# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM35/fasta_for_each_cluster/cluster_186.txt # target HMM database: merged_hmms/CBM35.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM35/CBM35_cluster_186.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: XOU79774.1|CBM35|PL1_5 [L=772] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-27 82.2 3.3 3.5e-27 82.2 3.3 2.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.7 0.24 0.48 25 25 .. 503 503 .. 432 570 .. 0.63 2 ! 82.2 3.3 1.7e-27 3.5e-27 11 119 .] 651 761 .. 640 761 .. 0.94 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.24 CBM35.hmm 25 f 25 XOU79774.1|CBM35|PL1_5 503 T 503 1 PP == domain 2 score: 82.2 bits; conditional E-value: 1.7e-27 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaagtvtL 96 sv++n+agy+G+gfv+ +a+g+a ++ ++p+aG+Y+l++rYan ++s++ +v vn +++++ +f stg+w++w ++++ +++ XOU79774.1|CBM35|PL1_5 651 GSVDSNNAGYTGDGFVNTDNASGNAAVYAFNAPSAGMYTLQVRYAN-GSSARPGDVLVNAGNIGTFDFSSTGSWTSWaNSNELSAYF 736 469*******************************************.6*****************************99******** PP CBM35.hmm 97 kaGkntitiks..dwGwinldslel 119 +aG+nt++i++ + G nlds+++ XOU79774.1|CBM35|PL1_5 737 SAGNNTVRIQAtnSGGLPNLDSVSV 761 ************778888***9876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (772 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.19 // Query: BCE03382.1|CBM13|CBM35|PL1 [L=988] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (988 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 1086.07 // Query: XPR75014.1|CBM35|PL1_5|PL9_1 [L=1024] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-31 96.0 3.5 8.7e-31 93.8 3.5 2.3 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.8 3.5 4.3e-31 8.7e-31 2 118 .. 535 654 .. 534 655 .. 0.94 Alignments for each domain: == domain 1 score: 93.8 bits; conditional E-value: 4.3e-31 CBM35.hmm 2 eAedasltg.vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst 81 eAe+ t +++tnh+gysGsgf + +a+g+a+++nv +aG +l +r+ang+++++t ++vvnGt+v+ v+f+ t XPR75014.1|CBM35|PL1_5|PL9_1 535 EAESSAATCgGTIDTNHSGYSGSGFCNTTNASGAALQVNVSNGAAGATTLAVRFANGGTTARTADLVVNGTRVQAVSFEPT 615 788765554499********************************************************************* PP CBM35.hmm 82 gnwdtwgtaagtvtLkaGkntitiks..dwGwinldsle 118 g+w+tw+t+ +tL aG+nti++ + + G n+d++e XPR75014.1|CBM35|PL1_5|PL9_1 616 GAWNTWTTKSLPATLVAGANTIRLVAtnSGGLANIDYIE 654 **************************9888888****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1024 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 296.44 // Query: XOU76750.1|CBM35|PL1_11 [L=748] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-27 81.0 1.3 2.5e-26 79.4 1.3 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.4 1.3 1.3e-26 2.5e-26 9 119 .] 101 211 .. 96 211 .. 0.96 Alignments for each domain: == domain 1 score: 79.4 bits; conditional E-value: 1.3e-26 CBM35.hmm 9 tgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtv 94 t + v+ +h gy+Gsgf + ++ g+ +t++v v ++G Y++++rYa+ +st+ s++ n+ + ++tf+s+g w++w + ++t+ XOU76750.1|CBM35|PL1_11 101 TDLVVEDEHLGYTGSGFTNTDNDLGADITWQVSVAEQGFYDVTFRYAA--SSTRAGSLTANDIGAADYTFTSSGGWTSWLEETQTI 184 557899*****************************************9..6*********************************** PP CBM35.hmm 95 tLkaGkntitiks..dwGwinldslel 119 +L+ G+nt+ +++ d+G n+d++el XOU76750.1|CBM35|PL1_11 185 ELQTGTNTLVLTAtgDSGLPNIDYIEL 211 *************************97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (748 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 274.05 // Query: WGO97621.1|CBM35|PL1_11|PL1_5 [L=1318] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-25 76.2 2.7 2.5e-25 76.2 2.7 4.8 5 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.2 0.08 0.16 28 82 .. 