GeneCatalog_proteins_20140317.aa.fasta|GH27|CBM35 [L=525] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-07 17.6 0.2 1e-06 16.2 0.2 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.2 0.2 5e-07 1e-06 2 119 .] 388 522 .. 387 522 .. 0.72 Alignments for each domain: == domain 1 score: 16.2 bits; conditional E-value: 5e-07 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpka 45 eAe+ +l + ++ ++ +g+sG + v++l +++++vtf+ v++ +a 417632|Cadsp1_GeneCatalog_proteins_20140317.aa.fasta|GH27|CBM35 388 EAESVTLANGAAIASCSGCSGGQKVGNLLsGSTASVTFKgVKASQA 433 899999*99999999**********9975377888****9999776 PP CBM35.hmm 46 GsYelslr.......Yang.tgstktlsvvvnGtkvsevtfpst.g 82 ++ + Y + + +t s++vnG++ +v fp + 417632|Cadsp1_GeneCatalog_proteins_20140317.aa.fasta|GH27|CBM35 434 T-VDVLFDyincevqYLGSsVPNVRTASISVNGGAPVTVLFPLSgY 478 4.444444011111155554557899****************9977 PP CBM35.hmm 83 nwdtwgtaagtvtL...kaG.kntitiks..dwGwi.nldslel 119 nw +v L + G +ntit++s +G ++d++++ 417632|Cadsp1_GeneCatalog_proteins_20140317.aa.fasta|GH27|CBM35 479 NWYGDVLPSYKVRLsgfTSGsQNTITVQSasGQGHApDIDRIRV 522 88765556667776333567458999999765555558888765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (525 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.15 // Query: 9352|Zymbr1_GeneCatalog_proteins_20170711.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-08 22.1 0.2 4.3e-08 20.6 0.2 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.6 0.2 2.2e-08 4.3e-08 2 108 .. 414 538 .. 413 549 .. 0.78 Alignments for each domain: == domain 1 score: 20.6 bits; conditional E-value: 2.2e-08 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsY 48 eAe+a+ g+++ ++ +g+sG + +g+ ++g+++tf+ +++ s 9352|Zymbr1_GeneCatalog_proteins_20170711.aa.fasta|GH27|CBM35 414 EAESATFAGNAALASCSGCSGGKKAGGIGnGNGNTLTFTGITTSQSSM 461 8***************************83566779***666788999 PP CBM35.hmm 49 elslrYangtgst........ktlsvvvnGtkvsevtfpst.gnwdtw 87 ++++ Y n++ ++ + sv+vnG+ v+fp t nwd+ 9352|Zymbr1_GeneCatalog_proteins_20170711.aa.fasta|GH27|CBM35 462 DVRFDYINSEIGYlggsglniRGASVSVNGGTPVPVSFPLTgYNWDKD 509 9999999974433222222227789999999999*******88****8 PP CBM35.hmm 88 gtaagtvtL....kaGkntitiks....d 108 + v L + G+ntiti+ + 9352|Zymbr1_GeneCatalog_proteins_20170711.aa.fasta|GH27|CBM35 510 VQRNYLVRLygfrTSGTNTITISGlssvS 538 778888888777779*****998655444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 83.29 // Query: WPV32616.1|CBM35|GH27 [L=561] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-08 22.5 0.7 2.4e-07 18.2 0.7 2.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.2 0.7 1.2e-07 2.4e-07 2 112 .. 419 548 .. 418 553 .. 0.71 Alignments for each domain: == domain 1 score: 18.2 bits; conditional E-value: 1.2e-07 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslr.......Yangtgstktl.......svvvnGtkvs 74 eAe+++l g + ++ +g+sGs+ v+ ++++g+++t++ + +++ + ++++ Y ++++++++ s++vnG++ + WPV32616.1|CBM35|GH27 419 EAESGTLVGGANTQPCSGCSGSTKVGFITNTGGSLTLSgI-RTSQATQDVRFDyldcevgYLFDPTGSQSNglnvrgaSISVNGGAGQ 505 8********999999*******************999954.45556666666633444444444444444411111116777777777 PP CBM35.hmm 75 evtfpst.gnwdtwgtaagtvtL....kaGkntitiksdwGwi 112 +v fp t nwd+ + v L + G+nti+i+ +G + WPV32616.1|CBM35|GH27 506 SVLFPLTgYNWDKDVAKNHLVRLsgfsTTGTNTIRISGLSGST 548 *******88****777777788844444899999998766655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (561 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.71 // Query: 10666|Fusoxpis1_GeneCatalog_proteins_20191008.aa.fasta|GH27|CBM35 [L=550] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-09 24.2 2.9 8.2e-09 22.9 2.9 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.9 2.9 4.1e-09 8.2e-09 7 119 .] 421 547 .. 414 547 .. 0.81 Alignments for each domain: == domain 1 score: 22.9 bits; conditional E-value: 4.1e-09 CBM35.hmm 7 sltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYe 49 sl+ + +++ +g+++s+ v++l +++++v ++ ++++ + + 10666|Fusoxpis1_GeneCatalog_proteins_20191008.aa.fasta|GH27|CBM35 421 SLSSGAKTASCSGCTSSTKVGNLGgSSNGQVVLSNISTSKATQN 464 5555556677899*********985556667777666788999* PP CBM35.hmm 50 lslrYang......tgstktlsvvvnGtkvsevtfpst.gnwdt 86 + + Y ng +++++ s+ vnG+ +++v+fp t nwd+ 10666|Fusoxpis1_GeneCatalog_proteins_20191008.aa.fasta|GH27|CBM35 465 VLFDYINGdvgfggSTNERLASIKVNGGTAQTVSFPLTgYNWDK 508 ******9855443346778889****************89**** PP CBM35.hmm 87 wgtaagtvtL....kaGkntitiks.dwGwi.nldslel 119 ++ v+L ++G ntiti+ + Gw ++d+l + 10666|Fusoxpis1_GeneCatalog_proteins_20191008.aa.fasta|GH27|CBM35 509 DVYKGYAVELsgfnTNGPNTITISGvNGGWApDFDRLAV 547 9999999***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (550 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 194.51 // Query: 770157|Colac2_GeneCatalog_proteins_20170414.aa.fasta|GH27|CBM35 [L=528] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-08 22.6 2.8 2.1e-08 21.6 2.3 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.6 2.3 1.1e-08 2.1e-08 8 107 .. 398 511 .. 390 525 .. 0.73 Alignments for each domain: == domain 1 score: 21.6 bits; conditional E-value: 1.1e-08 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYels 51 l+ + ++ +g+++s v++l ++++ v nv kaG+ ++ 770157|Colac2_GeneCatalog_proteins_20170414.aa.fasta|GH27|CBM35 398 LSSGANLQSCSGCTSSNKVGNLGGSSNGrvVLSNVSTSKAGTQTVL 443 5555555678999*******99844333336677************ PP CBM35.hmm 52 lrYang.......tgstktlsvvvnGtkvsevtfpst.gnwdtwgt 89 + Y ng + +++ s++vnG+++++v+fp + nw+ 770157|Colac2_GeneCatalog_proteins_20170414.aa.fasta|GH27|CBM35 444 FDYINGdvgylggSNNERLASISVNGGAAQTVSFPLSgYNWSADVF 489 **8887332222245678899**************99889*99666 PP CBM35.hmm 90 aagtvtLk....aGkntitiks 107 + v+L+ G+nti+i+ 770157|Colac2_GeneCatalog_proteins_20170414.aa.fasta|GH27|CBM35 490 KGYAVELTgftaGGANTISISG 511 6677777633334899999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (528 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.07 // Query: 212286|Nemabo1_GeneCatalog_proteins_20190325.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-07 17.2 0.4 1.1e-06 16.1 0.4 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.1 0.4 5.5e-07 1.1e-06 49 119 .] 475 552 .. 422 552 .. 0.67 Alignments for each domain: == domain 1 score: 16.1 bits; conditional E-value: 5.5e-07 CBM35.hmm 49 elslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaag 92 + + Y ++++++ s++vnG+ +++v+fp + nw t +a 212286|Nemabo1_GeneCatalog_proteins_20190325.aa.fasta|GH27|CBM35 475 NCDVAYTGSGSNERLASISVNGKPAKTVSFPLSgYNWATDIYAGY 519 3344466668899999***************9989****999999 PP CBM35.hmm 93 tvtL...kaGk.ntitiks.dwGwi.nldslel 119 v+L + G+ n+iti+ +Gw ++d++ + 212286|Nemabo1_GeneCatalog_proteins_20190325.aa.fasta|GH27|CBM35 520 GVELsgfNTGApNSITISGsGSGWApDFDRIAV 552 999944457866999999888999989999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 190.58 // Query: UKZ95943.1|CBM35|GH27 [L=554] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (554 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 444.78 // Query: 377896|Aurpu_var_pul1_GeneCatalog_proteins_20130219.aa.fasta|GH27|CBM35 [L=523] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-10 27.8 0.6 1e-09 25.8 0.6 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.8 0.6 5.1e-10 1e-09 1 106 [. 383 503 .. 383 518 .. 0.76 Alignments for each domain: == domain 1 score: 25.8 bits; conditional E-value: 5.1e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglq.aagdavtfn 39 yeAe ++ g++ ++ +g+sG + v+++ ++g+++tf+ 377896|Aurpu_var_pul1_GeneCatalog_proteins_20130219.aa.fasta|GH27|CBM35 383 YEAEAGQFAGSAGVASCSGCSGGKKVGNVGnGNGNTLTFS 422 9*********999***************983456668888 PP CBM35.hmm 40 .vdvpkaGsYelslr.........Yangtgstktlsvvvn 69 + +++ + ++++ ++ g g+ + s++vn 377896|Aurpu_var_pul1_GeneCatalog_proteins_20130219.aa.fasta|GH27|CBM35 423 gIR-TSQATQDVRFDyidceigyaFSGGYGNVRGASISVN 461 544.3444444444422333442244558888999***** PP CBM35.hmm 70 Gtkvsevtfpst.gnwdtwgtaagtvtL....kaGkntit 104 G+++++v+fp t nwd+ t+ v L + G+ntit 377896|Aurpu_var_pul1_GeneCatalog_proteins_20130219.aa.fasta|GH27|CBM35 462 GGAAQSVSFPLTgYNWDKDVTKGFLVRLsgfkTSGDNTIT 501 ************89****8888888999444448999999 PP CBM35.hmm 105 ik 106 i+ 377896|Aurpu_var_pul1_GeneCatalog_proteins_20130219.aa.fasta|GH27|CBM35 502 IS 503 86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (523 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.75 // Query: 167828|Tescy1_GeneCatalog_proteins_20150113.aa.fasta|GH27|CBM35 [L=534] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-12 34.7 4.2 6.4e-12 33.0 4.2 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.0 4.2 3.2e-12 6.4e-12 2 117 .. 403 531 .. 402 532 .. 0.80 Alignments for each domain: == domain 1 score: 33.0 bits; conditional E-value: 3.2e-12 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaG 46 eAe a+l g +++++ +g+sG ++v+++ ++g+++tf+ v v++++ 167828|Tescy1_GeneCatalog_proteins_20150113.aa.fasta|GH27|CBM35 403 EAEAATLAGGATKASCSGCSGGSNVGYV-GKGGTLTFTnVRVKSSE 447 8************************877.88888888879997755 PP CBM35.hmm 47 sYelslrYang........tgstktlsvvvnGtkvsevtfpst.gn 83 + + Y n+ ++++t s++vnG+ + +v+fp t n 167828|Tescy1_GeneCatalog_proteins_20150113.aa.fasta|GH27|CBM35 448 -AVIYFDYINAdvgfsfvgATNDRTASISVNGATATTVSFPLTgYN 492 .455566655421111112689*********************89* PP CBM35.hmm 84 wdtwgtaagtvtLk....aGkntitiks.dwGwinldsl 117 wd+ t+ +v L+ + +ntiti++ ++ + n+d++ 167828|Tescy1_GeneCatalog_proteins_20150113.aa.fasta|GH27|CBM35 493 WDKDVTKRYKVRLTgfnpNAANTITISNaNNYAPNFDRI 531 ***99999*****85555678999999966666698887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (534 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.40 // Query: 766540|Zymar1_GeneCatalog_proteins_20141012.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-09 23.5 0.8 1.5e-08 22.0 0.8 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.0 0.8 7.7e-09 1.5e-08 2 108 .. 414 538 .. 413 549 .. 0.77 Alignments for each domain: == domain 1 score: 22.0 bits; conditional E-value: 7.7e-09 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaG 46 eAe+a+ g++v ++ +g+sG + +g+ ++g+++tf+ +++ 766540|Zymar1_GeneCatalog_proteins_20141012.aa.fasta|GH27|CBM35 414 EAESATFAGNAVVASCSGCSGGKKAGGIGnGNGNTLTFTGITTSQS 459 8***************************83566779***6667889 PP CBM35.hmm 47 sYelslrYangtgst........ktlsvvvnGtkvsevtfpst.gn 83 s ++++ Y n++ ++ + s++vnG+ v+fp t n 766540|Zymar1_GeneCatalog_proteins_20141012.aa.fasta|GH27|CBM35 460 STDVRFDYINSEIGYlgssglniRGASISVNGGTPVAVQFPLTgYN 505 999999999974332222222226789999999999*******88* PP CBM35.hmm 84 wdtwgtaagtvtL....kaGkntitiks....d 108 wd+ + v L + G+ntit++ + 766540|Zymar1_GeneCatalog_proteins_20141012.aa.fasta|GH27|CBM35 506 WDKDVQRNYLVRLygfrTSGTNTITVSGlssvS 538 ***777788888877777999999998655444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.73 // Query: 152125|Triasper1_GeneCatalog_proteins_20210904.aa.fasta|GH27|CBM35 [L=519] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (519 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 427.30 // Query: 173700|CocheC4_6_GeneCatalog_proteins_20220427.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-08 21.1 2.3 7e-08 19.9 2.3 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.9 2.3 3.5e-08 7e-08 15 107 .. 431 535 .. 418 549 .. 0.77 Alignments for each domain: == domain 1 score: 19.9 bits; conditional E-value: 3.5e-08 CBM35.hmm 15 tnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYan 56 + +g+++s v+++ ++g++vt++ +++ + ++++ Y n 173700|CocheC4_6_GeneCatalog_proteins_20220427.aa.fasta|GH27|CBM35 431 SPCSGCTSSNKVGNIGgSNGGRVTLSNIRTSKATQTVRFDYIN 473 4567999999999998678889999966677889999999999 PP CBM35.hmm 57 g......tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaag 92 g ++++++ s++vnG+++++v+fp t nw+ ++ 173700|CocheC4_6_GeneCatalog_proteins_20220427.aa.fasta|GH27|CBM35 474 GnvdymgGTNERVASISVNGGAAKTVSFPLTgYNWNVDVSKNY 516 75533334678999*****************88***9999999 PP CBM35.hmm 93 tvtL....kaGkntitiks 107 v+L + G ntiti 173700|CocheC4_6_GeneCatalog_proteins_20220427.aa.fasta|GH27|CBM35 517 GVELsgfsTTGPNTITIAG 535 9999444447999999975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 184.12 // Query: 290989|Pyrsp1_GeneCatalog_proteins_20141006.aa.fasta|GH27|CBM35 [L=551] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-06 16.2 1.2 2.4e-06 15.0 0.4 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.7 0.3 0.089 0.18 91 91 .. 417 417 .. 367 471 .. 0.59 2 ! 15.0 0.4 1.2e-06 2.4e-06 49 116 .. 471 545 .. 415 548 .. 0.70 Alignments for each domain: == domain 1 score: -0.7 bits; conditional E-value: 0.089 CBM35.hmm 91 a 91 a 290989|Pyrsp1_GeneCatalog_proteins_20141006.aa.fasta|GH27|CBM35 417 A 417 1 PP == domain 2 score: 15.0 bits; conditional E-value: 1.2e-06 CBM35.hmm 49 elslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagt 93 + ++ Y g+ +++ s++vnG+++ ++fp t nwd+ + 290989|Pyrsp1_GeneCatalog_proteins_20141006.aa.fasta|GH27|CBM35 471 NAEIGYLGGSNNERLASISVNGGAAVRISFPLTgYNWDKDVLKGYA 516 4567899999999********************89****8888889 PP CBM35.hmm 94 vtL....kaGkntitiks.dwGwi.nlds 116 v+L + G+n+i ik + w ++d+ 290989|Pyrsp1_GeneCatalog_proteins_20141006.aa.fasta|GH27|CBM35 517 VELsgfsTTGANQIVIKGvGSAWApDFDR 545 99944444899999999764444445665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (551 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 71.87 // Query: XPT01944.1|CBM35|GH27 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-09 22.8 1.7 1.9e-08 21.8 0.9 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.0 0.31 0.61 37 63 .. 387 413 .. 378 424 .. 0.66 2 ! 21.8 0.9 9.5e-09 1.9e-08 5 118 .. 421 549 .. 416 550 .. 0.69 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.31 CBM35.hmm 37 tfnvdvpkaGsYelslrYangtgstkt 63 +f+ +v+++Gs +l+l+ + t++t + XPT01944.1|CBM35|GH27 387 SFSKQVNARGSLALRLSNIKRTSTTTN 413 566778888888888887775444333 PP == domain 2 score: 21.8 bits; conditional E-value: 9.5e-09 CBM35.hmm 5 dasltgvsvntnhagysGsgfvdglqaagda.vtfnvdvpkaGsYelslr.......YangtgstktlsvvvnGtkvsevtfpst.gn 83 ++sl + + ++ +g++++ v++l ++++ +t++ +++ + +++ Y g+ +++ s+++nG+++++v+fp t n XPT01944.1|CBM35|GH27 421 TGSLAAGANIQSCTGCTSTNKVGNLGGPSNGaLTLSNIRTSQATQVVRFDylngevgYLGGSNNERLASISINGGAAKTVSFPLTgYN 508 55555555556677777888888877554332444422234444445555111111166667788999*****************89* PP CBM35.hmm 84 wdtwgtaagtvtL....kaGkntitiks.dwGwi.nldsle 118 wd+ ++ v+L + G+n+i ik ++G+ ++d++ XPT01944.1|CBM35|GH27 509 WDKDVSKGYAVELsgfsTTGTNSIVIKGvKSGYApDIDRIG 549 ***999999****555458********99999998999985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.05 // Query: 796710|Zymps1_GeneCatalog_proteins_20141012.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-08 22.2 0.2 4e-08 20.7 0.2 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.7 0.2 2e-08 4e-08 2 111 .. 414 537 .. 413 549 .. 0.78 Alignments for each domain: == domain 1 score: 20.7 bits; conditional E-value: 2e-08 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaG 46 eAe+a g+++ ++ +g+sG + +g+ ++g+++tf+ +++ 796710|Zymps1_GeneCatalog_proteins_20141012.aa.fasta|GH27|CBM35 414 EAESAAFAGNAAVASCSGCSGGKKAGGIGnGNGNTLTFTGITTSQS 459 8**************************983566779***6667889 PP CBM35.hmm 47 sYelslrYangtgst........ktlsvvvnGtkvsevtfpst.gn 83 s ++++ Y n++ ++ + sv+vnG+ v+fp t n 796710|Zymps1_GeneCatalog_proteins_20141012.aa.fasta|GH27|CBM35 460 SMDVRFDYINSEIGYlggsglniRGASVSVNGGTPVPVSFPITgYN 505 999999999974433222222227789999999999*******88* PP CBM35.hmm 84 wdtwgtaagtvtL....kaGkntitiksdwGw 111 wd+ + v L + G+ntiti+ +G 796710|Zymps1_GeneCatalog_proteins_20141012.aa.fasta|GH27|CBM35 506 WDKDVQRNYLVRLygfrTSGSNTITISGLSGV 537 ***8888888888777779******9984443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.13 // Query: UKZ82838.1|CBM35|GH27 [L=554] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (554 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 447.30 // Query: 640916|Olipa1_GeneCatalog_proteins_20171127.aa.fasta|GH27|CBM35 [L=545] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-08 21.7 2.1 1.9e-08 21.7 2.1 2.9 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.0 0.45 0.9 96 111 .. 