444 497 .. 430 515 .. 0.75 2 ? -1.2 0.3 0.12 0.25 56 80 .. 552 577 .. 504 590 .. 0.66 3 ? -1.5 0.9 0.15 0.31 18 63 .. 601 645 .. 591 662 .. 0.67 4 ! 76.2 2.7 1.3e-25 2.5e-25 12 119 .] 663 772 .. 653 772 .. 0.95 5 ? -0.9 0.0 0.098 0.2 53 103 .. 1262 1309 .. 1245 1313 .. 0.84 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.08 CBM35.hmm 28 glqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstg 82 ++++g+++ ++ +++a Ye +++ + +++ t v G++v+++tf++ + WGO97621.1|CBM35|PL1_11|PL1_5 444 SIKWSGSQTVNAIVIKEAAGYEGNISGWQ-VTDNDTGAVLAAGSSVGTITFDAVT 497 56777888888888888888888888666.5888999999999999999998764 PP == domain 2 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 56 ngtgstktlsvvvnGtkvs.evtfps 80 ++tg+t+tls +v G++v + ++++ WGO97621.1|CBM35|PL1_11|PL1_5 552 SSTGGTATLSTTVSGDQVTlNWSVNN 577 33555555555555555544333333 PP == domain 3 score: -1.5 bits; conditional E-value: 0.15 CBM35.hmm 18 agysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstkt 63 +g +G+++ d a+++ + v+v+++ s +++ +Y++++ + t WGO97621.1|CBM35|PL1_11|PL1_5 601 SGVTGNTYTDTG-LANGTYYYWVKVTDSNSATINSNYSEAQVNVYT 645 566777777654.344444455888888888888888876554444 PP == domain 4 score: 76.2 bits; conditional E-value: 1.3e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gta 90 sv++n++g+ Gsgf + +a+g+ v ++v vp aG Y+l++r+an ++s++ +v vn ++++ ++pstg+w++w +++ WGO97621.1|CBM35|PL1_11|PL1_5 663 SVDSNNSGFAGSGFANTDNASGNGVNYAVSVPVAGVYTLQVRFAN-GSSARPADVLVNYGNAGVFDLPSTGSWTSWsNSN 741 699******************************************.6*****************************99** PP CBM35.hmm 91 agtvtLkaGkntitiks..dwGwinldslel 119 +++v+L aG+n +++++ + G n+dsl++ WGO97621.1|CBM35|PL1_11|PL1_5 742 EISVNLVAGNNIVRLEAttSGGLANIDSLSV 772 ******************999999****986 PP == domain 5 score: -0.9 bits; conditional E-value: 0.098 CBM35.hmm 53 rYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGknti 103 Y++++++t + + +v G++ ++ f + g+ ++ a t +aG+n++ WGO97621.1|CBM35|PL1_11|PL1_5 1262 DYSSASKNTISANRFVAGDDLTDYVFATAGKGGK---APYVSTFTAGQNSL 1309 589999999999999*************999888...88888888999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1318 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.97 // Query: UUA71552.1|CBM35|PL1_5 [L=702] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-31 96.3 6.0 1.5e-31 96.3 6.0 2.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.0 1.4 0.025 0.051 15 89 .. 40 113 .. 25 143 .. 0.67 2 ! 96.3 6.0 7.6e-32 1.5e-31 1 119 [] 188 309 .. 188 309 .. 0.98 Alignments for each domain: == domain 1 score: 1.0 bits; conditional E-value: 0.025 CBM35.hmm 15 tnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgt 89 +ag +Gsgf d +++v + ++ + + ++s+++ + + +t+ + G+kv + ++ +++ + w+t UUA71552.1|CBM35|PL1_5 40 GPSAGADGSGFNDTKLVRDGNVGTATQASGTSNQRVSVKWGS-AVTFNTVILREAGSKVTSWSLVDNDTGTVWAT 113 556677777777777777777777777777777777777777.35555555555566666666666655555544 PP == domain 2 score: 96.3 bits; conditional E-value: 7.6e-32 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 y+Ae++sl++++v++nh+g++Gsgfv+ + g++ +++v+ +aG+ ++++rYangt+s++ +s++vnGt ++ ++ f+ tg+w t UUA71552.1|CBM35|PL1_5 188 YQAESGSLSQAAVESNHSGFTGSGFVNFDNLVGSSAQWTVNQASAGTATITFRYANGTTSNRAMSISVNGTVINsSLAFNGTGAWAT 274 9*************************99999****************************************99879*********** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldslel 119 w+++ +t +L+aG+n i+ s + G nld+l++ UUA71552.1|CBM35|PL1_5 275 WAEQSMTTQLNAGSNVIRAVSttSDGGPNLDQLSV 309 *********************9**********986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (702 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 189.37 // Query: XOU83864.1|CBM35|PL1_11|PL1_5 [L=1318] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-25 76.2 2.7 2.5e-25 76.2 2.7 4.8 5 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.2 0.08 0.16 28 82 .. 444 497 .. 430 515 .. 0.75 2 ? -1.2 0.3 0.12 0.25 56 80 .. 552 577 .. 504 590 .. 0.66 3 ? -1.5 0.9 0.15 0.31 18 63 .. 601 645 .. 591 662 .. 0.67 4 ! 76.2 2.7 1.3e-25 2.5e-25 12 119 .] 663 772 .. 653 772 .. 0.95 5 ? -0.9 0.0 0.098 0.2 53 103 .. 1262 1309 .. 1245 1313 .. 0.84 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.08 CBM35.hmm 28 glqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstg 82 ++++g+++ ++ +++a Ye +++ + +++ t v G++v+++tf++ + XOU83864.1|CBM35|PL1_11|PL1_5 444 SIKWSGSQTVNAIVIKEAAGYEGNISGWQ-VTDNDTGAVLAAGSSVGTITFDAVT 497 56777888888888888888888888666.5888999999999999999998764 PP == domain 2 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 56 ngtgstktlsvvvnGtkvs.evtfps 80 ++tg+t+tls +v G++v + ++++ XOU83864.1|CBM35|PL1_11|PL1_5 552 SSTGGTATLSTTVSGDQVTlNWSVNN 577 33555555555555555544333333 PP == domain 3 score: -1.5 bits; conditional E-value: 0.15 CBM35.hmm 18 agysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstkt 63 +g +G+++ d a+++ + v+v+++ s +++ +Y++++ + t XOU83864.1|CBM35|PL1_11|PL1_5 601 SGVTGNTYTDTG-LANGTYYYWVKVTDSNSATINSNYSEAQVNVYT 645 566777777654.344444455888888888888888876554444 PP == domain 4 score: 76.2 bits; conditional E-value: 1.3e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gta 90 sv++n++g+ Gsgf + +a+g+ v ++v vp aG Y+l++r+an ++s++ +v vn ++++ ++pstg+w++w +++ XOU83864.1|CBM35|PL1_11|PL1_5 663 SVDSNNSGFAGSGFANTDNASGNGVNYAVSVPVAGVYTLQVRFAN-GSSARPADVLVNYGNAGVFDLPSTGSWTSWsNSN 741 699******************************************.6*****************************99** PP CBM35.hmm 91 agtvtLkaGkntitiks..dwGwinldslel 119 +++v+L aG+n +++++ + G n+dsl++ XOU83864.1|CBM35|PL1_11|PL1_5 742 EISVNLVAGNNIVRLEAttSGGLANIDSLSV 772 ******************999999****986 PP == domain 5 score: -0.9 bits; conditional E-value: 0.098 CBM35.hmm 53 rYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGknti 103 Y++++++t + + +v G++ ++ f + g+ ++ a t +aG+n++ XOU83864.1|CBM35|PL1_11|PL1_5 1262 DYSSASKNTISANRFVAGDDLTDYVFATAGKGGK---APYVSTFTAGQNSL 1309 589999999999999*************999888...88888888999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1318 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.74 // Query: XHN48988.1|CBM35|PL9_1 [L=476] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-09 24.1 2.5 1.5e-08 22.0 0.1 2.7 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 22.0 0.1 7.7e-09 1.5e-08 1 64 [. 32 96 .. 32 104 .. 0.86 2 ? 0.7 0.5 0.032 0.065 53 114 .. 333 390 .. 285 394 .. 0.72 Alignments for each domain: == domain 1 score: 22.0 bits; conditional E-value: 7.7e-09 CBM35.hmm 1 yeAedasltg.vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktl 64 yeAe+a + +++ +gysGsgf + +++g+ +f+ ++ +aG+ ++ r+a g+++t++ XHN48988.1|CBM35|PL9_1 32 YEAESAPAVCtGTSDSDRTGYSGSGFCSAPDTSGAHARFTANAASAGTAPVNRRFADGSAATRSA 96 9999997655467899****************************************976555544 PP == domain 2 score: 0.7 bits; conditional E-value: 0.032 CBM35.hmm 53 rYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtLkaGkntitiksdwGwinl 114 +Y n g+ + +v nG++++ +++ + ++++ ++ k+G++ +t++s+ G + + XHN48988.1|CBM35|PL9_1 333 SYDN--GTLSDGTVNTNGDRNG-YKLGGDdIPVN--HVVQHSIAYKNGHHGFTYNSNPGTMTI 390 3343..4555556666776666.33333312222..478888999999999999999998865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (476 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 168.75 // Query: XOU81762.1|CBM35|PL10_1 [L=572] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-27 80.9 4.2 2.6e-26 79.4 4.2 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.4 4.2 1.3e-26 2.6e-26 11 119 .] 