52 65 .. 47 70 .. 0.78 2 ? -0.4 0.1 0.071 0.14 59 86 .. 346 373 .. 332 399 .. 0.58 3 ! 21.7 2.1 9.7e-09 1.9e-08 1 117 [. 411 540 .. 411 542 .. 0.79 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.45 CBM35.hmm 96 LkaGkntitiksdwGw 111 L aG+n ++i+ Gw 640916|Olipa1_GeneCatalog_proteins_20171127.aa.fasta|GH27|CBM35 52 LAAGYNLFQIDC--GW 65 899*****9997..44 PP == domain 2 score: -0.4 bits; conditional E-value: 0.071 CBM35.hmm 59 gstktlsvvvnGtkvs..evtfpstgnwdt 86 ++++++s+++n ++ + ++t+++ w++ 640916|Olipa1_GeneCatalog_proteins_20171127.aa.fasta|GH27|CBM35 346 WQSSSRSITINFSQLGisTATVKNL--WTN 373 4455666666666665333333333..433 PP == domain 3 score: 21.7 bits; conditional E-value: 9.7e-09 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpka 45 y+Ae+asl g +++++ ag+sG+++ + +a+g++ t++ v+++++ 640916|Olipa1_GeneCatalog_proteins_20171127.aa.fasta|GH27|CBM35 411 YQAESASLAGGAATATCAGCSGTKVGNIGTANGASFTLSgVTATST 456 9*********999999*******97666678899999998888765 PP CBM35.hmm 46 GsYelslrYang......tgstktlsvvvnGtkvsevtfpst.gnw 84 + +l + Y n+ ++++ +++vnG+ + v+fp + +w 640916|Olipa1_GeneCatalog_proteins_20171127.aa.fasta|GH27|CBM35 457 -TSTLLIDYVNAevgymgATNARGATISVNGGTAVAVSFPLSgYDW 501 .556767766653322225678889***************997789 PP CBM35.hmm 85 dtwgtaagtvtLk....aGkntitiks.dwGwi.nldsl 117 + + v+L+ a +ntit+k+ d+ w ++d++ 640916|Olipa1_GeneCatalog_proteins_20171127.aa.fasta|GH27|CBM35 502 SYDVLKGFRVELSgfrvASNNTITYKAgDTEWApDIDRI 540 996777778999766668899999999877777688887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (545 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 161.25 // Query: 511269|Clael1_GeneCatalog_proteins_20140828.aa.fasta|GH27|CBM35 [L=558] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-08 20.0 2.7 2e-07 18.5 2.7 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.5 2.7 1e-07 2e-07 3 106 .. 420 535 .. 418 539 .. 0.83 Alignments for each domain: == domain 1 score: 18.5 bits; conditional E-value: 1e-07 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGs 47 A d+sl+ ++ ++ + +s+++ v++l +++++vt++ +++ + 511269|Clael1_GeneCatalog_proteins_20140828.aa.fasta|GH27|CBM35 420 ASDGSLSSGATIQSCSSCSSTKRVGNLGgSSNGRVTLSNIRTSQAT 465 8899999988999999***********9566788999966688899 PP CBM35.hmm 48 YelslrYang......tgstktlsvvvnGtkvsevtfpst.gnwdt 86 ++++ Y ng ++++ sv+vnG+++++v+fp + nw+ 511269|Clael1_GeneCatalog_proteins_20140828.aa.fasta|GH27|CBM35 466 QTVRFDYVNGdvgymgATNERIASVSVNGGAAKTVSFPLSgYNWEV 511 9*****99985533324577889***************99889999 PP CBM35.hmm 87 wgtaagtvtL....kaGkntitik 106 + + v+L + G+ntit++ 511269|Clael1_GeneCatalog_proteins_20140828.aa.fasta|GH27|CBM35 512 DVSRDYAVELsgfsTTGANTITVS 535 899999999944444899999985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (558 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 187.63 // Query: 5542|Clasph1_GeneCatalog_proteins_20160727.aa.fasta|GH27|CBM35 [L=888] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (888 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 810.57 // Query: 510573|Truan1_GeneCatalog_proteins_20170627.aa.fasta|GH27|CBM35 [L=554] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-07 16.8 0.7 1.7e-06 15.5 0.7 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 15.5 0.7 8.3e-07 1.7e-06 17 111 .. 434 542 .. 417 551 .. 0.64 Alignments for each domain: == domain 1 score: 15.5 bits; conditional E-value: 8.3e-07 CBM35.hmm 17 hagysGsgfvdglqaagda.vtfn.vdvpkaGsYelslrYang... 57 +g+ +s+ v++l + ++ v ++ + +++ + ++++ Y ng 510573|Truan1_GeneCatalog_proteins_20170627.aa.fasta|GH27|CBM35 434 CSGCASSSKVGNLGGGSSGrVVLSnIR-TSQATQNVQFDYINGevg 478 556666666666653333224333133.444555666665554221 PP CBM35.hmm 58 ....tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL.. 96 + +++ s++vnG+ +++v+fp + nwd ++ v+L 510573|Truan1_GeneCatalog_proteins_20170627.aa.fasta|GH27|CBM35 479 ylggSNNERLASISVNGGTAQTVSFPLSgYNWDADVYKGYAVELsg 524 11116788999***************9989****888889999944 PP CBM35.hmm 97 ..kaGkntitiks.dwGw 111 + G n+i+i+ + w 510573|Truan1_GeneCatalog_proteins_20170627.aa.fasta|GH27|CBM35 525 fnTSGPNSISITGvGSAW 542 444799999988754444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (554 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 87.69 // Query: 374501|Xylcub1_GeneCatalog_proteins_20181030.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-08 20.8 0.2 9e-08 19.6 0.2 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.6 0.2 4.5e-08 9e-08 50 119 .] 476 552 .. 423 552 .. 0.77 Alignments for each domain: == domain 1 score: 19.6 bits; conditional E-value: 4.5e-08 CBM35.hmm 50 lslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagt 93 ++ Y ++ +++ s++vnG +++v+fp + nw t ++ 374501|Xylcub1_GeneCatalog_proteins_20181030.aa.fasta|GH27|CBM35 476 CEVGYLGSSNNERLASISVNGRPAQTVSFPLSgYNWATDIYTGYG 520 345677778899999***************9989****999999* PP CBM35.hmm 94 vtL....kaGkntitiks.dwGwi.nldslel 119 v+L ++G+n+i+i+ +Gw ++d++ + 374501|Xylcub1_GeneCatalog_proteins_20181030.aa.fasta|GH27|CBM35 521 VELsgfnTEGANSIRISGaGSGWApDFDRIAV 552 ***555559*******99999**999999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 194.78 // Query: 156218|Dotse1_GeneCatalog_proteins_20100818.aa.fasta|GH27|CBM35 [L=526] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-08 20.7 0.6 2.5e-07 18.1 0.3 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.0 0.11 0.23 63 89 .. 125 157 .. 119 161 .. 0.74 2 ! 18.1 0.3 1.3e-07 2.5e-07 2 90 .. 389 486 .. 388 513 .. 0.80 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.11 CBM35.hmm 63 tlsvvvnGtkvs.....evtfpst.gnwdtwgt 89 + + +v+G++ + ++fps gnw++ ++ 156218|Dotse1_GeneCatalog_proteins_20100818.aa.fasta|GH27|CBM35 125 VDNCYVEGSADNapkdpRTDFPSRfGNWSKAQQ 157 567788888877777789999999888888443 PP == domain 2 score: 18.1 bits; conditional E-value: 1.3e-07 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaG 46 eAe++ + g + ++ +g+sGs+ +++ ++++++t++ ++ +++ 156218|Dotse1_GeneCatalog_proteins_20100818.aa.fasta|GH27|CBM35 389 EAESGAVAGGAKVQSCSGCSGSKKAGQIGNSSGSLTLSgIK-TSQA 433 8********888999*******************9999665.4555 PP CBM35.hmm 47 sYelslr.......Yang.tgstktlsvvvnGtkvsevtfpst.gn 83 + ++++ Y g +++++ sv++nG+ ++v fp t n 156218|Dotse1_GeneCatalog_proteins_20100818.aa.fasta|GH27|CBM35 434 TQDVRFDylnceigYLGGtNSNARGASVSINGGPGQSVLFPITgYN 479 66666661122222666667788899*****************889 PP CBM35.hmm 84 wdtwgta 90 wd+ t+ 156218|Dotse1_GeneCatalog_proteins_20100818.aa.fasta|GH27|CBM35 480 WDKDVTK 486 *994333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (526 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 160.55 // Query: 556181|Colgo1_GeneCatalog_proteins_20160414.aa.fasta|GH27|CBM35 [L=528] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-09 22.7 3.9 1.1e-08 22.5 2.5 1.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.0 0.22 0.44 39 68 .. 362 393 .. 330 406 .. 0.59 2 ! 22.5 2.5 5.4e-09 1.1e-08 8 108 .. 398 513 .. 391 525 .. 0.74 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.22 CBM35.hmm 39 nvdvpkaGsYelslrYang..tgstktlsvvv 68 + +v++ Gs +l+l+ + +++k + v+v 556181|Colgo1_GeneCatalog_proteins_20160414.aa.fasta|GH27|CBM35 362 SAQVNAHGSLALRLSNIQRstAAGAKYNYVSV 393 35666666666666644433344445555544 PP == domain 2 score: 22.5 bits; conditional E-value: 5.4e-09 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYels 51 l+ + ++ +g+++s v++l ++++ v nv kaG+ ++ 556181|Colgo1_GeneCatalog_proteins_20160414.aa.fasta|GH27|CBM35 398 LSSGANLQSCSGCTSSNKVGNLGGSSNGrvVLSNVSTSKAGTQTVL 443 5555555678999*******99844333336677************ PP CBM35.hmm 52 lrYang.......tgstktlsvvvnGtkvsevtfpst.gnwdtwgt 89 + Y ng + +++ s++vnG+++++v+fp + nw+ 556181|Colgo1_GeneCatalog_proteins_20160414.aa.fasta|GH27|CBM35 444 FDYINGdvgylggSNNERLASISVNGGAAQTVSFPLSgYNWSADVF 489 **8887332222245678899**************9988**99888 PP CBM35.hmm 90 aagtvtLk....aGkntitiks.d 108 +a v+L+ G+nti+i+ 556181|Colgo1_GeneCatalog_proteins_20160414.aa.fasta|GH27|CBM35 490 KAYAVELTgftaGGANTISISGvG 513 888999973333589999998643 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (528 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.83 // Query: 336034|Nemdif1_GeneCatalog_proteins_20190614.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-09 25.0 2.1 4.7e-09 23.7 1.1 2.3 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.18 0.36 60 99 .. 385 424 .. 373 433 .. 0.58 2 ! 23.7 1.1 2.3e-09 4.7e-09 17 118 .. 435 551 .. 421 552 .. 0.73 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.18 CBM35.hmm 60 stktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaG 99 s+++ s vnG+ + + + + + +t +t+ + +L++G 336034|Nemdif1_GeneCatalog_proteins_20190614.aa.fasta|GH27|CBM35 385 SASSYSKLVNGHGSMALRLSNIQRASTSATTYTYSSLTKG 424 5556666777777775555555555444444444444444 PP == domain 2 score: 23.7 bits; conditional E-value: 2.3e-09 CBM35.hmm 17 hagysGsgfvdglq.aagdavtfn.vdvpkaGsYelslr...... 53 +g+ +s+ v++l a++++v ++ + +++ s +++++ 336034|Nemdif1_GeneCatalog_proteins_20190614.aa.fasta|GH27|CBM35 435 CSGCASSSKVGNLGgASNGSVVLSnIR-TSQASQTVRFNyingev 478 567777777777763334445444144.45566677777223333 PP CBM35.hmm 54 .YangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL 96 Y n++++++ s++vnG+ +++v+fp + nwd+ ++ v L 336034|Nemdif1_GeneCatalog_proteins_20190614.aa.fasta|GH27|CBM35 479 aYTNSGSNERLASISVNGGPAQTVSFPLSgYNWDSDIYSGYGVDL 523 355666778889***************9989****999999**** PP CBM35.hmm 97 ....kaGkntitiks.dwGwi.nldsle 118 ++G+n+iti+ +Gw ++d++ 336034|Nemdif1_GeneCatalog_proteins_20190614.aa.fasta|GH27|CBM35 524 sgfnTQGSNSITISGsGTGWApDFDQIG 551 555559*******99899**98999985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.13 // Query: 1093362|Fusox3_1_GeneCatalog_proteins_20230106.aa.fasta|GH27|CBM35 [L=550] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-09 23.5 3.8 9e-09 22.8 3.1 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.8 3.1 4.5e-09 9e-09 7 119 .] 421 547 .. 414 547 .. 0.81 Alignments for each domain: == domain 1 score: 22.8 bits; conditional E-value: 4.5e-09 CBM35.hmm 7 sltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsY 48 sl+ + +++ +g+++++ v++l +++++v ++ ++++ + 1093362|Fusox3_1_GeneCatalog_proteins_20230106.aa.fasta|GH27|CBM35 421 SLSSGAKTASCSGCTSTTKVGNLGgSSNGQVVLSNISTSKATQ 463 5555556677899*********985556667777666788999 PP CBM35.hmm 49 elslrYang......tgstktlsvvvnGtkvsevtfpst.gnw 84 ++ + Y ng +++++ s+ vnG+ +++v+fp t nw 1093362|Fusox3_1_GeneCatalog_proteins_20230106.aa.fasta|GH27|CBM35 464 NVLFDYINGdvgfggSTNERLASIKVNGGTAQTVSFPLTgYNW 506 *******9855443346778889****************89** PP CBM35.hmm 85 dtwgtaagtvtL....kaGkntitiks.dwGwi.nldslel 119 d+ ++ v+L ++G ntiti+ + Gw ++d+l + 1093362|Fusox3_1_GeneCatalog_proteins_20230106.aa.fasta|GH27|CBM35 507 DKDVYKGYAVELsgfnTNGPNTITISGvNGGWApDFDRLAV 547 **9999999***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (550 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.40 // Query: 568387|Xylcur114988_1_GeneCatalog_proteins_20190615.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-08 22.0 0.3 3.9e-08 20.8 0.3 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.8 0.3 1.9e-08 3.9e-08 49 119 .] 475 552 .. 426 552 .. 0.80 Alignments for each domain: == domain 1 score: 20.8 bits; conditional E-value: 1.9e-08 CBM35.hmm 49 elslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtw 87 + ++ Y +t +++ s++vnG +++v+fp + nw t 568387|Xylcur114988_1_GeneCatalog_proteins_20190615.aa.fasta|GH27|CBM35 475 NCEVGYLGSTNNERLASISVNGRPAQTVSFPLSgYNWATD 514 556778888999*******************9989****9 PP CBM35.hmm 88 gtaagtvtL....kaGkntitiks.dwGwi.nldslel 119 ++ v+L ++G+n+i+i+ +Gw ++d++ + 568387|Xylcur114988_1_GeneCatalog_proteins_20190615.aa.fasta|GH27|CBM35 515 IYKGYGVELsgfnTEGANSIKISGaGSGWApDFDRIAV 552 99999****555559*******99999**999999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 213.31 // Query: 104741|Triasp1_GeneCatalog_proteins_20150522.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 408.14 // Query: 2036|Colco1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-08 22.0 3.4 2.5e-08 21.4 2.3 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.4 2.3 1.3e-08 2.5e-08 8 107 .. 425 538 .. 418 552 .. 0.73 Alignments for each domain: == domain 1 score: 21.4 bits; conditional E-value: 1.3e-08 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYelslr 53 l+ + ++ +g+++s v++l ++++ v nv kaG+ ++ + 2036|Colco1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 425 LSSGANLQSCSGCTSSNKVGNLGGSSNGrvVLSNVSTSKAGTQTVLFD 472 5555555678999*******99844333336677************** PP CBM35.hmm 54 Yang.......tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagt 93 Y ng + +++ s++vnG+++++v+fp + nw+ + 2036|Colco1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 473 YINGdvgylggSNNERLASISVNGGAAQTVSFPLSgYNWSADVFKGYA 520 8887332222245678899**************99889*996666677 PP CBM35.hmm 94 vtLk....aGkntitiks 107 v+L+ G+nti+i+ 2036|Colco1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 521 VELTgftaGGANTISISG 538 777633334899999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 75.41 // Query: 52833|Aurpu_var_mel1_GeneCatalog_proteins_20130418.aa.fasta|GH27|CBM35 [L=523] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-11 29.7 0.3 2.8e-10 27.7 0.3 2.1 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.7 0.3 1.4e-10 2.8e-10 1 106 [. 383 503 .. 383 519 .. 0.73 Alignments for each domain: == domain 1 score: 27.7 bits; conditional E-value: 1.4e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagda.vtfn 39 yeAe ++l+g+++ t+ +g+sG + v+ + + +++ +t++ 52833|Aurpu_var_mel1_GeneCatalog_proteins_20130418.aa.fasta|GH27|CBM35 383 YEAEAGKLSGSAAVTSCSGCSGGKKVGSIGNGDSNtLTLT 422 9***************************976655554444 PP CBM35.hmm 40 .vdvpkaGsYelslr.......Yang..tgstktlsvvvn 69 + +++ + ++++ Ya g g+ + s++vn 52833|Aurpu_var_mel1_GeneCatalog_proteins_20130418.aa.fasta|GH27|CBM35 423 gIR-TSQATQDVRFDyidceigYAFGggYGNVRGASISVN 461 322.2333333333322333337766547788899***** PP CBM35.hmm 70 Gtkvsevtfpst.gnwdtwgtaagtvtL....kaGkntit 104 G+++++v+fp t nwd+ + v L + G+ntit 52833|Aurpu_var_mel1_GeneCatalog_proteins_20130418.aa.fasta|GH27|CBM35 462 GGAAQSVSFPLTgYNWDKDVAKGFLVRLsgfkTSGDNTIT 501 ************88****5555556888444447999999 PP CBM35.hmm 105 ik 106 i+ 52833|Aurpu_var_mel1_GeneCatalog_proteins_20130418.aa.fasta|GH27|CBM35 502 IS 503 86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (523 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.31 // Query: 894439|Fusoxys1_GeneCatalog_proteins_20180511.aa.fasta|GH27|CBM35 [L=550] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-09 24.2 2.9 8.2e-09 22.9 2.9 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.9 2.9 4.1e-09 8.2e-09 7 119 .] 421 547 .. 414 547 .. 0.81 Alignments for each domain: == domain 1 score: 22.9 bits; conditional E-value: 4.1e-09 CBM35.hmm 7 sltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYe 49 sl+ + +++ +g+++s+ v++l +++++v ++ ++++ + + 894439|Fusoxys1_GeneCatalog_proteins_20180511.aa.fasta|GH27|CBM35 421 SLSSGAKTASCSGCTSSTKVGNLGgSSNGQVVLSNISTSKATQN 464 5555556677899*********985556667777666788999* PP CBM35.hmm 50 lslrYang......tgstktlsvvvnGtkvsevtfpst.gnwdt 86 + + Y ng +++++ s+ vnG+ +++v+fp t nwd+ 894439|Fusoxys1_GeneCatalog_proteins_20180511.aa.fasta|GH27|CBM35 465 VLFDYINGdvgfggSTNERLASIKVNGGTAQTVSFPLTgYNWDK 508 ******9855443346778889****************89**** PP CBM35.hmm 87 wgtaagtvtL....kaGkntitiks.dwGwi.nldslel 119 ++ v+L ++G ntiti+ + Gw ++d+l + 894439|Fusoxys1_GeneCatalog_proteins_20180511.aa.fasta|GH27|CBM35 509 DVYKGYAVELsgfnTNGPNTITISGvNGGWApDFDRLAV 547 9999999***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (550 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 195.85 // Query: 401405|Collu1_GeneCatalog_proteins_20160428.aa.fasta|GH27|CBM35 [L=528] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-08 22.2 3.2 2.4e-08 21.4 2.4 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.4 2.4 1.2e-08 2.4e-08 8 107 .. 398 511 .. 390 525 .. 0.73 Alignments for each domain: == domain 1 score: 21.4 bits; conditional E-value: 1.2e-08 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYels 51 l+ + ++ +g+++s v++l ++++ v nv kaG+ ++ 401405|Collu1_GeneCatalog_proteins_20160428.aa.fasta|GH27|CBM35 398 LSSGANLQSCSGCTSSNKVGNLGGSSNGrvVLSNVSTSKAGTQTVL 443 5555555678999*******99844333336677************ PP CBM35.hmm 52 lrYang.......tgstktlsvvvnGtkvsevtfpst.gnwdtwgt 89 + Y ng + +++ s++vnG+++++v+fp + nw+ 401405|Collu1_GeneCatalog_proteins_20160428.aa.fasta|GH27|CBM35 444 FDYINGdvgylggSNNERLASISVNGGAAQTVSFPLSgYNWSADVF 489 **8887332222245678899**************99889*99666 PP CBM35.hmm 90 aagtvtLk....aGkntitiks 107 + v+L+ G+nti+i+ 401405|Collu1_GeneCatalog_proteins_20160428.aa.fasta|GH27|CBM35 490 KGYAVELTgftaGGANTISISG 511 6677777633334899999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (528 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.01 // Query: 71191|Aurpu_var_nam1_GeneCatalog_proteins_20130418.aa.fasta|GH27|CBM35 [L=523] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-11 30.5 0.7 1.5e-10 28.5 0.7 2.1 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.5 0.7 7.4e-11 1.5e-10 1 107 [. 383 504 .. 383 519 .. 0.78 Alignments for each domain: == domain 1 score: 28.5 bits; conditional E-value: 7.4e-11 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglq.aagdavtfn 39 yeAe ++l g+++ ++ +g+sG + v+++ ++g+++tf+ 71191|Aurpu_var_nam1_GeneCatalog_proteins_20130418.aa.fasta|GH27|CBM35 383 YEAEAGQLAGSAAVASCSGCSGGKKVGNVGnGNGNTLTFS 422 9***************************983456668998 PP CBM35.hmm 40 .vdvpkaGsYelslr.......Yang..tgstktlsvvvn 69 + +++ + ++++ Ya g g+ + s++vn 71191|Aurpu_var_nam1_GeneCatalog_proteins_20130418.aa.fasta|GH27|CBM35 423 gIR-TSQATQDVRFDyldceigYAFGggYGNVRGASISVN 461 544.4444444444422333337766547788899***** PP CBM35.hmm 70 Gtkvsevtfpst.gnwdtwgtaagtvtL....kaGkntit 104 G+++++v+fp t nwd+ t+ v L + G+ntit 71191|Aurpu_var_nam1_GeneCatalog_proteins_20130418.aa.fasta|GH27|CBM35 462 GGAAQSVSFPLTgYNWDKDVTKGFLVRLsgfkTSGDNTIT 501 ************89****8888888999444448999999 PP CBM35.hmm 105 iks 107 i+ 71191|Aurpu_var_nam1_GeneCatalog_proteins_20130418.aa.fasta|GH27|CBM35 502 ISG 504 975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (523 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.37 // Query: 3286|Horwer1_GeneCatalog_proteins_20160803.aa.fasta|GH27|CBM35 [L=579] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-06 15.9 1.9 1.8e-06 15.4 0.1 2.2 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.8 0.0 0.82 1.6 98 108 .. 75 85 .. 72 91 .. 0.77 2 ? -3.6 0.0 0.7 1.4 5 28 .. 379 402 .. 378 417 .. 0.61 3 ! 15.4 0.1 8.8e-07 1.8e-06 1 105 [. 429 545 .. 429 560 .. 0.75 Alignments for each domain: == domain 1 score: -3.8 bits; conditional E-value: 0.82 CBM35.hmm 98 aGkntitiksd 108 aG+nt++i+ 3286|Horwer1_GeneCatalog_proteins_20160803.aa.fasta|GH27|CBM35 75 AGYNTFQIDCG 85 89999999873 PP == domain 2 score: -3.6 bits; conditional E-value: 0.7 CBM35.hmm 5 dasltgvsvntnhagysGsgfvdg 28 +a t + n+++++++ sg+ 3286|Horwer1_GeneCatalog_proteins_20160803.aa.fasta|GH27|CBM35 379 SADATDLWSNKTQTQCNVSGYNAT 402 556666666666777777776544 PP == domain 3 score: 15.4 bits; conditional E-value: 8.8e-07 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGs 47 y A+++sl+g++ ++ +g+s + v++l +a+++vt++ +++ + 3286|Horwer1_GeneCatalog_proteins_20160803.aa.fasta|GH27|CBM35 429 YVAASGSLDGSAEIQDCPGCSEGKKVGYL-TANSSVTIHGIRTSQST 474 889*******99999***********999.88899999955566677 PP CBM35.hmm 48 Yelslr.......Yang.tgstktlsvvvnGtkvsevtfpst.gnwd 85 ++++ Y ++ + +++t v+vnG+++ v+fp t +w+ 3286|Horwer1_GeneCatalog_proteins_20160803.aa.fasta|GH27|CBM35 475 SNVRFDyvncdvgYLADqKPNYRTAAVSVNGGAARMVNFPLTgYAWT 521 77777722333334444477899******************955666 PP CBM35.hmm 86 twgtaagtvtLk....aGkntiti 105 ++ v+L+ +G+n++ti 3286|Horwer1_GeneCatalog_proteins_20160803.aa.fasta|GH27|CBM35 522 LDVLTDFLVELSgfdpEGENSVTI 545 545555566665444467777766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (579 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 173.64 // Query: 324742|Cocvi2_GeneCatalog_proteins_20221119.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-09 23.6 1.3 1.2e-08 22.4 1.3 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.4 1.3 6.1e-09 1.2e-08 15 107 .. 431 535 .. 417 549 .. 0.78 Alignments for each domain: == domain 1 score: 22.4 bits; conditional E-value: 6.1e-09 CBM35.hmm 15 tnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYang.. 57 + +g+++s v+++ ++g++vt++ +++ + ++++ Y ng 324742|Cocvi2_GeneCatalog_proteins_20221119.aa.fasta|GH27|CBM35 431 SPCSGCTSSNKVGNIGgSNGGRVTLSNIRTSKATQTVRFDYINGnv 476 5567999999999998678889999966677889999999999755 PP CBM35.hmm 58 ....tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL.. 96 ++++++ s++vnG+++++v+fp t nw++ +++ v+L 324742|Cocvi2_GeneCatalog_proteins_20221119.aa.fasta|GH27|CBM35 477 dymgGTNERVASISVNGGAAKTVSFPLTgYNWSKDVSKDYAVELsg 522 33334678999*****************89****999999****44 PP CBM35.hmm 97 ..kaGkntitiks 107 + G ntiti+ 324742|Cocvi2_GeneCatalog_proteins_20221119.aa.fasta|GH27|CBM35 523 fsTTGPNTITISG 535 4448999999986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 188.82 // Query: 16168|Colme1_GeneCatalog_proteins_20180731.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-08 22.0 3.2 2.6e-08 21.3 2.4 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.3 2.4 1.3e-08 2.6e-08 8 107 .. 425 538 .. 418 552 .. 0.73 Alignments for each domain: == domain 1 score: 21.3 bits; conditional E-value: 1.3e-08 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYelsl 52 l+ + ++ +g+++s v++l ++++ v nv kaG+ ++ + 16168|Colme1_GeneCatalog_proteins_20180731.aa.fasta|GH27|CBM35 425 LSSGANLQSCSGCTSSNKVGNLGGSSNGrvVLSNVSTSKAGTQTVLF 471 5555555678999*******99844333336677************* PP CBM35.hmm 53 rYang.......tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaa 91 Y ng + +++ s++vnG+++++v+fp + nw+ + 16168|Colme1_GeneCatalog_proteins_20180731.aa.fasta|GH27|CBM35 472 DYINGdvgylggSNNERLASISVNGGAAQTVSFPLSgYNWSADVFKG 518 *8887332222245678899**************99889*9966666 PP CBM35.hmm 92 gtvtLk....aGkntitiks 107 v+L+ G+nti+i+ 16168|Colme1_GeneCatalog_proteins_20180731.aa.fasta|GH27|CBM35 519 YAVELTgftaGGANTISISG 538 77777633334899999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.09 // Query: 947212|Colsa1_GeneCatalog_proteins_20160329.aa.fasta|GH27|CBM35 [L=482] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-09 23.4 2.5 5.8e-09 23.4 2.5 2.2 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.2 0.1 0.061 0.12 37 59 .. 314 338 .. 281 360 .. 0.64 2 ! 23.4 2.5 2.9e-09 5.8e-09 9 108 .. 353 467 .. 346 479 .. 0.74 Alignments for each domain: == domain 1 score: -0.2 bits; conditional E-value: 0.061 CBM35.hmm 37 tfnvdvpkaGsYelslrYang..tg 59 +++v+v++ Gs +l+l+ + + 947212|Colsa1_GeneCatalog_proteins_20160329.aa.fasta|GH27|CBM35 314 SYSVQVNAHGSLALRLSNIQRstAA 338 3458999999988888766543233 PP == domain 2 score: 23.4 bits; conditional E-value: 2.9e-09 CBM35.hmm 9 tgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYelsl 52 + + ++ +g+++s v++l ++++ v nv kaG+ ++ + 947212|Colsa1_GeneCatalog_proteins_20160329.aa.fasta|GH27|CBM35 353 SSGANLQSCSGCTSSNKVGNLGGSSNGrvVISNVSTSKAGTQTVLF 398 554555678999*******99854433447778************* PP CBM35.hmm 53 rYang.......tgstktlsvvvnGtkvsevtfpst.gnwdtwgta 90 Y ng + +++ s++vnG+++++v+fp + nw+ + 947212|Colsa1_GeneCatalog_proteins_20160329.aa.fasta|GH27|CBM35 399 DYINGdvgylggSNNERLASISVNGGAAQTVSFPLSgYNWSADVFK 444 *8887332222245678899**************9988**998888 PP CBM35.hmm 91 agtvtLk....aGkntitiks.d 108 a v+L+ G+nti+i+ 947212|Colsa1_GeneCatalog_proteins_20160329.aa.fasta|GH27|CBM35 445 AYAVELTgftaGGANTISISGvG 467 88999973333589999998643 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (482 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 55.43 // Query: 8629|Colta1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-08 20.6 3.4 6.5e-08 20.0 2.4 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.0 2.4 3.3e-08 6.5e-08 8 107 .. 425 538 .. 418 552 .. 0.73 Alignments for each domain: == domain 1 score: 20.0 bits; conditional E-value: 3.3e-08 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYelslr 53 l+ + ++ +g+++s v++l ++++ v nv kaG+ ++ + 8629|Colta1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 425 LSSGANLQSCSGCTSSNKVGNLGGSSNGrvVLSNVSTSKAGTQTVLFD 472 5555555678999*******99844333336677************** PP CBM35.hmm 54 Yang.......tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagt 93 Y ng + +++ s++vnG++ ++v+fp + nw+ + 8629|Colta1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 473 YINGdvgylggSNNERLASISVNGGAGQTVSFPLSgYNWSADVFKGYA 520 8887332222245678899**************99889*996666677 PP CBM35.hmm 94 vtLk....aGkntitiks 107 v+L+ G+nti+i+ 8629|Colta1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 521 VELTgftaGGANTISISG 538 777633334899999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 81.75 // Query: 553387|Photr1_GeneCatalog_proteins_20140424.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-06 13.4 0.4 3.4e-05 11.2 0.0 2.2 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.8 0.1 0.092 0.18 27 56 .. 377 404 .. 351 431 .. 0.55 2 ! 11.2 0.0 1.7e-05 3.4e-05 52 116 .. 475 546 .. 416 548 .. 0.82 Alignments for each domain: == domain 1 score: -0.8 bits; conditional E-value: 0.092 CBM35.hmm 27 dglqaagdavtfnvdvpkaGsYelslrYan 56 +g ++++++++ +v+ + Gs +l+l+ + 553387|Photr1_GeneCatalog_proteins_20140424.aa.fasta|GH27|CBM35 377 TGTSTTSSSISTQVN--AHGSLALRLSNIK 404 333444444444444..3555555555444 PP == domain 2 score: 11.2 bits; conditional E-value: 1.7e-05 CBM35.hmm 52 lrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL 96 + Y g+++++ sv+vnG+ ++v+fp + +wd + +v L 553387|Photr1_GeneCatalog_proteins_20140424.aa.fasta|GH27|CBM35 475 VGYLGGGSNERLASVSVNGGPGQTVSFPLSgYDWDRDVCKGYKVLL 520 6788889999******************99889*997777778888 PP CBM35.hmm 97 ....kaGkntitiks.dwGwi.nlds 116 + G nt++++ +Gw +ld+ 553387|Photr1_GeneCatalog_proteins_20140424.aa.fasta|GH27|CBM35 521 sgfsTTGVNTVAVEGvGSGWApDLDR 546 44444799999999888899877776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.03 // Query: 118750|Lizem1_GeneCatalog_proteins_20150430.aa.fasta|GH27|CBM35 [L=553] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-07 19.3 1.6 2.8e-07 18.0 1.3 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.0 1.3 1.4e-07 2.8e-07 16 107 .. 432 536 .. 416 550 .. 0.64 Alignments for each domain: == domain 1 score: 18.0 bits; conditional E-value: 1.4e-07 CBM35.hmm 16 nhagysGsgfvdglqaagda.vtfnvdvpkaGsYelslr....... 53 + +g+++s v++l ++++ +t++ +++ + +++ 118750|Lizem1_GeneCatalog_proteins_20150430.aa.fasta|GH27|CBM35 432 SCSGCTSSNKVGNLGGPSNGaLTLSNIRTSQATQVVRFDyingevg 477 5566666666666664433224444222333444444441111111 PP CBM35.hmm 54 YangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL.. 96 Y g+ +++ sv+vnG+++++v+fp t nwd+ + v+L 118750|Lizem1_GeneCatalog_proteins_20150430.aa.fasta|GH27|CBM35 478 YLGGSNNERLASVSVNGGAAKTVSFPLTgYNWDKDVMKSYAVELsg 523 66667788999*****************89****888889999944 PP CBM35.hmm 97 ..kaGkntitiks 107 + G+nti ik 118750|Lizem1_GeneCatalog_proteins_20150430.aa.fasta|GH27|CBM35 524 fsTTGTNTIVIKG 536 4458****99986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (553 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.90 // Query: 25516|Fusoxmel1_GeneCatalog_proteins_20191008.aa.fasta|GH27|CBM35 [L=550] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-09 24.1 2.9 9.1e-09 22.8 2.9 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.8 2.9 4.5e-09 9.1e-09 8 119 .] 422 547 .. 414 547 .. 0.81 Alignments for each domain: == domain 1 score: 22.8 bits; conditional E-value: 4.5e-09 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYel 50 l+ + +++ +g+++s+ v++l +++++v ++ ++++ + ++ 25516|Fusoxmel1_GeneCatalog_proteins_20191008.aa.fasta|GH27|CBM35 422 LSSGAQTASCSGCTSSTKVGNLGgSSNGQVVLSNISTSKATQNV 465 5555556678999********985556667777666788999** PP CBM35.hmm 51 slrYang......tgstktlsvvvnGtkvsevtfpst.gnwdtw 87 + Y ng +++++ s+ vnG+ +++v+fp t nwd+ 25516|Fusoxmel1_GeneCatalog_proteins_20191008.aa.fasta|GH27|CBM35 466 LFDYINGdvgfggSTNERLASIKVNGGTAQTVSFPLTgYNWDKD 509 *****9855443346778889****************89****9 PP CBM35.hmm 88 gtaagtvtL....kaGkntitiks.dwGwi.nldslel 119 ++ v+L ++G ntiti+ + Gw ++d+l + 25516|Fusoxmel1_GeneCatalog_proteins_20191008.aa.fasta|GH27|CBM35 510 VYKGYAVELsgfnTNGPNTITISGvNGGWApDFDRLAV 547 999999***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (550 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 206.77 // Query: 530224|Psehy1_GeneCatalog_proteins_20140829.aa.fasta|GH27|CBM35 [L=561] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-08 21.3 1.0 6.9e-08 19.9 1.0 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.9 1.0 3.5e-08 6.9e-08 3 117 .. 427 556 .. 425 558 .. 0.73 Alignments for each domain: == domain 1 score: 19.9 bits; conditional E-value: 3.5e-08 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGs 47 A ++sl + + ++ +g++++ v++l +a++++t++ +++ + 530224|Psehy1_GeneCatalog_proteins_20140829.aa.fasta|GH27|CBM35 427 ASKGSLANGANVQSCSGCTSKNKVGNLGsSANGRLTLSNIRTSQAT 472 6677777766667788888888888887455666666644455566 PP CBM35.hmm 48 YelslrYang.......tgstktlsvvvnGtkvsevtfpst.gnwd 85 ++ + Y ng + +++ s++vnG+ +v+fp t nwd 530224|Psehy1_GeneCatalog_proteins_20140829.aa.fasta|GH27|CBM35 473 QAVVFDYINGeigylggSNNERLASISVNGGTPRTVSFPVTgYNWD 518 666666555422221116788999*****************89*** PP CBM35.hmm 86 twgtaagtvtL....kaGkntitiks.dwGwi.nldsl 117 ++ v+L + G nti+i+ +G+ ++d++ 530224|Psehy1_GeneCatalog_proteins_20140829.aa.fasta|GH27|CBM35 519 ADVYKSYAVELsgfsTTGVNTIAISGsGSGYApDFDRI 556 *999999****444458*******98788887788877 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (561 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 85.14 // Query: 279709|Tilan2_GeneCatalog_proteins_20140224.aa.fasta|GH27|CBM35 [L=501] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-07 19.3 1.5 3.6e-07 17.6 1.5 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 17.6 1.5 1.8e-07 3.6e-07 1 86 [. 367 457 .. 367 488 .. 0.73 Alignments for each domain: == domain 1 score: 17.6 bits; conditional E-value: 1.8e-07 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagda.vtfn.vdvpk 44 yeAe+a l++ ++ ++ +g+sGs+ v+++ + + + ++ + +++ 279709|Tilan2_GeneCatalog_proteins_20140224.aa.fasta|GH27|CBM35 367 YEAENAVLSNGAAVASWSGCSGSKKVGNIGTLTFKnIQTSqMKSNV 412 9*********999999**********99965432223333344444 PP CBM35.hmm 45 aGsY...elslrYangtgstktlsvvvnGtkvsevtfpst.gnwdt 86 + +Y ++++++ n ++++ sv+vn++ +++v fp + nwd+ 279709|Tilan2_GeneCatalog_proteins_20140224.aa.fasta|GH27|CBM35 413 RFDYinaDVQYSFVN-VTNARGASVSVNNGLSQQVYFPLSgYNWDK 457 444443345555555.57778888999999999*****99789988 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (501 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 190.35 // Query: 161153|Altalt1_GeneCatalog_proteins_20170627.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-08 19.9 4.5 1.6e-07 18.8 4.5 1.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.8 4.5 8.1e-08 1.6e-07 3 107 .. 419 535 .. 417 549 .. 