94 201 .. 83 201 .. 0.90 Alignments for each domain: == domain 1 score: 79.4 bits; conditional E-value: 1.3e-26 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtL 96 ++ +nh gysG+gfvd +a+g+++t++vdv ++G+Y++s+r+an +++++ +++ n + + ++ f +tg+w tw++ + tv+L XOU81762.1|CBM35|PL10_1 94 GEIVNNHEGYSGTGFVDTANAEGASITWKVDV-DGGNYDVSVRFAN-GSTARGATLSSN-EINTTYGFATTGDWATWADETHTVSL 176 567899*************************9.67***********.699999999999.66689********************* PP CBM35.hmm 97 kaGkntitiks..dwGwinldslel 119 aG+nti++++ G n+d++++ XOU81762.1|CBM35|PL10_1 177 AAGENTIQLSAltAGGLPNVDAITI 201 ************888999****986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (572 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 253.69 // Query: UOD78362.1|CBM35|GH39 [L=847] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-10 29.0 2.1 1.1e-10 29.0 2.1 4.1 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.9 0.1 0.1 0.2 23 61 .. 418 457 .. 399 464 .. 0.68 2 ! 29.0 2.1 5.4e-11 1.1e-10 2 84 .. 474 556 .. 473 569 .. 0.79 3 ! 3.8 0.1 0.0035 0.007 88 115 .. 601 628 .. 567 632 .. 0.59 4 ? -2.2 1.1 0.26 0.51 46 81 .. 767 800 .. 755 838 .. 0.61 Alignments for each domain: == domain 1 score: -0.9 bits; conditional E-value: 0.1 CBM35.hmm 23 sgfvdglqaagdavtfnvd.vpkaGsYelslrYangtgst 61 + f ++l+ ++++vt+ v+ ++ a Y+l ++ a++t++t UOD78362.1|CBM35|GH39 418 QLFTGNLKVNNGSVTVPVKdMKLASGYRLVIKKATSTTGT 457 4566777778889999875256678888888877764444 PP == domain 2 score: 29.0 bits; conditional E-value: 5.4e-11 CBM35.hmm 2 eAedas.ltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYang..tgstktlsvvvnGtkvsevtfpstgnw 84 eAeda +tg+ + y + g + +++++++tf+v++p++G+Y+++l Y ng +g+++t +v++n+++ ++v++p tgn UOD78362.1|CBM35|GH39 474 EAEDADsITGA--HMVYGSYASGGEFERSDGTNAKLTFKVNAPQDGQYAFNLGYGNGniSGQDATEKVSINNQS-ETVNLPFTGNG 556 67777513444..33456677888888999***************************999***********877.56777777654 PP == domain 3 score: 3.8 bits; conditional E-value: 0.0035 CBM35.hmm 88 gtaagtvtLkaGkntitiksdwGwinld 115 ++ a v+Lk+ +ntit+++ + ++d UOD78362.1|CBM35|GH39 601 KKIASAVPLKKDENTITLEQGQNSAEID 628 4445555555555555555544444444 PP == domain 4 score: -2.2 bits; conditional E-value: 0.26 CBM35.hmm 46 GsYelslrYangtgstktlsvvvnGtkvsevtfpst 81 +Y ++ Y++ +k++ v+n + v+ ++ ++ UOD78362.1|CBM35|GH39 767 RKYIVNAYYKST--PKKKQITVINPKGVNAYKNKNL 800 567777777762..2333333345555554444443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (847 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 103.31 // Query: WGO97510.1|CBM2|CBM35|PL10_1 [L=700] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-30 90.8 3.2 7.8e-30 90.8 3.2 2.7 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 1.6 0.11 0.22 46 78 .. 82 116 .. 46 143 .. 0.59 2 ? -0.7 1.0 0.088 0.18 11 65 .. 104 157 .. 90 184 .. 0.66 3 ! 90.8 3.2 3.9e-30 7.8e-30 12 119 .] 221 330 .. 213 330 .. 0.96 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.11 CBM35.hmm 46 GsYelslrYang..tgstktlsvvvnGtkvsevtf 78 + +l l+Y ++ +++ + sv+ nG+ v+ +++ WGO97510.1|CBM2|CBM35|PL10_1 82 SNWALALNYDQAaaITNSWNASVSANGNVVNATNI 116 34555566655533555666677777777765544 PP == domain 2 score: -0.7 bits; conditional E-value: 0.088 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktls 65 vs+n n + + g+ ++l aag++++f + + +G+ +l ++ +g++s+++ s WGO97510.1|CBM2|CBM35|PL10_1 104 VSANGNVVNATNIGWNGNL-AAGQSTSFGLQGTYTGNFSLPVCVGQGQSSSSSSS 157 4445555555555655555.77888888888888888888888888755555544 