0.78 Alignments for each domain: == domain 1 score: 18.8 bits; conditional E-value: 8.1e-08 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaG 46 A ++sl+ + +++ +g+++s v++l +++++vt++ +++ 161153|Altalt1_GeneCatalog_proteins_20170627.aa.fasta|GH27|CBM35 419 ASTGSLSSGANTQSCSGCTSSNKVGNLGgSSNGRVTISNIRTSKA 463 7778888887888999***********855677899995556778 PP CBM35.hmm 47 sYelslrYang......tgstktlsvvvnGtkvsevtfpst.gnw 84 + ++ + Y ng ++++++ ++vnG+++++v+fp + nw 161153|Altalt1_GeneCatalog_proteins_20170627.aa.fasta|GH27|CBM35 464 TQTVLFDYVNGqvdymgGSNERVAAISVNGGAAKTVSFPLSgYNW 508 8899999888744332246789999**************9989** PP CBM35.hmm 85 dtwgtaagtvtL....kaGkntitiks 107 d+ ++ v+L + G+ntiti+ 161153|Altalt1_GeneCatalog_proteins_20170627.aa.fasta|GH27|CBM35 509 DKDVYKNYGVELsgfsTTGTNTITISG 535 **999999****444458******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 191.79 // Query: 189079|Clafu1_GeneCatalog_proteins_20110826.aa.fasta|GH27|CBM35 [L=562] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-08 22.5 0.7 2.4e-07 18.2 0.7 2.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.2 0.7 1.2e-07 2.4e-07 2 112 .. 419 548 .. 418 553 .. 0.71 Alignments for each domain: == domain 1 score: 18.2 bits; conditional E-value: 1.2e-07 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaG 46 eAe+++l g + ++ +g+sGs+ v+ ++++g+++t++ + +++ 189079|Clafu1_GeneCatalog_proteins_20110826.aa.fasta|GH27|CBM35 419 EAESGTLVGGANTQPCSGCSGSTKVGFITNTGGSLTLSgI-RTSQA 463 8********999999*******************999954.45556 PP CBM35.hmm 47 sYelslr.......Yangtgstktl.......svvvnGtkvsevtf 78 + ++++ Y ++++++++ s++vnG++ ++v f 189079|Clafu1_GeneCatalog_proteins_20110826.aa.fasta|GH27|CBM35 464 TQDVRFDyldcevgYLFDPTGSQSNglnvrgaSISVNGGAGQSVLF 509 666666633444444444444444411111116777777777**** PP CBM35.hmm 79 pst.gnwdtwgtaagtvtL....kaGkntitiksdwGwi 112 p t nwd+ + v L + G+nti+i+ +G + 189079|Clafu1_GeneCatalog_proteins_20110826.aa.fasta|GH27|CBM35 510 PLTgYNWDKDVAKNHLVRLsgfsTTGTNTIRISGLSGST 548 ***88****777777788844444899999998766655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (562 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.42 // Query: 2902|Moeaph1_GeneCatalog_proteins_20170701.aa.fasta|GH27|CBM35 [L=559] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.9e-09 22.7 0.6 3.4e-08 21.0 0.6 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.0 0.6 1.7e-08 3.4e-08 2 115 .. 426 554 .. 425 557 .. 0.82 Alignments for each domain: == domain 1 score: 21.0 bits; conditional E-value: 1.7e-08 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGs 47 eAe+++l g++++++ ag+s + v+++ ++g+++t++ p++ + 2902|Moeaph1_GeneCatalog_proteins_20170701.aa.fasta|GH27|CBM35 426 EAESGTLAGNAAKASCAGCSNGSKVSNVGgGPGNTLTLTNIKPSSSE 472 9*******************999999998577888888866699999 PP CBM35.hmm 48 YelslrYangt........gstktlsvvvnGtkvsevtfpst.gnwd 85 l + Y n++ ++++ +++vnG+ +++v+fp + +w+ 2902|Moeaph1_GeneCatalog_proteins_20170701.aa.fasta|GH27|CBM35 473 AVLYFDYINADvgfsfvgaTNERFAQISVNGGTAQNVSFPLSgYDWN 519 9999999996422222222689999***************99889** PP CBM35.hmm 86 twgtaagtvtLk....aGkntitiksdwGwi.nld 115 + t+a +v L+ a ntiti++ +G+ ++d 2902|Moeaph1_GeneCatalog_proteins_20170701.aa.fasta|GH27|CBM35 520 KDVTKAYKVRLSgfkpASVNTITISNPNGYApDFD 554 *999*******755557889999999888875666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (559 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.09 // Query: 11460|Fusve2_GeneCatalog_proteins_20150720.aa.fasta|GH27|CBM35 [L=549] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-08 22.4 2.2 1.2e-08 22.4 2.2 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.0 0.31 0.62 34 56 .. 382 404 .. 350 417 .. 0.55 2 ! 22.4 2.2 5.8e-09 1.2e-08 7 119 .] 421 547 .. 414 547 .. 0.80 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.31 CBM35.hmm 34 davtfnvdvpkaGsYelslrYan 56 +a +f+ +v+ Gs +l+l+ + 11460|Fusve2_GeneCatalog_proteins_20150720.aa.fasta|GH27|CBM35 382 GASSFSKQVNGHGSVALRLSNIK 404 33344444444444444444333 PP == domain 2 score: 22.4 bits; conditional E-value: 5.8e-09 CBM35.hmm 7 sltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelsl 52 sl+ + +++ +g+++s+ v++l +++++v ++ ++++ + ++ + 11460|Fusve2_GeneCatalog_proteins_20150720.aa.fasta|GH27|CBM35 421 SLSSGAQTASCSGCTSSTKVGNLGgSSNGQVVLSNISTSKTTQNVLF 467 555555667789999******9985455667777666777899999* PP CBM35.hmm 53 rYang......tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaag 92 Y ng +++++ s+ vnG+ +++v+fp t nwd+ ++ 11460|Fusve2_GeneCatalog_proteins_20150720.aa.fasta|GH27|CBM35 468 DYINGdvgfggSSNERLASIKVNGGTAKTVSFPLTgYNWDKDVYKGY 514 ***9855443346778899****************89****999999 PP CBM35.hmm 93 tvtL....kaGkntitiks.dwGwi.nldslel 119 v+L + G ntiti+ + Gw ++d+l + 11460|Fusve2_GeneCatalog_proteins_20150720.aa.fasta|GH27|CBM35 515 AVELsgfsTSGPNTITISGvNGGWApDFDRLAV 547 ****555558********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (549 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 66.63 // Query: USW54245.1|CBM35|GH27 [L=507] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (507 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 431.50 // Query: 317363|XylarbFL1030_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 [L=556] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-06 14.6 0.3 6.4e-06 13.6 0.3 1.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 13.6 0.3 3.2e-06 6.4e-06 18 119 .] 436 553 .. 419 553 .. 0.71 Alignments for each domain: == domain 1 score: 13.6 bits; conditional E-value: 3.2e-06 CBM35.hmm 18 agysGsgfvdglqaagda........vtfnvdvpkaGsYe 49 ag+ +s+ v++l +a++ ++ + +v k + + 317363|XylarbFL1030_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 436 AGCASSTKVGNLGGASNGsvvlsnilTSQATQVVKFDYIN 475 5666666666665433333433333233334444444555 PP CBM35.hmm 50 lslrYang.tgstktlsvvvnGtkvsevtfpst.gnwdtw 87 ++ Y + ++++ s+ vnG+ ++ v+fp + nw t 317363|XylarbFL1030_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 476 CEVAYLGSgASNERLASIRVNGGPAQVVSFPLSgYNWVTD 515 5666766658889999***************9988****9 PP CBM35.hmm 88 gtaagtvtL....kaGkntitiks.dwGwi.nldslel 119 ++ ++L ++G nti+i+ +Gw ++d++e+ 317363|XylarbFL1030_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 516 IYVGYGIQLsgfnTEGPNTISISGaGTGWApDFDRVEV 553 99999****555559*******9999***989998876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (556 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 189.50 // Query: XPS79078.1|CBM35|GH27 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-09 22.8 1.7 1.9e-08 21.8 0.9 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.0 0.31 0.61 37 63 .. 387 413 .. 378 424 .. 0.66 2 ! 21.8 0.9 9.5e-09 1.9e-08 5 118 .. 421 549 .. 416 550 .. 0.69 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.31 CBM35.hmm 37 tfnvdvpkaGsYelslrYangtgstkt 63 +f+ +v+++Gs +l+l+ + t++t + XPS79078.1|CBM35|GH27 387 SFSKQVNARGSLALRLSNIKRTSTTTN 413 566778888888888887775444333 PP == domain 2 score: 21.8 bits; conditional E-value: 9.5e-09 CBM35.hmm 5 dasltgvsvntnhagysGsgfvdglqaagda.vtfnvdvpkaGsYelslr.......YangtgstktlsvvvnGtkvsevtfpst.gn 83 ++sl + + ++ +g++++ v++l ++++ +t++ +++ + +++ Y g+ +++ s+++nG+++++v+fp t n XPS79078.1|CBM35|GH27 421 TGSLAAGANIQSCTGCTSTNKVGNLGGPSNGaLTLSNIRTSQATQVVRFDylngevgYLGGSNNERLASISINGGAAKTVSFPLTgYN 508 55555555556677777888888877554332444422234444445555111111166667788999*****************89* PP CBM35.hmm 84 wdtwgtaagtvtL....kaGkntitiks.dwGwi.nldsle 118 wd+ ++ v+L + G+n+i ik ++G+ ++d++ XPS79078.1|CBM35|GH27 509 WDKDVSKGYAVELsgfsTTGTNSIVIKGvKSGYApDIDRIG 549 ***999999****555458********99999998999985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.86 // Query: 1561|Spore1_GeneCatalog_proteins_20131031.aa.fasta|GH27|CBM35 [L=575] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-08 19.8 3.2 6.2e-07 16.9 2.7 2.7 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.4 0.0 0.14 0.29 84 111 .. 66 91 .. 52 95 .. 0.70 2 ! 16.9 2.7 3.1e-07 6.2e-07 2 107 .. 438 557 .. 437 568 .. 0.76 Alignments for each domain: == domain 1 score: -1.4 bits; conditional E-value: 0.14 CBM35.hmm 84 wdtwgtaagtvtLkaGkntitiksdwGw 111 +t+ + + +L aG+n ++++ Gw 1561|Spore1_GeneCatalog_proteins_20131031.aa.fasta|GH27|CBM35 66 HTTMDLMQSQGYLAAGYNFFQVDC--GW 91 445555667789999999999885..66 PP == domain 2 score: 16.9 bits; conditional E-value: 3.1e-07 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpkaGs 47 eAe+++l g++ +++ +g+s + v+++ +a +++t+n +++++ + 1561|Spore1_GeneCatalog_proteins_20131031.aa.fasta|GH27|CBM35 438 EAESGTLAGSASKASCSGCSNGSKVGNIGnGAANSLTLNgIKANA-SE 484 8**************************983455669999877755.45 PP CBM35.hmm 48 YelslrYang........tgstktlsvvvnGtkvsevtfpst.gnwdt 86 l + Y n+ +++++ +++vnG++ ++v+fp + +w++ 1561|Spore1_GeneCatalog_proteins_20131031.aa.fasta|GH27|CBM35 485 AVLYFDYINAevgfsfvgATNQRSAQISVNGGSPQNVSFPLSgYDWSK 532 5566666664211111125899******************99889*99 PP CBM35.hmm 87 wgtaagtvtL...kaGk.ntitiks 107 t+ +v L kaG+ n+iti + 1561|Spore1_GeneCatalog_proteins_20131031.aa.fasta|GH27|CBM35 533 DVTKGYKVRLtgfKAGQtNSITIAN 557 8888889998444588547888876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (575 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.70 // Query: 603011|Rhesp1_GeneCatalog_proteins_20171207.aa.fasta|GH27|CBM35 [L=515] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (515 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 577.66 // Query: 420371|Xylscr1_GeneCatalog_proteins_20190612.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-08 20.8 0.2 8.5e-08 19.6 0.2 1.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.6 0.2 4.3e-08 8.5e-08 49 119 .] 475 552 .. 425 552 .. 0.79 Alignments for each domain: == domain 1 score: 19.6 bits; conditional E-value: 4.3e-08 CBM35.hmm 49 elslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaag 92 + ++ Y +t +++ s++vnG +++v+fp + nw t ++ 420371|Xylscr1_GeneCatalog_proteins_20190612.aa.fasta|GH27|CBM35 475 NCEVGYLGSTNNERLASISVNGRPAQTVSFPLSgYNWATDIYTSY 519 4567788889999******************9989****99999* PP CBM35.hmm 93 tvtL....kaGkntitiks.dwGwi.nldslel 119 v+L ++G n+i+i+ +Gw ++d++ + 420371|Xylscr1_GeneCatalog_proteins_20190612.aa.fasta|GH27|CBM35 520 GVELsgfnTEGPNSIKISGvGSGWApDFDRIAV 552 ****555559********9999**999999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 214.83 // Query: UPX17570.1|CBM35|GH27 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-07 18.3 2.8 3.7e-07 17.6 1.2 2.2 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.9 0.1 0.098 0.2 32 62 .. 382 412 .. 358 432 .. 0.72 2 ! 17.6 1.2 1.8e-07 3.7e-07 5 107 .. 421 536 .. 417 550 .. 0.65 Alignments for each domain: == domain 1 score: -0.9 bits; conditional E-value: 0.098 CBM35.hmm 32 agdavtfnvdvpkaGsYelslrYangtgstk 62 +++a +f+ +v+++Gs +l+l+ + t++t UPX17570.1|CBM35|GH27 382 TQNAASFSKQVNARGSLALRLSNIKRTSTTT 412 4566778888888888888887777533332 PP == domain 2 score: 17.6 bits; conditional E-value: 1.8e-07 CBM35.hmm 5 dasltgvsvntnhagysGsgfvdglqaag.davtfnvdvpkaGsYelslr.......YangtgstktlsvvvnGtkvsevtfpst.gn 83 ++sl + + ++ +g++++ v++l +++ +a+t++ +++ + ++ + Y g+ +++ s++vnG+++++v+fp t n UPX17570.1|CBM35|GH27 421 TGSLAAGANLQSCSGCTSTNKVGNLGGPSnGALTLSNIRTSQATQAVHFDyingevgYLGGSNNERLASISVNGGAAKTVSFPLTgYN 508 55666655566677788888888887544144554433344455555555111111155566788999*****************89* PP CBM35.hmm 84 wdtwgtaagtvtL....kaGkntitiks 107 wd+ + v+L + G+n+i ik UPX17570.1|CBM35|GH27 509 WDKDVLKSYAVELsgfsTTGTNSIVIKG 536 ***8888889999444448999999986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.34 // Query: 16975|Didma1_GeneCatalog_proteins_20160126.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-07 16.7 2.0 1.8e-06 15.4 1.3 2.1 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 15.4 1.3 8.8e-07 1.8e-06 18 110 .. 433 542 .. 413 552 .. 0.65 Alignments for each domain: == domain 1 score: 15.4 bits; conditional E-value: 8.8e-07 CBM35.hmm 18 agysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYan....... 56 +g++++ v++l ++++a+t++ +++ + +l++ Y n 16975|Didma1_GeneCatalog_proteins_20160126.aa.fasta|GH27|CBM35 433 SGCTSTNKVGNLGgSSNGALTLSNIRTSQATQTLRFDYVNcdvgfaf 479 56666666666653344445555333444555555555442222222 PP CBM35.hmm 57 ..g.tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL... 96 + ++++ s++vnG++++ ++fp t nwd+ t+ v+L 16975|Didma1_GeneCatalog_proteins_20160126.aa.fasta|GH27|CBM35 480 sgDtRNNERNASISVNGGAAKIISFPLTgYNWDKDVTKGYAVELsgf 526 11335678999*****************89****999999****444 PP CBM35.hmm 97 .kaGkntitiks.dwG 110 + G+n+i ik + G 16975|Didma1_GeneCatalog_proteins_20160126.aa.fasta|GH27|CBM35 527 sTTGTNSIVIKGaNGG 542 448*******984444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.36 // Query: 12494|Colcu1_GeneCatalog_proteins_20180803.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-08 22.2 3.3 2.4e-08 21.4 2.4 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.4 2.4 1.2e-08 2.4e-08 8 108 .. 425 540 .. 418 552 .. 0.72 Alignments for each domain: == domain 1 score: 21.4 bits; conditional E-value: 1.2e-08 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYelsl 52 l+ + ++ +g+++s v++l ++++ v nv kaG+ ++ + 12494|Colcu1_GeneCatalog_proteins_20180803.aa.fasta|GH27|CBM35 425 LSSGANLQSCSGCTSSNKVGNLGGSSNGrvVLSNVSTSKAGTQTVLF 471 5555555678999*******99844333336677************* PP CBM35.hmm 53 rYang.......tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaa 91 Y ng + +++ s++vnG+++++v+fp + nw+ + 12494|Colcu1_GeneCatalog_proteins_20180803.aa.fasta|GH27|CBM35 472 DYVNGdvgylggSNNERLASISVNGGAAQTVSFPLSgYNWSADVFKG 518 *8887332221245678899**************99889*9976666 PP CBM35.hmm 92 gtvtLk....aGkntitiks.d 108 v+L+ G+nti+i+ 12494|Colcu1_GeneCatalog_proteins_20180803.aa.fasta|GH27|CBM35 519 YAVELTgftaGGANTISISGvG 540 7788863333489999998653 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.39 // Query: 16551|Fusoxmel1_GeneCatalog_proteins_20191008.aa.fasta|GH27|CBM35 [L=550] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-09 23.5 3.8 9e-09 22.8 3.1 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.8 3.1 4.5e-09 9e-09 7 119 .] 421 547 .. 414 547 .. 0.81 Alignments for each domain: == domain 1 score: 22.8 bits; conditional E-value: 4.5e-09 CBM35.hmm 7 sltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYe 49 sl+ + +++ +g+++++ v++l +++++v ++ ++++ + + 16551|Fusoxmel1_GeneCatalog_proteins_20191008.aa.fasta|GH27|CBM35 421 SLSSGAKTASCSGCTSTTKVGNLGgSSNGQVVLSNISTSKATQN 464 5555556677899*********985556667777666788999* PP CBM35.hmm 50 lslrYang......tgstktlsvvvnGtkvsevtfpst.gnwdt 86 + + Y ng +++++ s+ vnG+ +++v+fp t nwd+ 16551|Fusoxmel1_GeneCatalog_proteins_20191008.aa.fasta|GH27|CBM35 465 VLFDYINGdvgfggSTNERLASIKVNGGTAQTVSFPLTgYNWDK 508 ******9855443346778889****************89**** PP CBM35.hmm 87 wgtaagtvtL....kaGkntitiks.dwGwi.nldslel 119 ++ v+L ++G ntiti+ + Gw ++d+l + 16551|Fusoxmel1_GeneCatalog_proteins_20191008.aa.fasta|GH27|CBM35 509 DVYKGYAVELsgfnTNGPNTITISGvNGGWApDFDRLAV 547 9999999***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (550 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.51 // Query: 393262|Didex1_GeneCatalog_proteins_20120924.aa.fasta|GH27|CBM35 [L=551] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-07 16.9 3.7 9e-07 16.3 2.7 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.3 2.7 4.5e-07 9e-07 3 107 .. 418 534 .. 413 548 .. 0.75 Alignments for each domain: == domain 1 score: 16.3 bits; conditional E-value: 4.5e-07 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglqaa.gdavtfnvdvpkaGs 47 A ++sl + + ++ +g++++ v++l ++ ++a+t++ +++ + 393262|Didex1_GeneCatalog_proteins_20120924.aa.fasta|GH27|CBM35 418 ASTGSLAAGANIQTCSGCTSTNKVGNLGGPsNGALTLSNIRTSQAT 463 5566666655556678999999999999651566777755577788 PP CBM35.hmm 48 YelslrYang......tgstktlsvvvnGtkvsevtfpst.gnwdt 86 +++ Y ng +++++ s++vnG+ +++v+fp t nwd+ 393262|Didex1_GeneCatalog_proteins_20120924.aa.fasta|GH27|CBM35 464 QVVRFDYINGevgfggSTNERLASISVNGGTAKTVSFPLTgYNWDK 509 99999999975544334677889*****************89**** PP CBM35.hmm 87 wgtaagtvtL....kaGkntitiks 107 + v+L + G+nti ik 393262|Didex1_GeneCatalog_proteins_20120924.aa.fasta|GH27|CBM35 510 DVLKSYAVELsgfsTTGTNTIVIKG 534 8888999999444458*****9996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (551 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.26 // Query: 519340|XyFL1272_2_GeneCatalog_proteins_20191031.aa.fasta|GH27|CBM35 [L=527] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-09 23.8 0.7 4.5e-09 23.8 0.7 2.2 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.0 0.3 0.61 31 56 .. 129 154 .. 110 162 .. 0.63 2 ! 23.8 0.7 2.2e-09 4.5e-09 50 118 .. 448 523 .. 391 524 .. 0.82 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.3 CBM35.hmm 31 aagdavtfnvdvpkaGsYelslrYan 56 d t + ++pk+ + ++ +rY++ 519340|XyFL1272_2_GeneCatalog_proteins_20191031.aa.fasta|GH27|CBM35 129 CYVDGATSATNAPKDARTDFVTRYSA 154 44455556667777777777777776 PP == domain 2 score: 23.8 bits; conditional E-value: 2.2e-09 CBM35.hmm 50 lslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgta 90 + Y g+ +++ sv+vnG+++ +v+fp t nw t t+ 519340|XyFL1272_2_GeneCatalog_proteins_20191031.aa.fasta|GH27|CBM35 448 CDIGYLGGGNNERLASVSVNGGAAVTVSFPLTgYNWVTDITK 489 467899999999********************88****9*** PP CBM35.hmm 91 agtvtL....kaGkntitiks.dwGwi.nldsle 118 a v+L + G+nti+i+ ++Gw ++d++ 519340|XyFL1272_2_GeneCatalog_proteins_20191031.aa.fasta|GH27|CBM35 490 AYAVELsgfsTSGTNTIAISGvNSGWApDVDRIG 523 ******555558********99****99999986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (527 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 77.95 // Query: 425806|Xylarb124340_1_GeneCatalog_proteins_20190612.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-06 16.2 0.3 2.5e-06 14.9 0.2 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 14.9 0.2 1.2e-06 2.5e-06 48 117 .. 474 550 .. 421 551 .. 0.72 Alignments for each domain: == domain 1 score: 14.9 bits; conditional E-value: 1.2e-06 CBM35.hmm 48 YelslrYangtgstktlsvvvnGtkvsevtfpst.gnwdt 86 + ++ Y ++ +++ sv vnG+ +++v+fp + +w + 425806|Xylarb124340_1_GeneCatalog_proteins_20190612.aa.fasta|GH27|CBM35 474 INCEIGYLGSSNNERLASVRVNGGPAQTVSFPISgYDWAS 513 3556778888899999****************99789999 PP CBM35.hmm 87 wgtaagtvtLk....aGkntitiks.dwGwi.nldsl 117 ++ v+L+ G+n+i+i+ +Gw +ld++ 425806|Xylarb124340_1_GeneCatalog_proteins_20190612.aa.fasta|GH27|CBM35 514 DVYKGYGVELSgfiiGGSNSISISGdGTGWApDLDQI 550 8888999***944445*******99899**9899987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 86.36 // Query: 886|Fusoxcon1_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 [L=550] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-09 22.8 2.5 1.9e-08 21.8 2.2 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.8 2.2 9.5e-09 1.9e-08 8 119 .] 422 547 .. 414 547 .. 0.80 Alignments for each domain: == domain 1 score: 21.8 bits; conditional E-value: 9.5e-09 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelsl 52 l+ + +++ +g+++s+ +++l +++++v ++ ++++ + ++ + 886|Fusoxcon1_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 422 LSSGAKTASCSGCTSSTKIGNLGgSSNGQVVLSNISTSKATQNVLF 467 5555556677899999999999844556677776667788999999 PP CBM35.hmm 53 rYang......tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaa 91 Y ng +++++ s+ vnG+ +++v+fp t nwd+ ++ 886|Fusoxcon1_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 468 DYINGdvgfggSTNERLASIKVNGGTAQTVSFPLTgYNWDKDVYKG 513 9999755443346778889****************89****99999 PP CBM35.hmm 92 gtvtL....kaGkntitiks.dwGwi.nldslel 119 v+L ++G ntiti+ + Gw ++d+l + 886|Fusoxcon1_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 514 YAVELsgfnTNGPNTITISGvNGGWApDFDRLAV 547 99***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (550 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.97 // Query: 312686|Boeex1_GeneCatalog_proteins_20171129.aa.fasta|GH27|CBM35 [L=553] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-07 18.9 0.8 4.1e-07 17.5 0.8 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 17.5 0.8 2e-07 4.1e-07 17 107 .. 433 536 .. 417 548 .. 0.69 Alignments for each domain: == domain 1 score: 17.5 bits; conditional E-value: 2e-07 CBM35.hmm 17 hagysGsgfvdglqaagda........vtfnvdvpkaGsYelslrY 54 +g++++ v+++ +a++ ++ + +v + + ++ Y 312686|Boeex1_GeneCatalog_proteins_20171129.aa.fasta|GH27|CBM35 433 CSGCTSTNKVGNVGGASNGaltlsnirTSQATQVVRFDYINCEVGY 478 5555555555555533332333444334455555555666778889 PP CBM35.hmm 55 angtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL... 96 g+ +++ s++vnG+++++v+fp t nwd+ + v+L 312686|Boeex1_GeneCatalog_proteins_20171129.aa.fasta|GH27|CBM35 479 LGGSNNERLASISVNGGAAKTVSFPLTgYNWDKDILKSYAVELsgf 524 99999**********************89****8888888999444 PP CBM35.hmm 97 .kaGkntitiks 107 + G+n+i ik 312686|Boeex1_GeneCatalog_proteins_20171129.aa.fasta|GH27|CBM35 525 sTTGTNSIVIKG 536 447999998885 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (553 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 222.16 // Query: 19961|Fusoxrap1_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 [L=550] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-09 24.0 2.9 9.1e-09 22.8 2.9 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.8 2.9 4.5e-09 9.1e-09 8 119 .] 422 547 .. 414 547 .. 0.81 Alignments for each domain: == domain 1 score: 22.8 bits; conditional E-value: 4.5e-09 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYel 50 l+ + +++ +g+++s+ v++l +++++v ++ ++++ + ++ 19961|Fusoxrap1_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 422 LSSGAQTASCSGCTSSTKVGNLGgSSNGQVVLSNISTSKATQNV 465 5555556678999********985556667777666788999** PP CBM35.hmm 51 slrYang......tgstktlsvvvnGtkvsevtfpst.gnwdtw 87 + Y ng +++++ s+ vnG+ +++v+fp t nwd+ 19961|Fusoxrap1_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 466 LFDYINGdvgfggSTNERLASIKVNGGTAQTVSFPLTgYNWDKD 509 *****9855443346778889****************89****9 PP CBM35.hmm 88 gtaagtvtL....kaGkntitiks.dwGwi.nldslel 119 ++ v+L ++G ntiti+ + Gw ++d+l + 19961|Fusoxrap1_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 510 VYKGYAVELsgfnTNGPNTITISGvNGGWApDFDRLAV 547 999999***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (550 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 194.48 // Query: 11459|Fusoxcub1_GeneCatalog_proteins_20191005.aa.fasta|GH27|CBM35 [L=550] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-09 23.9 3.3 7.6e-09 23.0 2.8 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.0 2.8 3.8e-09 7.6e-09 7 119 .] 421 547 .. 415 547 .. 0.81 Alignments for each domain: == domain 1 score: 23.0 bits; conditional E-value: 3.8e-09 CBM35.hmm 7 sltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYe 49 sl+ + +++ +g+++s+ v++l +++++v ++ ++++ + + 11459|Fusoxcub1_GeneCatalog_proteins_20191005.aa.fasta|GH27|CBM35 421 SLSSGAKTASCSGCTSSTKVGNLGgSSNGQVVLSNISTSKATQN 464 5555556677899*********985556667777666788999* PP CBM35.hmm 50 lslrYang......tgstktlsvvvnGtkvsevtfpst.gnwdt 86 + + Y ng +++++ s+ vnG+ +++v+fp t nwd+ 11459|Fusoxcub1_GeneCatalog_proteins_20191005.aa.fasta|GH27|CBM35 465 VLFDYINGdvgfggSTNERLASIKVNGGTAQTVSFPLTgYNWDK 508 ******9855443346778889****************89**** PP CBM35.hmm 87 wgtaagtvtL....kaGkntitiks.dwGwi.nldslel 119 ++ v+L ++G ntiti+ + Gw ++d+l + 11459|Fusoxcub1_GeneCatalog_proteins_20191005.aa.fasta|GH27|CBM35 509 DVYKGYAVELsgfnTNGPNTITISGvNGGWApDFDRLAV 547 9999999***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (550 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.82 // Query: 288689|Elsamp1_GeneCatalog_proteins_20151205.aa.fasta|GH27|CBM35 [L=523] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-06 15.1 1.5 6.8e-06 13.5 1.5 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 13.5 1.5 3.4e-06 6.8e-06 18 112 .. 403 509 .. 390 518 .. 0.71 Alignments for each domain: == domain 1 score: 13.5 bits; conditional E-value: 3.4e-06 CBM35.hmm 18 agysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYan..... 56 ag+s+ + v+++ ++g++vt+ + +aG+ ++ + Y n 288689|Elsamp1_GeneCatalog_proteins_20151205.aa.fasta|GH27|CBM35 403 AGCSSGQKVGNI-GSGATVTLGgIR-ATAGTMDVLFDYVNceigy 445 566666667666.666777776444.4566666666655522211 PP CBM35.hmm 57 ..g.tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtLk 97 + + + + sv+vnG+++ +vtfp t nw++ ++ +v L+ 288689|Elsamp1_GeneCatalog_proteins_20151205.aa.fasta|GH27|CBM35 446 lgDqGPNLRGASVSVNGGQAVTVTFPLTgYNWEKDLVKGYKVRLS 490 112234557789****************89****99999*****8 PP CBM35.hmm 98 ....aGkntitiksdwGwi 112 G+nt+t+++ +G + 288689|Elsamp1_GeneCatalog_proteins_20151205.aa.fasta|GH27|CBM35 491 gfnvGGENTVTVGAATGVT 509 44445********998876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (523 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 91.36 // Query: 4021|ChetHm540_1_GeneCatalog_proteins_20210514.aa.fasta|GH27|CBM35 [L=559] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-08 21.1 2.3 7.2e-08 19.9 2.3 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.9 2.3 3.6e-08 7.2e-08 15 107 .. 439 543 .. 426 557 .. 0.77 Alignments for each domain: == domain 1 score: 19.9 bits; conditional E-value: 3.6e-08 CBM35.hmm 15 tnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYan 56 + +g+++s v+++ ++g++vt++ +++ + ++++ Y n 4021|ChetHm540_1_GeneCatalog_proteins_20210514.aa.fasta|GH27|CBM35 439 SPCSGCTSSNKVGNIGgSNGGRVTLSNIRTSKATQTVRFDYIN 481 4567999999999998678889999966677889999999999 PP CBM35.hmm 57 g......tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaag 92 g ++++++ s++vnG+++++v+fp t nw+ ++ 4021|ChetHm540_1_GeneCatalog_proteins_20210514.aa.fasta|GH27|CBM35 482 GnvdymgGTNERVASISVNGGAAKTVSFPLTgYNWNVDVSKNY 524 75533334678999*****************88***9999999 PP CBM35.hmm 93 tvtL....kaGkntitiks 107 v+L + G ntiti 4021|ChetHm540_1_GeneCatalog_proteins_20210514.aa.fasta|GH27|CBM35 525 GVELsgfsTTGPNTITIAG 543 9999444447999999975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (559 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 186.49 // Query: 23410|Fusox2_GeneCatalog_proteins_20150720.aa.fasta|GH27|CBM35 [L=549] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-09 22.7 2.7 1.8e-08 21.8 2.0 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.8 2.0 8.9e-09 1.8e-08 8 119 .] 422 547 .. 414 547 .. 0.81 Alignments for each domain: == domain 1 score: 21.8 bits; conditional E-value: 8.9e-09 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslr 53 l+ + +++ +g+++++ v++l +++++v ++ ++++ + ++ + 23410|Fusox2_GeneCatalog_proteins_20150720.aa.fasta|GH27|CBM35 422 LSSGAKTASCSGCTSTTKVGNLGgSSNGQVVLSNISTSQATPNVLFD 468 55555566788999999999998455666777766678899999999 PP CBM35.hmm 54 Yang......tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagt 93 Y ng +++++ s+ vnG+ +++v+fp t nwd+ ++ 23410|Fusox2_GeneCatalog_proteins_20150720.aa.fasta|GH27|CBM35 469 YLNGdvgfggSTNERLASIKVNGGTAQTVSFPLTgYNWDKDVYKGYA 515 999755443346778889****************89****9999999 PP CBM35.hmm 94 vtL....kaGkntitiks.dwGwi.nldslel 119 v+L ++G ntiti+ + Gw ++d+l + 23410|Fusox2_GeneCatalog_proteins_20150720.aa.fasta|GH27|CBM35 516 VELsgfnTNGPNTITISGvNGGWApDFDRLAV 547 ***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (549 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.38 // Query: 557208|Parch1_GeneCatalog_proteins_20171014.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-07 17.3 1.4 1.4e-06 15.8 1.4 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 15.8 1.4 6.9e-07 1.4e-06 14 106 .. 429 534 .. 417 549 .. 0.68 Alignments for each domain: == domain 1 score: 15.8 bits; conditional E-value: 6.9e-07 CBM35.hmm 14 ntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYang. 57 +++ +g+ +s+ v++l ++g++vt++ +++ + +++ Y ng 557208|Parch1_GeneCatalog_proteins_20171014.aa.fasta|GH27|CBM35 429 TQSCSGCMSSTKVGYLGgSNGGRVTISNIRTSRATQIVRFDYINGe 474 4556788888888888756677788875556777777777766652 PP CBM35.hmm 58 ......tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL 96 ++++++ ++vnG+++++v+fp + nwd+ +++ v+L 557208|Parch1_GeneCatalog_proteins_20171014.aa.fasta|GH27|CBM35 475 vgylggGANERVAAISVNGGAAQTVSFPLSgYNWDKDVSKDYAVEL 520 22221267899*****************9989****8888888988 PP CBM35.hmm 97 k....aGkntitik 106 + +ntiti+ 557208|Parch1_GeneCatalog_proteins_20171014.aa.fasta|GH27|CBM35 521 SgfstTNTNTITIS 534 52221345666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.97 // Query: 234340|Krezon1_GeneCatalog_proteins_20220127.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-08 19.6 0.9 2.2e-07 18.3 0.9 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.3 0.9 1.1e-07 2.2e-07 17 119 .] 432 549 .. 419 549 .. 0.73 Alignments for each domain: == domain 1 score: 18.3 bits; conditional E-value: 1.1e-07 CBM35.hmm 17 hagysGsgfvdglq.aagdavtfnvdvpkaGsYelslr....... 53 ag+ +s+ v++l +++++vt++ +++ + ++++ 234340|Krezon1_GeneCatalog_proteins_20220127.aa.fasta|GH27|CBM35 432 CAGCASSTKVGNLGgSSNGSVTLSNVRTSQATQTVKFDyincevg 476 566777777777764455667766333455555555551111111 PP CBM35.hmm 54 YangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL. 96 Y ++ + + s++vnG+ +++v+fp + nw t ++ v+L 234340|Krezon1_GeneCatalog_proteins_20220127.aa.fasta|GH27|CBM35 477 YLGSGNNGRLASISVNGGPAQTVSFPLSgYNWVTDIYTGYGVELs 521 55567788999***************9988****999999****5 PP CBM35.hmm 97 ...kaGkntitiks.dwGwi.nldslel 119 ++G n+iti+ +Gw ++d++ + 234340|Krezon1_GeneCatalog_proteins_20220127.aa.fasta|GH27|CBM35 522 gfnTEGPNSITISGaGTGWApDFDQIAV 549 55559*******9999***999999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 178.09 // Query: UPP54606.1|CBM35|GH27 [L=522] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-10 29.0 0.5 3.9e-10 27.2 0.5 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.2 0.5 2e-10 3.9e-10 1 106 [. 383 503 .. 383 519 .. 0.77 Alignments for each domain: == domain 1 score: 27.2 bits; conditional E-value: 2e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpkaGsYelslr.........YangtgstktlsvvvnGtkvsevt 77 yeAe a++ g++ ++ +g+sG + v+++ +ag+++tf+ + +++ + ++++ ++ g g+ + s++vnG+++++v+ UPP54606.1|CBM35|GH27 383 YEAEAAKVAGSAGVASCSGCSGGKKVGNVGnGAGNTLTFTgIR-TSQATQDVRFDyidceigyaFSGGYGNVRGASISVNGGAAQSVS 469 9*********99****************984677789999644.4444444444422444442244457888999************* PP CBM35.hmm 78 fpst.gnwdtwgtaagtvtL....kaGkntitik 106 fp t nwd+ t+ v L + G+nti+i+ UPP54606.1|CBM35|GH27 470 FPLTgYNWDKDVTKGFLVRLsgfsTSGDNTISIS 503 ****88****777777889944444799999886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (522 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.60 // Query: 330675|Stasp1_GeneCatalog_proteins_20141004.aa.fasta|GH27|CBM35 [L=554] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-08 20.4 0.7 1.4e-07 18.9 0.7 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.9 0.7 7.1e-08 1.4e-07 3 117 .. 419 549 .. 417 551 .. 0.76 Alignments for each domain: == domain 1 score: 18.9 bits; conditional E-value: 7.1e-08 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglqaagda.vtfnvdvpkaGs 47 A ++sl + +++ +g+s+s+ v++l ++g+a vt++ +++ s 330675|Stasp1_GeneCatalog_proteins_20141004.aa.fasta|GH27|CBM35 419 ASTGSLASGASTQSCSGCSSSTKVGNLGGSGNAaVTLSNIRTSQAS 464 6677777777788899999999999999666554888744455566 PP CBM35.hmm 48 YelslrYan.......g.tgstktlsvvvnGtkvsevtfpst.gnw 84 ++ + Y n g ++++ s++vnG++ +v+fp + +w 330675|Stasp1_GeneCatalog_proteins_20141004.aa.fasta|GH27|CBM35 465 QSVMFDYINcevgfsfGtATNERLASISVNGGAPVTVSFPLSgYDW 510 6666666653322222335678889***************99889* PP CBM35.hmm 85 dtwgtaagtvtL....kaGkntitiks.dwGwi.nldsl 117 ++ ++ +v+L + G+nti+i+ + G+ +ld++ 330675|Stasp1_GeneCatalog_proteins_20141004.aa.fasta|GH27|CBM35 511 SKDVYKGYKVQLggfsTSGTNTIKISGvNGGYApDLDRV 549 **999999****888789********9888887788876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (554 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.14 // Query: 13731|Fusfu1_GeneCatalog_proteins_20130915.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 759.81 // Query: 5732|Clapu1_GeneCatalog_proteins_20210223.aa.fasta|GH27|CBM35 [L=563] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-08 20.0 0.7 2.1e-07 18.4 0.2 2.2 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.9 0.0 0.2 0.4 63 90 .. 363 390 .. 358 429 .. 0.59 2 ! 18.4 0.2 1e-07 2.1e-07 18 117 .. 444 558 .. 427 560 .. 