PP == domain 3 score: 90.8 bits; conditional E-value: 3.9e-30 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaag 92 s+++n++g++Gsgf + +a+g++v ++v vp +G+Y l++rYang+g+++ + vnG+++++ +fp+tg+w++w+ta WGO97510.1|CBM2|CBM35|PL10_1 221 SIDSNNSGFTGSGFANTDNATGKSVDWSVSVPYSGNYLLEWRYANGSGNNRAGAIEVNGNARGNQSFPTTGAWTSWTTASA 301 6899***************************************************************************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 +v+L+aG+n i++ + +G n+dsl++ WGO97510.1|CBM2|CBM35|PL10_1 302 NVSLDAGTNLISLVAstGEGLGNIDSLTV 330 ***************8888888****997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (700 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 116.19 // Query: WGP00202.1|CBM2|CBM35|PL3_1 [L=511] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-30 93.2 2.2 1.4e-30 93.2 2.2 2.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.3 0.07 0.14 36 47 .. 38 49 .. 18 85 .. 0.61 2 ! 93.2 2.2 6.8e-31 1.4e-30 12 119 .] 170 277 .. 160 277 .. 0.97 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.07 CBM35.hmm 36 vtfnvdvpkaGs 47 t+nv+v+++Gs WGP00202.1|CBM2|CBM35|PL3_1 38 YTVNVNVTNTGS 49 222333333332 PP == domain 2 score: 93.2 bits; conditional E-value: 6.8e-31 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagt 93 s+++n++gy+Gsgf + +++g+av+++ +vp++G+Y l rYa+ ++t++ svvvnG++v++ +fpstg+w++w++ + WGP00202.1|CBM2|CBM35|PL3_1 170 SIDNNNSGYTGSGFANTENQNGSAVEYALNVPSNGNYLLDARYAS--ATTRSASVVVNGSSVGSFSFPSTGSWTSWTVDSAN 249 689*****************************************9..6********************************** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 v+Lk G+n ++i + ++G n+dsl++ WGP00202.1|CBM2|CBM35|PL3_1 250 VPLKGGNNIVRIVAtnSSGLPNIDSLKV 277 *************999**********97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (511 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 205.30 // Query: XOU82356.1|CBM2|CBM35|PL3_1 [L=511] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-30 93.2 2.2 1.4e-30 93.2 2.2 2.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.3 0.07 0.14 36 47 .. 38 49 .. 18 85 .. 0.61 2 ! 93.2 2.2 6.8e-31 1.4e-30 12 119 .] 170 277 .. 160 277 .. 0.97 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.07 CBM35.hmm 36 vtfnvdvpkaGs 47 t+nv+v+++Gs XOU82356.1|CBM2|CBM35|PL3_1 38 YTVNVNVTNTGS 49 222333333332 PP == domain 2 score: 93.2 bits; conditional E-value: 6.8e-31 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagt 93 s+++n++gy+Gsgf + +++g+av+++ +vp++G+Y l rYa+ ++t++ svvvnG++v++ +fpstg+w++w++ + XOU82356.1|CBM2|CBM35|PL3_1 170 SIDNNNSGYTGSGFANTENQNGSAVEYALNVPSNGNYLLDARYAS--ATTRSASVVVNGSSVGSFSFPSTGSWTSWTVDSAN 249 689*****************************************9..6********************************** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 v+Lk G+n ++i + ++G n+dsl++ XOU82356.1|CBM2|CBM35|PL3_1 250 VPLKGGNNIVRIVAtnSSGLPNIDSLKV 277 *************999**********97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (511 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 233.55 // Query: BGA03471.1|CBM35|PL1_5|PL9 [L=897] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-30 92.5 3.9 7.6e-30 90.8 3.9 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.8 3.9 3.8e-30 7.6e-30 2 118 .. 520 639 .. 519 640 .. 