0.71 Alignments for each domain: == domain 1 score: -1.9 bits; conditional E-value: 0.2 CBM35.hmm 63 tlsvvvnGtkvsevtfpstgnwdtwgta 90 +++++n ++++ ++ ++w+ ++ta 5732|Clapu1_GeneCatalog_proteins_20210223.aa.fasta|GH27|CBM35 363 RRTLTLNFADIGVASAAVLDAWTGVNTA 390 5555555555555555555555554443 PP == domain 2 score: 18.4 bits; conditional E-value: 1e-07 CBM35.hmm 18 agysGsgfvdglqaagda..vtfnvdvpkaGsYelslr.......Yan 56 +g+s+s+ v++l +ag+ v n+ +++ + ++++ Y 5732|Clapu1_GeneCatalog_proteins_20210223.aa.fasta|GH27|CBM35 444 SGCSSSKKVSYLGGAGAGrvVLSNIR-TSQATQKVRFDyvngdvcYLG 490 67777777777776655443333344.344555566551122222555 PP CBM35.hmm 57 gtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtLk....aG 99 g++++++ s+ vnG++ + v+fp + +w+ ++ v+L+ G 5732|Clapu1_GeneCatalog_proteins_20210223.aa.fasta|GH27|CBM35 491 GGSNERVASIRVNGGAEQVVSFPLSgYDWERDVYQGYVVELSgfnvHG 538 67899******************998899998999999***866668* PP CBM35.hmm 100 kntitiks.dwGwi.nldsl 117 +nti+i+ +Gw +ld++ 5732|Clapu1_GeneCatalog_proteins_20210223.aa.fasta|GH27|CBM35 539 TNTISISGsGTGWApDLDRV 558 ******99899**9889876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (563 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.17 // Query: 506413|Kredeu1_GeneCatalog_proteins_20190325.aa.fasta|GH27|CBM35 [L=567] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (567 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 470.76 // Query: 8349|Fusoxrad1_GeneCatalog_proteins_20191005.aa.fasta|GH27|CBM35 [L=550] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-09 24.3 2.9 7.8e-09 23.0 2.9 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.0 2.9 3.9e-09 7.8e-09 7 119 .] 421 547 .. 414 547 .. 0.81 Alignments for each domain: == domain 1 score: 23.0 bits; conditional E-value: 3.9e-09 CBM35.hmm 7 sltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYel 50 sl+ + +++ +g+++++ v++l +++++v ++ ++++ + ++ 8349|Fusoxrad1_GeneCatalog_proteins_20191005.aa.fasta|GH27|CBM35 421 SLSSGAKTASCSGCTSTTKVGNLGgSSNGQVVLSNISTSKATQNV 465 5555556677899*********985556667777666788999** PP CBM35.hmm 51 slrYang......tgstktlsvvvnGtkvsevtfpst.gnwdtwg 88 + Y ng +++++ s+ vnG+ +++v+fp t nwd+ 8349|Fusoxrad1_GeneCatalog_proteins_20191005.aa.fasta|GH27|CBM35 466 LFDYINGdvgfggSTNERLASIKVNGGTAQTVSFPLTgYNWDKDV 510 *****9855443346778889****************89****99 PP CBM35.hmm 89 taagtvtL....kaGkntitiks.dwGwi.nldslel 119 ++ v+L ++G ntiti+ + Gw ++d+l + 8349|Fusoxrad1_GeneCatalog_proteins_20191005.aa.fasta|GH27|CBM35 511 YKGYAVELsgfkTNGPNTITISGvNGGWApDFDRLAV 547 99999***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (550 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 210.34 // Query: 911005|Fusoxalb1_GeneCatalog_proteins_20200914.aa.fasta|GH27|CBM35 [L=554] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-08 21.9 2.7 3e-08 21.1 2.0 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.1 2.0 1.5e-08 3e-08 8 119 .] 426 551 .. 420 551 .. 0.78 Alignments for each domain: == domain 1 score: 21.1 bits; conditional E-value: 1.5e-08 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYe 49 l+ + +++ +g+++s+ v++l +++++v ++ ++++ + + 911005|Fusoxalb1_GeneCatalog_proteins_20200914.aa.fasta|GH27|CBM35 426 LSSGAKTASCSGCTSSTKVGNLGgSSNGQVVLSNISTSKATQN 468 5555566778999*******99854556677776667788999 PP CBM35.hmm 50 lslrYang......tgstktlsvvvnGtkvsevtfpst.gnwd 85 + + Y ng +++++ s+ vnG+ +++v+fp t nwd 911005|Fusoxalb1_GeneCatalog_proteins_20200914.aa.fasta|GH27|CBM35 469 VLFDYINGdvgyggSTNERLASIKVNGGTAQTVSFPLTgYNWD 511 9999999855332234567789****************89*** PP CBM35.hmm 86 twgtaagtvtL....kaGkntitiks.dwGwi.nldslel 119 + ++ ++L + G nti+i+ + Gw ++d+l + 911005|Fusoxalb1_GeneCatalog_proteins_20200914.aa.fasta|GH27|CBM35 512 KDVYKGYVLELsgfsTSGPNTISISGvNGGWApDFDRLAV 551 *7777778899445558********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (554 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 75.98 // Query: 7142|Pyrtt1_GeneCatalog_proteins_20110408.aa.fasta|GH27|CBM35 [L=554] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-08 22.0 1.4 4.6e-08 20.5 1.4 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.5 1.4 2.3e-08 4.6e-08 16 110 .. 434 539 .. 418 551 .. 0.66 Alignments for each domain: == domain 1 score: 20.5 bits; conditional E-value: 2.3e-08 CBM35.hmm 16 nhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYang..... 57 + +g++++ v+++ ++++++t++ +++ + ++ + Y ng 7142|Pyrtt1_GeneCatalog_proteins_20110408.aa.fasta|GH27|CBM35 434 SCSGCTSNNRVGNIGgSSNGRLTLSNIRTSKATQSILIDYINGqvdym 481 556666666666665333444555533344455556566555533222 PP CBM35.hmm 58 .tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL....kaG 99 ++++++ s++vnG+++++v+fp t nwd+ t+ v+L + G 7142|Pyrtt1_GeneCatalog_proteins_20110408.aa.fasta|GH27|CBM35 482 gGSNERVASISVNGGAAKTVSFPLTgYNWDKDITKGYAVELsgfsTTG 529 2578999******************89****999999****545458* PP CBM35.hmm 100 kntitiksdwG 110 +ntiti+ G 7142|Pyrtt1_GeneCatalog_proteins_20110408.aa.fasta|GH27|CBM35 530 TNTITISG-AG 539 ******96.33 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (554 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 212.35 // Query: 266869|Ternu1_GeneCatalog_proteins_20140925.aa.fasta|GH27|CBM35 [L=528] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-08 22.4 0.4 1.4e-07 19.0 0.1 2.6 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.4 0.0 0.29 0.58 32 60 .. 348 376 .. 344 381 .. 0.75 2 ! 19.0 0.1 7e-08 1.4e-07 1 106 [. 385 508 .. 385 525 .. 0.74 Alignments for each domain: == domain 1 score: -2.4 bits; conditional E-value: 0.29 CBM35.hmm 32 agdavtfnvdvpkaGsYelslrYangtgs 60 +++a++++ +v++ Gs l+l+ ++t++ 266869|Ternu1_GeneCatalog_proteins_20140925.aa.fasta|GH27|CBM35 348 KQEATSYSTTVKAHGSVPLRLSKISKTKN 376 66788888999999999999887776444 PP == domain 2 score: 19.0 bits; conditional E-value: 7e-08 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpk 44 yeAe++ l+g ++ + +g+sG + v+++ ++gd++t++ ++ + 266869|Ternu1_GeneCatalog_proteins_20140925.aa.fasta|GH27|CBM35 385 YEAEEGDLSGRTTVVDCSGCSGGKKVGYIGeSSGDTLTIHgIQT-S 429 9***************************9857889999996665.5 PP CBM35.hmm 45 aGsYelslrYan.........g...tgstktlsvvvnGtkvsevtf 78 + + ++++ Y + g+ k s++vn+++++ev f 266869|Ternu1_GeneCatalog_proteins_20140925.aa.fasta|GH27|CBM35 430 QAEQDVRFDYVHceiaflhvaPedaHGNVKGASISVNDGAAQEVVF 475 566777777643222222222223367788899************* PP CBM35.hmm 79 pst.gnwdtwgtaagtvtL....kaGkntitik 106 p + +w+ + +v L + G+n+i+i+ 266869|Ternu1_GeneCatalog_proteins_20140925.aa.fasta|GH27|CBM35 476 PLSgYDWGVDVAKGFKVRLsgfkTTGDNSIKIS 508 *99778888566666888844444788888886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (528 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.67 // Query: 102881|Aurpu1_GeneCatalog_proteins_20220323.aa.fasta|GH27|CBM35 [L=553] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-10 27.3 0.4 1.3e-09 25.5 0.4 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.5 0.4 6.7e-10 1.3e-09 1 106 [. 413 533 .. 413 549 .. 0.77 Alignments for each domain: == domain 1 score: 25.5 bits; conditional E-value: 6.7e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpk 44 yeAe ++ g++ ++ +g+sG + v+++ ++g+++tf+ + ++ 102881|Aurpu1_GeneCatalog_proteins_20220323.aa.fasta|GH27|CBM35 413 YEAEAGQFAGSAGVASCSGCSGGKKVGNVGnGNGNTLTFSgIR-TS 457 9*********999***************983456668888544.34 PP CBM35.hmm 45 aGsYelslr.........YangtgstktlsvvvnGtkvsevtfpst 81 + + ++++ ++ g g+ + s++vnG+++++v+fp t 102881|Aurpu1_GeneCatalog_proteins_20220323.aa.fasta|GH27|CBM35 458 QATQDVRFDyidceigyaFSGGYGNVRGASISVNGGAAQSVSFPLT 503 44444444422333442244558888999***************** PP CBM35.hmm 82 .gnwdtwgtaagtvtL....kaGkntitik 106 nwd+ t+ v L + G+ntiti+ 102881|Aurpu1_GeneCatalog_proteins_20220323.aa.fasta|GH27|CBM35 504 gYNWDKDITKGFLVRLsgfkTSGDNTITIS 533 89****888888899944444899999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (553 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.26 // Query: QKD63095.2|CBM35|GH27 [L=549] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-09 24.2 2.9 8.2e-09 22.9 2.9 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.9 2.9 4.1e-09 8.2e-09 7 119 .] 421 547 .. 414 547 .. 0.81 Alignments for each domain: == domain 1 score: 22.9 bits; conditional E-value: 4.1e-09 CBM35.hmm 7 sltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYang......tgstktlsvvvnGtkvsevtfpst.gnwdt 86 sl+ + +++ +g+++s+ v++l +++++v ++ ++++ + ++ + Y ng +++++ s+ vnG+ +++v+fp t nwd+ QKD63095.2|CBM35|GH27 421 SLSSGAKTASCSGCTSSTKVGNLGgSSNGQVVLSNISTSKATQNVLFDYINGdvgfggSTNERLASIKVNGGTAQTVSFPLTgYNWDK 508 5555556677899*********985556667777666788999*******9855443346778889****************89**** PP CBM35.hmm 87 wgtaagtvtL....kaGkntitiks.dwGwi.nldslel 119 ++ v+L ++G ntiti+ + Gw ++d+l + QKD63095.2|CBM35|GH27 509 DVYKGYAVELsgfnTNGPNTITISGvNGGWApDFDRLAV 547 9999999***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (549 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 179.81 // Query: 4991|Fusox32931_GeneCatalog_proteins_20191005.aa.fasta|GH27|CBM35 [L=523] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-09 24.0 3.3 6.6e-09 23.2 2.7 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.2 2.7 3.3e-09 6.6e-09 7 119 .] 394 520 .. 387 520 .. 0.81 Alignments for each domain: == domain 1 score: 23.2 bits; conditional E-value: 3.3e-09 CBM35.hmm 7 sltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYe 49 sl+ + +++ +g+++s+ v++l +++++v ++ ++++ + + 4991|Fusox32931_GeneCatalog_proteins_20191005.aa.fasta|GH27|CBM35 394 SLSSGAKTASCSGCTSSTKVGNLGgSSNGQVVLSNISTSKATQN 437 5555556677899*********985556667777666788999* PP CBM35.hmm 50 lslrYang......tgstktlsvvvnGtkvsevtfpst.gnwdt 86 + + Y ng +++++ s+ vnG+ +++v+fp t nwd+ 4991|Fusox32931_GeneCatalog_proteins_20191005.aa.fasta|GH27|CBM35 438 VLFDYINGdvgfggSTNERLASIKVNGGTAQTVSFPLTgYNWDK 481 ******9855443346778889****************89**** PP CBM35.hmm 87 wgtaagtvtL....kaGkntitiks.dwGwi.nldslel 119 ++ v+L ++G ntiti+ + Gw ++d+l + 4991|Fusox32931_GeneCatalog_proteins_20191005.aa.fasta|GH27|CBM35 482 DVYKGYAVELsgfnTNGPNTITISGvNGGWApDFDRLAV 520 9999999***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (523 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.16 // Query: 12825|Fusoxlyc1_GeneCatalog_proteins_20191005.aa.fasta|GH27|CBM35 [L=550] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-09 22.7 2.4 2.4e-08 21.4 2.4 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.4 2.4 1.2e-08 2.4e-08 7 119 .] 421 547 .. 416 547 .. 0.81 Alignments for each domain: == domain 1 score: 21.4 bits; conditional E-value: 1.2e-08 CBM35.hmm 7 sltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYe 49 sl+ + +++ +g+++s+ v++l +++++v ++ ++++ + + 12825|Fusoxlyc1_GeneCatalog_proteins_20191005.aa.fasta|GH27|CBM35 421 SLSSGAKTASCSGCTSSTKVGNLGgSSNGQVVLSNISTSKATQN 464 5555556677899*********985556667777666788999* PP CBM35.hmm 50 lslrYang......tgstktlsvvvnGtkvsevtfpst.gnwdt 86 + + Y ng +++++ s+ vn++ +++v+fp t nwd+ 12825|Fusoxlyc1_GeneCatalog_proteins_20191005.aa.fasta|GH27|CBM35 465 VLFDYINGdvgfggSTNERLASIKVNDGTAQTVSFPLTgYNWDK 508 ******9855443346778889****************89**** PP CBM35.hmm 87 wgtaagtvtL....kaGkntitiks.dwGwi.nldslel 119 ++ v+L ++G ntiti+ + Gw ++d+l + 12825|Fusoxlyc1_GeneCatalog_proteins_20191005.aa.fasta|GH27|CBM35 509 DVYKGYAVELsgfnTNGPNTITISGvNGGWApDFDRLAV 547 9999999***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (550 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 183.74 // Query: 741155|Phimu1_GeneCatalog_proteins_20171129.aa.fasta|GH27|CBM35 [L=525] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-09 24.1 0.5 1e-08 22.6 0.5 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.6 0.5 5e-09 1e-08 2 118 .. 388 521 .. 387 522 .. 0.72 Alignments for each domain: == domain 1 score: 22.6 bits; conditional E-value: 5e-09 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdgl.qaagdavtfn.vdvpka 45 eAe a+l + ++ ++ ag+sG + v++l q+++++vtf+ v++ ++ 741155|Phimu1_GeneCatalog_proteins_20171129.aa.fasta|GH27|CBM35 388 EAEAATLANGAAIASCAGCSGGQKVGNLlQGSTASVTFKgVQASQS 433 9********999999**********9962688889****9998665 PP CBM35.hmm 46 GsYelslrYan.......g.tgstktlsvvvnGtkvsevtfpst.g 82 + ++ + Y n + + +t s++vnG+++ +v fp t 741155|Phimu1_GeneCatalog_proteins_20171129.aa.fasta|GH27|CBM35 434 -TVDVLFDYINcevqylgSsVPNVRTASISVNGGAAVTVLFPLTgY 478 .5555555555111111043457799******************77 PP CBM35.hmm 83 nwdtwgtaagtvtL...kaG.kntitiks..dwGwi.nldsle 118 nw +v L + G +ntit++s +G ++d+++ 741155|Phimu1_GeneCatalog_proteins_20171129.aa.fasta|GH27|CBM35 479 NWYGDVLPSYKVRLsgfTSGsQNTITVQSasGQGHApDIDRIR 521 8876555666777633356745899999966555555777775 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (525 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 77.86 // Query: 38487|NeFL0916_1_GeneCatalog_proteins_20190612.aa.fasta|GH27|CBM35 [L=387] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (387 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 449.47 // Query: 84966|Psean1_1_GeneCatalog_proteins_20140109.aa.fasta|GH27|CBM35 [L=575] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-08 22.6 0.6 3.5e-08 20.9 0.6 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.9 0.6 1.8e-08 3.5e-08 2 115 .. 442 570 .. 441 573 .. 0.82 Alignments for each domain: == domain 1 score: 20.9 bits; conditional E-value: 1.8e-08 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpka 45 eAe+++l g++++++ ag+s + v+++ ++g+++t++ p++ 84966|Psean1_1_GeneCatalog_proteins_20140109.aa.fasta|GH27|CBM35 442 EAESGTLAGNAAKASCAGCSNGSKVSNVGgGPGNTLTLTNIKPSS 486 9*******************9999999985778888888666999 PP CBM35.hmm 46 GsYelslrYangt........gstktlsvvvnGtkvsevtfpst. 81 + l + Y n++ ++++ +++vnG+ +++v+fp + 84966|Psean1_1_GeneCatalog_proteins_20140109.aa.fasta|GH27|CBM35 487 SEAVLYFDYINADvgfsfvgaTNERFAQISVNGGTAQNVSFPLSg 531 999999999996422222222689999***************998 PP CBM35.hmm 82 gnwdtwgtaagtvtLk....aGkntitiksdwGwi.nld 115 +w++ t+a +v L+ a ntiti++ +G+ ++d 84966|Psean1_1_GeneCatalog_proteins_20140109.aa.fasta|GH27|CBM35 532 YDWNKDVTKAYKVRLSgfkpASVNTITISNPNGYApDFD 570 89***999*******755557889999999888875666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (575 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 87.25 // Query: 284943|Fusoxy1_GeneCatalog_proteins_20171014.aa.fasta|GH27|CBM35 [L=550] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-09 24.3 2.7 7.4e-09 23.1 2.7 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.1 2.7 3.7e-09 7.4e-09 7 119 .] 421 547 .. 415 547 .. 0.81 Alignments for each domain: == domain 1 score: 23.1 bits; conditional E-value: 3.7e-09 CBM35.hmm 7 sltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYel 50 sl+ + +++ +g+++s+ v++l +++++v ++ ++++ + ++ 284943|Fusoxy1_GeneCatalog_proteins_20171014.aa.fasta|GH27|CBM35 421 SLSSGAKTASCSGCTSSTKVGNLGgSSNGQVVLSNISTSKATQNV 465 5555556677899*********985556667777666788999** PP CBM35.hmm 51 slrYang......tgstktlsvvvnGtkvsevtfpst.gnwdtwg 88 + Y ng +++++ s+ vnG+ +++v+fp t nwd+ 284943|Fusoxy1_GeneCatalog_proteins_20171014.aa.fasta|GH27|CBM35 466 LFDYINGdvgfggSTNERLASIKVNGGTAQTVSFPLTgYNWDKDV 510 *****9855443346778889****************89****99 PP CBM35.hmm 89 taagtvtL....kaGkntitiks.dwGwi.nldslel 119 ++ v+L ++G ntiti+ + Gw ++d+l + 284943|Fusoxy1_GeneCatalog_proteins_20171014.aa.fasta|GH27|CBM35 511 YKGYAVELsgfnTNGPNTITISGvNGGWApDFDRLAV 547 99999***555559********99****999999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (550 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 183.17 // Query: 363963|XylFL0933_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-08 21.3 1.2 6.3e-08 20.1 1.2 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.1 1.2 3.2e-08 6.3e-08 32 119 .] 461 552 .. 420 552 .. 0.74 Alignments for each domain: == domain 1 score: 20.1 bits; conditional E-value: 3.2e-08 CBM35.hmm 32 agdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs 74 ++++t +v+ + + ++ Y ++ +++ s++vnG++++ 363963|XylFL0933_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 461 RTSQTTQTVKF---DYINCEIGYLGSGNNERLASISVNGGAAK 500 44444444443...4457788899999999************* PP CBM35.hmm 75 evtfpst.gnwdtwgtaagtvtL....kaGkntitiks.dwGw 111 +v+fp + nw++ + v+L + G+nti+i+ +Gw 363963|XylFL0933_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 501 TVSFPISgYNWGSDVYEGYGVELsgfnTGGANTISISGaGTGW 543 *****9989****8888889***444447*******9999*** PP CBM35.hmm 112 i.nldslel 119 ++d++ + 363963|XylFL0933_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 544 ApDFDQIAV 552 999999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 195.06 // Query: 285403|Colfi1_GeneCatalog_proteins_20160218.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-09 23.0 2.9 1.3e-08 22.2 2.1 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.2 2.1 6.7e-09 1.3e-08 8 107 .. 425 538 .. 417 552 .. 0.73 Alignments for each domain: == domain 1 score: 22.2 bits; conditional E-value: 6.7e-09 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYels 51 l+ + ++ +g+++s v++l ++++ v nv kaG+ ++ 285403|Colfi1_GeneCatalog_proteins_20160218.aa.fasta|GH27|CBM35 425 LSSGANLQSCSGCTSSNKVGNLGGSSNGrvVISNVSTSKAGTQTVL 470 5555555678999*******99854433447778************ PP CBM35.hmm 52 lrYang.......tgstktlsvvvnGtkvsevtfpst.gnwdtwgt 89 + Y ng + +++ s++vnG+++++v+fp + nw+ 285403|Colfi1_GeneCatalog_proteins_20160218.aa.fasta|GH27|CBM35 471 FDYINGdvgylggSNNERLASISVNGGAAQTVSFPLSgYNWSADVF 516 **8887332222245678899**************99889*99766 PP CBM35.hmm 90 aagtvtLk....aGkntitiks 107 + v+L+ G+nti+i+ 285403|Colfi1_GeneCatalog_proteins_20160218.aa.fasta|GH27|CBM35 517 KGYAVELTgfaaGGANTISISG 538 6777888633335899999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.35 // Query: 773303|Clapol1_1_GeneCatalog_proteins_20180327.aa.fasta|GH27|CBM35 [L=541] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-08 21.5 1.2 5.6e-08 20.2 1.2 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.2 1.2 2.8e-08 5.6e-08 1 107 [. 407 522 .. 407 538 .. 0.68 Alignments for each domain: == domain 1 score: 20.2 bits; conditional E-value: 2.8e-08 CBM35.hmm 1 yeAedasltgvsvntnhagysG...sgfvdglqaagdavtfn. 39 yeAe+a l + + +g+sG g+v+ l+ +g v+ + 773303|Clapol1_1_GeneCatalog_proteins_20180327.aa.fasta|GH27|CBM35 407 YEAETAALADGANVQACSGCSGgkkAGYVGTLTFSG--VRSAr 447 99***9999955555666666622246666654322..22222 PP CBM35.hmm 40 vdvpkaGsY...elslrYangtgstktlsvvvnGtkvsevtfp 79 ++ + +Y ++++++ n +++++ v+vnG+ + ev fp 773303|Clapol1_1_GeneCatalog_proteins_20180327.aa.fasta|GH27|CBM35 448 ATAAVRFDYvngDVQFSFDN-KTNARGAAVSVNGGPATEVYFP 489 33333444433368888888.699999**************** PP CBM35.hmm 80 st.gnwdtwgtaagtvtL....kaGkntitiks 107 t nwdt v+L + G+ntit+k 773303|Clapol1_1_GeneCatalog_proteins_20180327.aa.fasta|GH27|CBM35 490 VTgYNWDTDVWRSFLVELsgfnTSGANTITVKG 522 **89****6666667788444458*****9996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (541 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 181.24 // Query: 595039|Xylbam139988_1_GeneCatalog_proteins_20190612.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-07 18.7 0.3 4e-07 17.5 0.3 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 17.5 0.3 2e-07 4e-07 49 118 .. 475 551 .. 421 552 .. 0.68 Alignments for each domain: == domain 1 score: 17.5 bits; conditional E-value: 2e-07 CBM35.hmm 49 elslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtw 87 + ++Y g+++++ s+ vnG+++++v+fp + nw t 595039|Xylbam139988_1_GeneCatalog_proteins_20190612.aa.fasta|GH27|CBM35 475 NCDISYLGGGSNERLASIKVNGGAAQTVSFPLSgYNWATD 514 45567888999********************9989****9 PP CBM35.hmm 88 gtaagtvtL....kaGkntitiks..dwGwinldsle 118 a+ v+L ++G n+i+i+ ++ + ++d++ 595039|Xylbam139988_1_GeneCatalog_proteins_20190612.aa.fasta|GH27|CBM35 515 IHADYGVQLsgfnTQGPNSISISGvgNSYAPDFDRIA 551 99*******555559******9986555555777775 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 198.31 // Query: 445593|Aaoar1_GeneCatalog_proteins_20140429.aa.fasta|GH27|CBM35 [L=554] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-06 13.1 0.1 2.6e-05 11.7 0.1 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 11.7 0.1 1.3e-05 2.6e-05 50 107 .. 475 537 .. 447 551 .. 0.81 Alignments for each domain: == domain 1 score: 11.7 bits; conditional E-value: 1.3e-05 CBM35.hmm 50 lslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtv 94 ++ Y g+ +++ s++vnG +++ v+fp + nw+ + +v 445593|Aaoar1_GeneCatalog_proteins_20140429.aa.fasta|GH27|CBM35 475 CEIGYLGGSNNERLASISVNGRSAQVVSFPLSgYNWEVDVYRGFKV 520 5789999999********************9978999877777889 PP CBM35.hmm 95 tL....kaGkntitiks 107 +L + G n+it++ 445593|Aaoar1_GeneCatalog_proteins_20140429.aa.fasta|GH27|CBM35 521 ELsgfnTSGPNNITVSG 537 98444446888888775 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (554 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 199.94 // Query: 109593|Sepmu1_GeneCatalog_proteins_20100915.aa.fasta|GH27|CBM35 [L=568] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (568 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 567.24 // Query: 321696|XylFL1042_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 [L=373] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-09 24.2 0.8 7.9e-09 23.0 0.8 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.0 0.8 3.9e-09 7.9e-09 17 119 .] 253 370 .. 239 370 .. 0.69 Alignments for each domain: == domain 1 score: 23.0 bits; conditional E-value: 3.9e-09 CBM35.hmm 17 hagysGsgfvdglq.aagda.......vtfnvdvpkaGsYels 51 +g+++s v++l +++++ ++ + + k + + + 321696|XylFL1042_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 253 CSGCTSSNKVGNLGgSSNGKvilsnirTSQATQTVKFDYINCE 295 5566666666666622233322222211122222222333556 PP CBM35.hmm 52 lrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagt 93 + Y ++ +++ sv+vnG++++ v+fp + nwd+ + 321696|XylFL1042_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 296 IGYLGSSNNERLASVSVNGGAAQVVSFPISgYNWDSDIYEGYG 338 678878899999****************9989****9999999 PP CBM35.hmm 94 vtL....kaGkntitiks.dwGwi.nldslel 119 v+L + G+ntiti+ +Gw +ld++ + 321696|XylFL1042_GeneCatalog_proteins_20190320.aa.fasta|GH27|CBM35 339 VELsgfnTGGANTITISGsGTGWApDLDRIAV 370 ***444447*******9989***99***9976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (373 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 59.10 // Query: 499233|XyFL0064_1_GeneCatalog_proteins_20191108.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-08 22.6 0.9 2.5e-08 21.4 0.9 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.4 0.9 1.2e-08 2.5e-08 46 119 .] 472 552 .. 421 552 .. 0.71 Alignments for each domain: == domain 1 score: 21.4 bits; conditional E-value: 1.2e-08 CBM35.hmm 46 GsYelslrYangtgstktlsvvvnGtkvsevtfpst.gnwdt 86 + + ++ Y ++ +++ s++vnG+++++v+fp + nwd+ 499233|XyFL0064_1_GeneCatalog_proteins_20191108.aa.fasta|GH27|CBM35 472 DYINCEIGYLGSGNNERLASISVNGGAAKTVSFPISgYNWDS 513 33456777888899999*****************9989**** PP CBM35.hmm 87 wgtaagtvtL....kaGkntitiks.dwGwi.nldslel 119 + v+L + G+nti+i+ +Gw ++d++ + 499233|XyFL0064_1_GeneCatalog_proteins_20191108.aa.fasta|GH27|CBM35 514 DVYEGYGVELsgfnTGGANTISISGaGTGWApDFDRIAV 552 8888899***444447*******9999***999999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 190.26 // Query: 134014|Cocsa1_GeneCatalog_proteins_20110610.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-08 20.3 3.0 1.1e-07 19.3 2.7 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.3 2.7 5.6e-08 1.1e-07 15 107 .. 431 535 .. 416 549 .. 0.77 Alignments for each domain: == domain 1 score: 19.3 bits; conditional E-value: 5.6e-08 CBM35.hmm 15 tnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYang.. 57 + +g+++s v+++ ++g++vt++ +++ + ++s+ Y ng 134014|Cocsa1_GeneCatalog_proteins_20110610.aa.fasta|GH27|CBM35 431 SPCSGCTSSNKVGNIGgSNGGRVTLSNIRTSKATQTVSFDYINGnv 476 5567999999999998578889999966677889999999999755 PP CBM35.hmm 58 ....tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL.. 96 ++++++ s++vnG+++++v+fp t nw+ ++ v+L 134014|Cocsa1_GeneCatalog_proteins_20110610.aa.fasta|GH27|CBM35 477 dymgGTNERVASISVNGGAAKTVSFPLTgYNWNVDVSKGYGVELsg 522 33334678999*****************889**9888999999944 PP CBM35.hmm 97 ..kaGkntitiks 107 + G ntiti+ 134014|Cocsa1_GeneCatalog_proteins_20110610.aa.fasta|GH27|CBM35 523 fsTSGPNTITISG 535 4448999999975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.33 // Query: 473932|Xylacu1_GeneCatalog_proteins_20190613.aa.fasta|GH27|CBM35 [L=559] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (559 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 617.40 // Query: 11321|CadmalM221_1_GeneCatalog_proteins_20220609.aa.fasta|GH27|CBM35 [L=525] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-08 20.4 0.1 1.9e-07 18.5 0.0 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.0 0.34 0.68 59 84 .. 321 346 .. 317 353 .. 0.72 2 ! 18.5 0.0 9.5e-08 1.9e-07 2 119 .] 388 522 .. 387 522 .. 0.77 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.34 CBM35.hmm 59 gstktlsvvvnGtkvsevtfpstgnw 84 +s+k +++ vn t+v+ + ++ + w 11321|CadmalM221_1_GeneCatalog_proteins_20220609.aa.fasta|GH27|CBM35 321 HSNKARTLAVNLTSVGISSATARDLW 346 57888999999888885555555545 PP == domain 2 score: 18.5 bits; conditional E-value: 9.5e-08 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfnvd 41 eAe+a+l + + ++ +g+s + v++l ++++++tf+ 11321|CadmalM221_1_GeneCatalog_proteins_20220609.aa.fasta|GH27|CBM35 388 EAESATLANGASIASCPGCSNGQKVGNLIsGSTASLTFKGI 428 89*****9977777899999888888875277778999977 PP CBM35.hmm 42 vpkaGsYelslrYangtg........stktlsvvvnGtkvs 74 ++++ + ++ + Y n + + +t s++vnG+++ 11321|CadmalM221_1_GeneCatalog_proteins_20220609.aa.fasta|GH27|CBM35 429 STSQSTVDVLFDYINCEVqylgssvpNVRTASISVNGGAAV 469 778888888888777543112222226799*********** PP CBM35.hmm 75 evtfpst.gnwdtwgtaagtvtLk....aGkntitiks..d 108 +v fp + nw+ +v L+ G+nti+i+s 11321|CadmalM221_1_GeneCatalog_proteins_20220609.aa.fasta|GH27|CBM35 470 TVLFPLSgYNWNGDVLPSYKVRLSgfnsGGQNTISIQStpG 510 *****99889*998888999999633336*********997 PP CBM35.hmm 109 wGwi.nldslel 119 +G ++d++++ 11321|CadmalM221_1_GeneCatalog_proteins_20220609.aa.fasta|GH27|CBM35 511 QGHApDIDRIRV 522 777669999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (525 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.34 // Query: 142489|Colorb1_GeneCatalog_proteins_20180806.aa.fasta|GH27|CBM35 [L=554] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-06 15.0 0.3 7.7e-06 13.3 0.0 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.1 0.15 0.31 10 25 .. 375 393 .. 369 398 .. 0.69 2 ! 13.3 0.0 3.8e-06 7.7e-06 51 111 .. 476 542 .. 450 551 .. 0.78 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.15 CBM35.hmm 10 g...vsvntnhagysGsgf 25 +++ +n++gysG+ + 142489|Colorb1_GeneCatalog_proteins_20180806.aa.fasta|GH27|CBM35 375 DlwsSTTVENATGYSGQVN 393 4444788889999999865 PP == domain 2 score: 13.3 bits; conditional E-value: 3.8e-06 CBM35.hmm 51 slrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtv 94 ++ Y ng+ +++ sv+vn++++++v+fp + nwd v 142489|Colorb1_GeneCatalog_proteins_20180806.aa.fasta|GH27|CBM35 476 EVGYLNGGNNERLASVTVNDGAAQTVSFPLSgYNWDADVFRGYAV 520 689**************************9988999955555666 PP CBM35.hmm 95 tLk....aGkntitiks.dwGw 111 +L+ G n i+i+ +G+ 142489|Colorb1_GeneCatalog_proteins_20180806.aa.fasta|GH27|CBM35 521 ELSgfkvDGPNIIKISGaGTGF 542 7753333566666666555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (554 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 190.41 // Query: 7190|Colsp1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-08 21.2 4.1 4.5e-08 20.5 3.1 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.5 3.1 2.3e-08 4.5e-08 8 107 .. 425 538 .. 418 552 .. 0.73 Alignments for each domain: == domain 1 score: 20.5 bits; conditional E-value: 2.3e-08 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYelslr 53 l+ + ++ +g+++s v++l ++++ v nv kaG+ ++ + 7190|Colsp1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 425 LSSGANLQSCSGCTSSNKVGNLGGSSNGrvVLSNVSTSKAGTQTVLFD 472 5555555678999*******99844333336677************** PP CBM35.hmm 54 Yang.......tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagt 93 Y ng + +++ s++vnG+++++v+fp + nw+ + 7190|Colsp1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 473 YTNGdvgylggSNNERLASISVNGGAAQTVSFPLSgYNWSADVFKGYA 520 8887332221245678899**************99889*996666677 PP CBM35.hmm 94 vtLk....aGkntitiks 107 v+L+ G+nti+i+ 7190|Colsp1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 521 VELTgftaGGANTISISG 538 777633334899999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.87 // Query: UKZ57108.1|CBM35|GH27 [L=554] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (554 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 429.59 // Query: 736346|XyFL1777_1_GeneCatalog_proteins_20190501.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-09 23.4 1.6 1.4e-08 22.2 1.6 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.2 1.6 7e-09 1.4e-08 17 118 .. 435 551 .. 421 552 .. 0.69 Alignments for each domain: == domain 1 score: 22.2 bits; conditional E-value: 7e-09 CBM35.hmm 17 hagysGsgfvdglq.aagdavtfn.vdvpkaGsYelslr... 53 +g+++s+ v++l +a+++v ++ + +++ + ++++ 736346|XyFL1777_1_GeneCatalog_proteins_20190501.aa.fasta|GH27|CBM35 435 CTGCTSSTKVGNLGgSANGNVVLSnIR-TSQATQTVKFDyin 475 566677777776653333333333133.23333444444111 PP CBM35.hmm 54 ....YangtgstktlsvvvnGtkvsevtfpst.gnwdtwgta 90 Y ++ +++ s++vnG+ +++v+fp + nwd+ +a 736346|XyFL1777_1_GeneCatalog_proteins_20190501.aa.fasta|GH27|CBM35 476 cevgYLGSGNNERLASISVNGGPAQTVSFPLSgYNWDKDIYA 517 11117777889999****************9989****9999 PP CBM35.hmm 91 agtvtL....kaGkntitiks.dwGwi.nldsle 118 +v+L + G+nti+i+ +Gw ++d++ 736346|XyFL1777_1_GeneCatalog_proteins_20190501.aa.fasta|GH27|CBM35 518 GYSVQLsgfnTGGTNTIKISGaGTGWApDFDRIG 551 ******444447*******9999***98999985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 206.78 // Query: 1793|Psehu1_GeneCatalog_proteins_20130926.aa.fasta|GH27|CBM35 [L=939] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-08 20.7 0.9 3.9e-08 20.7 0.9 2.7 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.9 0.2 0.21 0.42 59 87 .. 325 353 .. 317 363 .. 0.78 2 ! 20.7 0.9 2e-08 3.9e-08 2 107 .. 392 511 .. 391 522 .. 0.73 Alignments for each domain: == domain 1 score: -1.9 bits; conditional E-value: 0.21 CBM35.hmm 59 gstktlsvvvnGtkvsevtfpstgnwdtw 87 +s+ +++++v+ ++ + ++ + t+ w+ 1793|Psehu1_GeneCatalog_proteins_20130926.aa.fasta|GH27|CBM35 325 WSNTQNTITVDFAQLGVASADVTDLWTGA 353 56788999999999999999999988864 PP == domain 2 score: 20.7 bits; conditional E-value: 2e-08 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpkaGs 47 eAe+++l g +++++ ag+sG + v+++ +ag+++t+n +++ ++ + 1793|Psehu1_GeneCatalog_proteins_20130926.aa.fasta|GH27|CBM35 392 EAESGTLAGKAATASCAGCSGGTKVGYVGgGAGNTLTLNgIKA-SGNE 438 8*************************99856777889997776.4455 PP CBM35.hmm 48 YelslrYang........tgstktlsvvvnGtkvsevtfpst.gnwdt 86 l + Y n+ +++++ +++vnG+++++v+fp + +w+ 1793|Psehu1_GeneCatalog_proteins_20130926.aa.fasta|GH27|CBM35 439 AVLYFDYINAdvgfsfvgATNEREAQISVNGGSAQNVSFPLSgYDWSL 486 56666777752211111257899*****************99678887 PP CBM35.hmm 87 wgtaagtvtL...kaG.kntitiks 107 t+ +v L k G +n+iti++ 1793|Psehu1_GeneCatalog_proteins_20130926.aa.fasta|GH27|CBM35 487 DVTKGYKVRLtgfKTGqSNSITISN 511 6777777777222345336666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (939 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 235.00 // Query: QKD57556.2|CBM35|GH27 [L=551] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-07 19.2 1.7 4.7e-07 17.3 0.1 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.1 0.1 0.048 0.097 33 66 .. 383 416 .. 374 419 .. 0.83 2 ! 17.3 0.1 2.3e-07 4.7e-07 52 118 .. 476 548 .. 422 549 .. 