0.94 Alignments for each domain: == domain 1 score: 90.8 bits; conditional E-value: 3.8e-30 CBM35.hmm 2 eAedasltg.vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgn 83 eAe+ t +++tnh+gysG+gf + +a+g+a+++nv +aG +l +r+ang+++++t ++vvnGt+v+ v+f+ tg+ BGA03471.1|CBM35|PL1_5|PL9 520 EAESSAATCgGTIDTNHSGYSGTGFCNTTNASGAALQVNVGNGAAGATTLAVRFANGGTTARTADLVVNGTRVQAVSFEPTGA 602 788765554499*********************************************************************** PP CBM35.hmm 84 wdtwgtaagtvtLkaGkntitiks..dwGwinldsle 118 w+tw+t+ +tL aG+nti++ + + G n+d++e BGA03471.1|CBM35|PL1_5|PL9 603 WNTWSTKSLPATLVAGANTIRLVAtnSGGLANIDYVE 639 ************************9888888***985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (897 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 360.13 // Query: XAW85805.1|CBM35|PL1_11|PL1_5 [L=1220] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-30 92.1 1.6 9.5e-30 90.5 1.6 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.5 1.6 4.8e-30 9.5e-30 13 119 .] 571 679 .. 562 679 .. 0.95 Alignments for each domain: == domain 1 score: 90.5 bits; conditional E-value: 4.8e-30 CBM35.hmm 13 vntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaa 91 ++++hagy+Gsg+ + +a+g av+++vdvp+aG Y+l++rYa+ +gs++ sv++nG+++ +vt++ tg+w+++ +++ XAW85805.1|CBM35|PL1_11|PL1_5 571 IESEHAGYTGSGYANTDNASGTAVEWSVDVPAAGLYTLQWRYAS-SGSDRAASVIINGSSAASVTMTDTGAWTSYaDSSQ 649 799*****************************************.8****************************977888 PP CBM35.hmm 92 gtvtLkaGkntitiks..dwGwinldslel 119 + v+L aG+n+i++++ ++G n+d+l++ XAW85805.1|CBM35|PL1_11|PL1_5 650 VVVSLAAGYNSIRLEAtgSNGLANIDRLQV 679 999************************987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1220 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 409.71 // Query: WYH55521.1|CBM2|CBM35|CE12 [L=680] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-47 145.6 14.0 6.5e-26 78.1 3.3 3.2 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.2 0.13 0.26 36 57 .. 38 59 .. 9 84 .. 0.60 2 ! 73.9 0.2 6.7e-25 1.3e-24 12 119 .] 152 261 .. 143 261 .. 0.94 3 ! 78.1 3.3 3.3e-26 6.5e-26 12 119 .] 314 425 .. 304 425 .. 0.95 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.13 CBM35.hmm 36 vtfnvdvpkaGsYelslrYang 57 ++v+ +++Gs +++ + + WYH55521.1|CBM2|CBM35|CE12 38 NDWQVKWQQNGSSTVTSLWNAT 59 2456777777777766666653 PP == domain 2 score: 73.9 bits; conditional E-value: 6.7e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaagt 93 s+++n++g+sG gf + +a g+ ++++v + +G+Y+l++rYang+ +++ ++++nG ++ ++fp+t++w+ w + + WYH55521.1|CBM2|CBM35|CE12 152 SIDNNNPGFSGAGFANTDNAVGSGIEWAVAA-VGGNYDLQWRYANGSNANRPGKIIINGVNQAGLDFPATSEWTIWnDSMLVP 233 689**************************97.89******************************************5556689 PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 v+L+ G n +++++ +G n+d+l++ WYH55521.1|CBM2|CBM35|CE12 234 VSLESGINIVRLEAieTTGLANIDALSV 261 ************************9986 PP == domain 3 score: 78.1 bits; conditional E-value: 3.3e-26 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs..evtfpstgnwdtwgtaag 92 ++++n+ g++G+gf + ++ g+av+++v+v +aG+Y+l lrYang+gs++ + vn+++++ +++++ tg+ +tw+ + WYH55521.1|CBM2|CBM35|CE12 314 AIDNNNDGFTGDGFANTGNNLGSAVSWSVQVGTAGTYQLALRYANGGGSARPGVLAVNDSSSGtyDINLTDTGSSNTWAIETL 396 589************************************************************777888999*********** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 v L++G+nt+++++ ++G n+d+l++ WYH55521.1|CBM2|CBM35|CE12 397 PVFLNEGTNTLKLTAtsESGLANIDYLQV 425 ***************999*********87 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (680 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 170.70 // Query: XOU75681.1|CBM35|PL1_5 [L=772] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-27 82.2 3.3 3.5e-27 82.2 3.3 2.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.7 0.24 0.48 25 25 .. 503 503 .. 432 570 .. 0.63 2 ! 82.2 3.3 1.7e-27 3.5e-27 11 119 .] 651 761 .. 640 761 .. 