0.79 Alignments for each domain: == domain 1 score: 0.1 bits; conditional E-value: 0.048 CBM35.hmm 33 gdavtfnvdvpkaGsYelslrYangtgstktlsv 66 +da++++ +v+ Gs +l+l+ +g ++tk+ s QKD57556.2|CBM35|GH27 383 NDATSISTQVNGHGSVALRLSNVQGASDTKNYSY 416 7889999999999999999999998888887764 PP == domain 2 score: 17.3 bits; conditional E-value: 2.3e-07 CBM35.hmm 52 lrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtL....kaGkntitiks.dwGwi.nldsle 118 ++Y +++++ s+ vnG+++++v+fp t +wd+ + tv+L + G ntiti+ + w ++d+l QKD57556.2|CBM35|GH27 476 VQYIG-GTNERLASIKVNGGAAQSVSFPLTgYDWDKDVYGNYTVELsgfnTRGPNTITISGvNGAWApDFDRLA 548 45665.6889999*****************889***999999****555458*******995555556777765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (551 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.46 // Query: 1019396|Colny1_GeneCatalog_proteins_20160329.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-08 21.7 3.8 2.6e-08 21.3 2.4 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.3 2.4 1.3e-08 2.6e-08 8 107 .. 425 538 .. 418 552 .. 0.73 Alignments for each domain: == domain 1 score: 21.3 bits; conditional E-value: 1.3e-08 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYel 50 l+ + ++ +g+++s v++l ++++ v nv kaG+ ++ 1019396|Colny1_GeneCatalog_proteins_20160329.aa.fasta|GH27|CBM35 425 LSSGANLQSCSGCTSSNKVGNLGGSSNGrvVLSNVSTSKAGTQTV 469 5555555678999*******99844333336677*********** PP CBM35.hmm 51 slrYang.......tgstktlsvvvnGtkvsevtfpst.gnwdtw 87 + Y ng + +++ s++vnG+++++v+fp + nw+ 1019396|Colny1_GeneCatalog_proteins_20160329.aa.fasta|GH27|CBM35 470 LFDYINGdvgylggSNNERLASISVNGGAAQTVSFPLSgYNWSAD 514 ***8887332222245678899**************99889*996 PP CBM35.hmm 88 gtaagtvtLk....aGkntitiks 107 + v+L+ G+nti+i+ 1019396|Colny1_GeneCatalog_proteins_20160329.aa.fasta|GH27|CBM35 515 VFKGYAVELTgftaGGANTISISG 538 666677777633334899999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 78.22 // Query: 16696|Collup1_GeneCatalog_proteins_20180803.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-08 22.2 3.1 2.5e-08 21.4 2.3 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.4 2.3 1.2e-08 2.5e-08 8 107 .. 425 538 .. 418 552 .. 0.73 Alignments for each domain: == domain 1 score: 21.4 bits; conditional E-value: 1.2e-08 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYels 51 l+ + ++ +g+++s v++l ++++ v nv kaG+ ++ 16696|Collup1_GeneCatalog_proteins_20180803.aa.fasta|GH27|CBM35 425 LSSGANLQSCSGCTSSNKVGNLGGSSNGrvVLSNVSTSKAGTQTVL 470 5555555678999*******99844333336677************ PP CBM35.hmm 52 lrYang.......tgstktlsvvvnGtkvsevtfpst.gnwdtwgt 89 + Y ng + +++ s++vnG+++++v+fp + nw+ 16696|Collup1_GeneCatalog_proteins_20180803.aa.fasta|GH27|CBM35 471 FDYINGdvgylggSNNERLASISVNGGAAQTVSFPLSgYNWSADVF 516 **8887332222245678899**************99889*99666 PP CBM35.hmm 90 aagtvtLk....aGkntitiks 107 + v+L+ G+nti+i+ 16696|Collup1_GeneCatalog_proteins_20180803.aa.fasta|GH27|CBM35 517 KGYAVELTgftaGGANTISISG 538 6677777633334899999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.53 // Query: 16435|Colpa1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-08 22.6 2.6 2.3e-08 21.5 2.2 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.5 2.2 1.2e-08 2.3e-08 8 107 .. 425 538 .. 418 552 .. 0.73 Alignments for each domain: == domain 1 score: 21.5 bits; conditional E-value: 1.2e-08 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda..vtfnvdvpkaGsYelsl 52 l+ + ++ +g+++s v++l ++++ v nv kaG+ ++ + 16435|Colpa1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 425 LSSGANLQSCSGCTSSNKVGNLGGSSNGrvVLSNVSTSKAGTQTVLF 471 5555555678999*******99844333336677************* PP CBM35.hmm 53 rYang.......tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaa 91 Y ng + +++ s++vnG+++++v+fp + nw+ + 16435|Colpa1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 472 DYINGdvgylggSNNERLASISVNGGAAQTVSFPLSgYNWSADVFKG 518 *8887332222245678899**************99889*9966666 PP CBM35.hmm 92 gtvtLk....aGkntitiks 107 v+L+ G+nti+i+ 16435|Colpa1_GeneCatalog_proteins_20180729.aa.fasta|GH27|CBM35 519 YAVELTgftaGGANTISISG 538 77777633334899999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.82 // Query: 77027|Setho1_GeneCatalog_proteins_20150424.aa.fasta|GH27|CBM35 [L=558] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-08 21.3 2.0 7.5e-08 19.8 2.0 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.8 2.0 3.8e-08 7.5e-08 3 117 .. 424 553 .. 422 555 .. 0.77 Alignments for each domain: == domain 1 score: 19.8 bits; conditional E-value: 3.8e-08 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsY 48 A ++sl+ + +++ +g+s+s+ v++l ++g++vt++ +++ + 77027|Setho1_GeneCatalog_proteins_20150424.aa.fasta|GH27|CBM35 424 ASTGSLSSGANTQSCSGCSSSTKVGYLGgSNGGRVTISNIRTSQATQ 470 7778888887888999***********96778889999656777888 PP CBM35.hmm 49 elslrYang.......tgstktlsvvvnGtkvsevtfpst.gnwdtw 87 +++ Y ng +++++ ++vnG+++++v+f + nwd 77027|Setho1_GeneCatalog_proteins_20150424.aa.fasta|GH27|CBM35 471 IVRFDYINGevgylggGTNERIAAISVNGGAAKTVSFALSgYNWDRD 517 88888777532222125788999***************9989****9 PP CBM35.hmm 88 gtaagtvtL....kaGkntitiks.dwGwi.nldsl 117 +++ v+L + G+ntiti+ + +ld++ 77027|Setho1_GeneCatalog_proteins_20150424.aa.fasta|GH27|CBM35 518 VSKDYAVELsgfsTTGTNTITISGvGRAYApDLDRI 553 9999*****445458******987533332366665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (558 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 87.54 // Query: 498851|Parchr1_GeneCatalog_proteins_20190213.aa.fasta|GH27|CBM35 [L=517] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-09 23.3 2.6 1.3e-08 22.3 1.9 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.9 0.0 0.21 0.42 34 62 .. 347 375 .. 319 394 .. 0.65 2 ! 22.3 1.9 6.7e-09 1.3e-08 3 117 .. 383 512 .. 380 514 .. 0.75 Alignments for each domain: == domain 1 score: -1.9 bits; conditional E-value: 0.21 CBM35.hmm 34 davtfnvdvpkaGsYelslrYangtgstk 62 + +f+ +v++ Gs +l+l+ + ++++k 498851|Parchr1_GeneCatalog_proteins_20190213.aa.fasta|GH27|CBM35 347 SGSSFSKQVNAHGSLALRLSNIQRSTASK 375 23566667777777777777666544444 PP == domain 2 score: 22.3 bits; conditional E-value: 6.7e-09 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaG 46 A ++sl + +++ +g+++s+ v++l ++g++vt++ +++ 498851|Parchr1_GeneCatalog_proteins_20190213.aa.fasta|GH27|CBM35 383 ASTGSLASGANTQSCSGCTSSTKVGYLGgSNGGRVTISNIRTSKA 427 6667777777778899**********9967788899984445666 PP CBM35.hmm 47 sYelslrYang.......tgstktlsvvvnGtkvsevtfpst.gn 83 + +++ Y n+ +++++ ++vnG+++++v+fp + n 498851|Parchr1_GeneCatalog_proteins_20190213.aa.fasta|GH27|CBM35 428 TQIVRFDYINSevgylggGTNERLAAISVNGGAAQTVSFPLSgYN 472 6777777665422111116788999***************9989* PP CBM35.hmm 84 wdtwgtaagtvtLka....Gkntitiks..dwGwinldsl 117 wd+ +++ v+L+ G+ntiti+ + + +ld++ 498851|Parchr1_GeneCatalog_proteins_20190213.aa.fasta|GH27|CBM35 473 WDKDVSKDYAVELTGfstiGANTITISGvgNAYAPDLDRI 512 ***99999*****744444*******98644444477776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (517 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.48 // Query: CAK1359941.1|CBM35|GH27 [L=554] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-10 26.1 0.2 1.9e-09 25.0 0.2 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.0 0.2 9.4e-10 1.9e-09 2 113 .. 420 542 .. 419 552 .. 0.81 Alignments for each domain: == domain 1 score: 25.0 bits; conditional E-value: 9.4e-10 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslr.......YangtgstktlsvvvnGtkvsevtfps 80 eAe++s g + ++ +g+sG + +++ + g+++t++ +++ + +l++ Y+ + +t+ s++vnG+ ++v fp CAK1359941.1|CBM35|GH27 420 EAESGSFAGGANVQSCSGCSGGQKAGNIGNGGGSLTLSNVRTSQATQDLRFDyidcevgYMG-GLNTRGASISVNGGPGQSVIFPL 504 8********888999*********************99555677888888882233333444.6899******************* PP CBM35.hmm 81 t.gnwdtwgtaagtvtL....kaGkntitiksdwGwin 113 t nwd+ + v L + G+nti+i+ +G+++ CAK1359941.1|CBM35|GH27 505 TgYNWDKDVAKNHLVRLsgfsTTGTNTIKISGLSGNTQ 542 *88****7777778999445458******998666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (554 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 196.19 // Query: 162660|Settu3_GeneCatalog_proteins_20170818.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-07 17.1 2.1 1.5e-06 15.7 2.1 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 15.7 2.1 7.3e-07 1.5e-06 7 97 .. 423 521 .. 416 549 .. 0.73 Alignments for each domain: == domain 1 score: 15.7 bits; conditional E-value: 7.3e-07 CBM35.hmm 7 sltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYels 51 sl+ + +++ +g+s+s+ v++l +++++vt++ +++ + ++ 162660|Settu3_GeneCatalog_proteins_20170818.aa.fasta|GH27|CBM35 423 SLSSGANTQSCSGCSSSTRVGNLGgSSNGRVTLSNIRTSQATQTVL 468 5555555677889999999999985567779998666777888888 PP CBM35.hmm 52 lrYang......tgstktlsvvvnGtkvsevtfpst.gnwdtwgta 90 + Y ng ++++++ s++vnG+++++v+fp + nwd ++ 162660|Settu3_GeneCatalog_proteins_20170818.aa.fasta|GH27|CBM35 469 FDYINGqvdymgGTNERVASISVNGGAAKTVSFPLSgYNWDVNVSK 514 9988874433224678999***************99889*997777 PP CBM35.hmm 91 agtvtLk 97 v+L+ 162660|Settu3_GeneCatalog_proteins_20170818.aa.fasta|GH27|CBM35 515 GYAVELS 521 7888885 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 179.58 // Query: WPV17717.1|CBM35|GH27 [L=561] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-08 22.5 0.7 2.4e-07 18.2 0.7 2.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.2 0.7 1.2e-07 2.4e-07 2 112 .. 419 548 .. 418 553 .. 0.71 Alignments for each domain: == domain 1 score: 18.2 bits; conditional E-value: 1.2e-07 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslr.......Yangtgstktl.......svvvnGtkvs 74 eAe+++l g + ++ +g+sGs+ v+ ++++g+++t++ + +++ + ++++ Y ++++++++ s++vnG++ + WPV17717.1|CBM35|GH27 419 EAESGTLVGGANTQPCSGCSGSTKVGFITNTGGSLTLSgI-RTSQATQDVRFDyldcevgYLFDPTGSQSNglnvrgaSISVNGGAGQ 505 8********999999*******************999954.45556666666633444444444444444411111116777777777 PP CBM35.hmm 75 evtfpst.gnwdtwgtaagtvtL....kaGkntitiksdwGwi 112 +v fp t nwd+ + v L + G+nti+i+ +G + WPV17717.1|CBM35|GH27 506 SVLFPLTgYNWDKDVAKNHLVRLsgfsTTGTNTIRISGLSGST 548 *******88****777777788844444899999998766655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (561 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.67 // Query: 13817|Color1_GeneCatalog_proteins_20161026.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-07 18.0 1.1 7.4e-07 16.6 1.1 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.6 1.1 3.7e-07 7.4e-07 8 107 .. 425 538 .. 419 552 .. 0.71 Alignments for each domain: == domain 1 score: 16.6 bits; conditional E-value: 3.7e-07 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglq.aagda.vtfnvdvpkaGsYelsl 52 l+ + ++ +g+++s v+++ ++g++ v n+++ +aG+ ++ + 13817|Color1_GeneCatalog_proteins_20161026.aa.fasta|GH27|CBM35 425 LSSGANLQSCSGCTSSNKVGDIGgSSGGRvVLSNITSSTAGTQTVLF 471 555555567889999999*999844445535556************* PP CBM35.hmm 53 rYang.......tgstktlsvvvnGtkvsevtfpst.gnwdtwgtaa 91 Y ng + +++ s++vnG ++v+fp + nw+ + 13817|Color1_GeneCatalog_proteins_20161026.aa.fasta|GH27|CBM35 472 DYINGdvgylggGNNERLASITVNGVTGQTVSFPLSgYNWSADVFKG 518 *888733222224577889***************9988999865555 PP CBM35.hmm 92 gtvtLk...aGk.ntitiks 107 v+Lk aG+ nti+i+ 13817|Color1_GeneCatalog_proteins_20161026.aa.fasta|GH27|CBM35 519 YRVELKgfqAGSaNTISITG 538 56666433367437777765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 184.64 // Query: XHB18925.1|CBM35|GH27 [L=551] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (551 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 789.37 // Query: 507912|Pyrly1_GeneCatalog_proteins_20170623.aa.fasta|GH27|CBM35 [L=553] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-08 22.2 1.5 4e-08 20.7 1.5 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.7 1.5 2e-08 4e-08 3 112 .. 419 541 .. 417 550 .. 0.77 Alignments for each domain: == domain 1 score: 20.7 bits; conditional E-value: 2e-08 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglq.aagdavtfn.vdvpkaG 46 A ++sl+ + +++ +g+++s+ v++l +++++vt++ + ka 507912|Pyrly1_GeneCatalog_proteins_20170623.aa.fasta|GH27|CBM35 419 ASTGSLSSGANTQSCSGCTSSSKVGYLGgSSNGRVTLSnIRTSKAT 464 6778888877788899999999999998556677998866665555 PP CBM35.hmm 47 sYel......slrYangtgstktlsvvvnGtkvsevtfpst.gnwd 85 + l ++ Y g+ +++ s++vnG+ + +v+fp + nwd 507912|Pyrly1_GeneCatalog_proteins_20170623.aa.fasta|GH27|CBM35 465 QNVLfdfinsEIGYLGGKNNERIASISVNGGTATSVSFPLSgYNWD 510 544433233346699999*********************9989*** PP CBM35.hmm 86 twgtaagtvtL....kaGkntitiksdwGwi 112 ++ v+L + G ntiti+ G++ 507912|Pyrly1_GeneCatalog_proteins_20170623.aa.fasta|GH27|CBM35 511 ASVYKNYAVELsgfsTTGPNTITISGVDGAY 541 *9999******444458*******9866766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (553 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 87.41 // Query: 317211|XylFL0043_GeneCatalog_proteins_20190321.aa.fasta|GH27|CBM35 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-09 23.0 0.8 2e-08 21.7 0.8 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.7 0.8 9.8e-09 2e-08 13 119 .] 431 552 .. 420 552 .. 0.68 Alignments for each domain: == domain 1 score: 21.7 bits; conditional E-value: 9.8e-09 CBM35.hmm 13 vntnhagysGsgfvdglqaagda........vtfnvdvpkaGs 47 ++ +g+ +s+ v++l ++++ ++ + + k + 317211|XylFL0043_GeneCatalog_proteins_20190321.aa.fasta|GH27|CBM35 431 NTQACSGCASSSKVGNLGGSSNGkvvlsnirTSQATQTVKFDY 473 4555566666666766663332222222211111122222233 PP CBM35.hmm 48 YelslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgt 89 + ++ Y ++ +++ s++vnG++++ v+fp + nwd+ + 317211|XylFL0043_GeneCatalog_proteins_20190321.aa.fasta|GH27|CBM35 474 INCEIGYLGSGNNERLASISVNGGAAKPVSFPISgYNWDSDVY 516 3556668878899999****************9989****999 PP CBM35.hmm 90 aagtvtL....kaGkntitiks.dwGwi.nldslel 119 a +v+L + G+nti+i+ +Gw ++d++ + 317211|XylFL0043_GeneCatalog_proteins_20190321.aa.fasta|GH27|CBM35 517 AGYSVELsgfnTGGANTISISGaGTGWApDFDRIAV 552 999****444447*******9999***999999976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 198.31 // Query: USP76659.1|CBM35|GH27 [L=551] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-07 17.9 2.8 5.1e-07 17.2 2.0 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 17.2 2.0 2.5e-07 5.1e-07 5 108 .. 421 538 .. 417 549 .. 0.73 Alignments for each domain: == domain 1 score: 17.2 bits; conditional E-value: 2.5e-07 CBM35.hmm 5 dasltgvsvntnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYang......tgstktlsvvvnGtkvsevtfpst.gnw 84 ++sl + ++ ag+++s v++l ++++++t++ +++ + ++++ Y ng +++++ s++vnG+ ++v+fp + nw USP76659.1|CBM35|GH27 421 TGSLASGANIQTCAGCTSSNKVGNLGgSSNGRLTLSNIRTSKATQTVRFDYINGqvdymgGSNERLASISVNGGPGKTVSFPLSgYNW 508 5555554444567899999999999845566788875556778899999999985433224567889***************9989** PP CBM35.hmm 85 dtwgtaagtvtL....kaGkntitiks..d 108 ++ ++ v+L + G+ntiti+ + USP76659.1|CBM35|GH27 509 SQDVYKNYGVELsgfsTTGTNTITISGagS 538 **999999****555458*******97443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (551 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 76.59 // Query: 22497|FusoxFo47_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-07 19.2 1.7 4.7e-07 17.3 0.1 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.1 0.1 0.049 0.097 33 66 .. 383 416 .. 374 419 .. 0.83 2 ! 17.3 0.1 2.4e-07 4.7e-07 52 118 .. 476 548 .. 422 549 .. 0.79 Alignments for each domain: == domain 1 score: 0.1 bits; conditional E-value: 0.049 CBM35.hmm 33 gdavtfnvdvpkaGsYelslrYangtgstktlsv 66 +da++++ +v+ Gs +l+l+ +g ++tk+ s 22497|FusoxFo47_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 383 NDATSISTQVNGHGSVALRLSNVQGASDTKNYSY 416 7889999999999999999999998888887764 PP == domain 2 score: 17.3 bits; conditional E-value: 2.4e-07 CBM35.hmm 52 lrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtv 94 ++Y +++++ s+ vnG+++++v+fp t +wd+ + tv 22497|FusoxFo47_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 476 VQYIG-GTNERLASIKVNGGAAQSVSFPLTgYDWDKDVYGNYTV 518 45665.6889999*****************889***999999** PP CBM35.hmm 95 tL....kaGkntitiks.dwGwi.nldsle 118 +L + G ntiti+ + w ++d+l 22497|FusoxFo47_GeneCatalog_proteins_20191007.aa.fasta|GH27|CBM35 519 ELsgfnTRGPNTITISGvNGAWApDFDRLA 548 **555458*******995555556777765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.54 // [ok]