0.94 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.24 CBM35.hmm 25 f 25 XOU75681.1|CBM35|PL1_5 503 T 503 1 PP == domain 2 score: 82.2 bits; conditional E-value: 1.7e-27 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaagtvtL 96 sv++n+agy+G+gfv+ +a+g+a ++ ++p+aG+Y+l++rYan ++s++ +v vn +++++ +f stg+w++w ++++ +++ XOU75681.1|CBM35|PL1_5 651 GSVDSNNAGYTGDGFVNTDNASGNAAVYAFNAPSAGMYTLQVRYAN-GSSARPGDVLVNAGNIGTFDFSSTGSWTSWaNSNELSAYF 736 469*******************************************.6*****************************99******** PP CBM35.hmm 97 kaGkntitiks..dwGwinldslel 119 +aG+nt++i++ + G nlds+++ XOU75681.1|CBM35|PL1_5 737 SAGNNTVRIQAtnSGGLPNLDSVSV 761 ************778888***9876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (772 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 120.06 // Query: XOU80841.1|CBM35|PL1_11 [L=748] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-27 81.0 1.3 2.5e-26 79.4 1.3 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.4 1.3 1.3e-26 2.5e-26 9 119 .] 101 211 .. 96 211 .. 0.96 Alignments for each domain: == domain 1 score: 79.4 bits; conditional E-value: 1.3e-26 CBM35.hmm 9 tgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtv 94 t + v+ +h gy+Gsgf + ++ g+ +t++v v ++G Y++++rYa+ +st+ s++ n+ + ++tf+s+g w++w + ++t+ XOU80841.1|CBM35|PL1_11 101 TDLVVEDEHLGYTGSGFTNTDNDLGADITWQVSVAEQGFYDVTFRYAA--SSTRAGSLTANDIGAADYTFTSSGGWTSWLEETQTI 184 557899*****************************************9..6*********************************** PP CBM35.hmm 95 tLkaGkntitiks..dwGwinldslel 119 +L+ G+nt+ +++ d+G n+d++el XOU80841.1|CBM35|PL1_11 185 ELQTGTNTLVLTAtgDSGLPNIDYIEL 211 *************************97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (748 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 326.43 // Query: WYH47468.1|CBM35|CBM5|PL1_11|PL1_5 [L=1255] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-24 73.8 4.9 6.4e-24 71.7 4.9 2.2 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.7 4.9 3.2e-24 6.4e-24 12 119 .] 645 753 .. 638 753 .. 0.96 Alignments for each domain: == domain 1 score: 71.7 bits; conditional E-value: 3.2e-24 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 +v++n+ g++Gsgf + +a+g + ++++ ++GsY+l++rYang+ +++ ++vnG +vs+ +f stg+w++ WYH47468.1|CBM35|CBM5|PL1_11|PL1_5 645 TVDSNNGGFTGSGFANTDNANGTGIDWTIT-GDTGSYTLRWRYANGSDVNRSALLSVNGVAVSTEDFVSTGSWTS 718 699***************************.588***************************************** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldslel 119 w+t+ ++++L aG++ i++++ ++G n+d++e+ WYH47468.1|CBM35|CBM5|PL1_11|PL1_5 719 WATTSVQLNLGAGYKDIRLQAnqSSGLANIDYVEI 753 *********************99*********986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1255 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 408.57 // Query: XOU79773.1|CBM35|PL1_11|PL1_5 [L=1318] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-25 76.2 2.7 2.5e-25 76.2 2.7 4.8 5 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.2 0.08 0.16 28 82 .. 444 497 .. 430 515 .. 0.75 2 ? -1.2 0.3 0.12 0.25 56 80 .. 552 577 .. 504 590 .. 0.66 3 ? -1.5 0.9 0.15 0.31 18 63 .. 601 645 .. 591 662 .. 0.67 4 ! 76.2 2.7 1.3e-25 2.5e-25 12 119 .] 663 772 .. 653 772 .. 0.95 5 ? -0.9 0.0 0.098 0.2 53 103 .. 1262 1309 .. 1245 1313 .. 0.84 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.08 CBM35.hmm 28 glqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstg 82 ++++g+++ ++ +++a Ye +++ + +++ t v G++v+++tf++ + XOU79773.1|CBM35|PL1_11|PL1_5 444 SIKWSGSQTVNAIVIKEAAGYEGNISGWQ-VTDNDTGAVLAAGSSVGTITFDAVT 497 56777888888888888888888888666.5888999999999999999998764 PP == domain 2 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 56 ngtgstktlsvvvnGtkvs.evtfps 80 ++tg+t+tls +v G++v + ++++ XOU79773.1|CBM35|PL1_11|PL1_5 552 SSTGGTATLSTTVSGDQVTlNWSVNN 577 33555555555555555544333333 PP == domain 3 score: -1.5 bits; conditional E-value: 0.15 CBM35.hmm 18 agysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstkt 63 +g +G+++ d a+++ + v+v+++ s +++ +Y++++ + t XOU79773.1|CBM35|PL1_11|PL1_5 601 SGVTGNTYTDTG-LANGTYYYWVKVTDSNSATINSNYSEAQVNVYT 645 566777777654.344444455888888888888888876554444 PP == domain 4 score: 76.2 bits; conditional E-value: 1.3e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gta 90 sv++n++g+ Gsgf + +a+g+ v ++v vp aG Y+l++r+an ++s++ +v vn ++++ ++pstg+w++w +++ XOU79773.1|CBM35|PL1_11|PL1_5 663 SVDSNNSGFAGSGFANTDNASGNGVNYAVSVPVAGVYTLQVRFAN-GSSARPADVLVNYGNAGVFDLPSTGSWTSWsNSN 741 699******************************************.6*****************************99** PP CBM35.hmm 91 agtvtLkaGkntitiks..dwGwinldslel 119 +++v+L aG+n +++++ + G n+dsl++ XOU79773.1|CBM35|PL1_11|PL1_5 742 EISVNLVAGNNIVRLEAttSGGLANIDSLSV 772 ******************999999****986 PP == domain 5 score: -0.9 bits; conditional E-value: 0.098 CBM35.hmm 53 rYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGknti 103 Y++++++t + + +v G++ ++ f + g+ ++ a t +aG+n++ XOU79773.1|CBM35|PL1_11|PL1_5 1262 DYSSASKNTISANRFVAGDDLTDYVFATAGKGGK---APYVSTFTAGQNSL 1309 589999999999999*************999888...88888888999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1318 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.92 // Query: BFM21297.1|CBM35|CE8|PL10_1 [L=1013] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-24 72.2 2.9 9.4e-24 71.1 0.1 3.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.9 0.2 0.2 0.4 58 80 .. 154 177 .. 141 214 .. 0.51 2 ! 71.1 0.1 4.7e-24 9.4e-24 12 118 .. 262 368 .. 252 369 .. 0.96 Alignments for each domain: == domain 1 score: -1.9 bits; conditional E-value: 0.2 CBM35.hmm 58 tgstktlsvvvnGtkvs.evtfps 80 ++++ +l +vnG++v + ++ + BFM21297.1|CBM35|CE8|PL10_1 154 DTASVNLAASVNGDDVTlNWDVSN 177 344445555677777665333333 PP == domain 2 score: 71.1 bits; conditional E-value: 4.7e-24 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagt 93 s+++nh+g+ Gsgf + +++g+ +t++++++ a + l +rYa+ +s++ ++ vnGt v+++ +p+tg+wd+w++ t BFM21297.1|CBM35|CE8|PL10_1 262 SIDSNHSGFGGSGFANSDNKSGAGITYSINADYAHNALLDIRYAA--TSNRPADIEVNGTVVGTAYLPATGAWDSWNSESLT 341 689*****************************************9..7********************************** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldsle 118 v+L+aG+n i++ + +G n+ds++ BFM21297.1|CBM35|CE8|PL10_1 342 VPLEAGENRIRLIAqtANGLPNIDSMT 368 ************999999******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1013 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 165.55 // Query: WYH46475.1|CBM2|CBM35|PL10_1 [L=631] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-30 92.6 4.7 2.1e-30 92.6 4.7 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.6 4.7 1.1e-30 2.1e-30 12 119 .] 187 296 .. 181 296 .. 0.98 2 ? -1.8 0.1 0.18 0.37 29 57 .. 388 416 .. 364 443 .. 0.72 Alignments for each domain: == domain 1 score: 92.6 bits; conditional E-value: 1.1e-30 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaag 92 s+++n++gy+G gf + +a+g a++++v +p + sY+l +rYang+++ +t s+ vnG++ ++v+f++tg+w++w++a + WYH46475.1|CBM2|CBM35|PL10_1 187 SIDNNNTGYTGAGFANTTNANGMAIRWSVASPYGSSYQLDWRYANGSSNPRTASIRVNGNSTGSVDFDTTGAWTSWTSAGV 267 689****************************************************************************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 v L++G+nti++ s ++G n+d+l++ WYH46475.1|CBM2|CBM35|PL10_1 268 VVGLEQGQNTIELVSttNEGLANIDALTV 296 **************************997 PP == domain 2 score: -1.8 bits; conditional E-value: 0.18 CBM35.hmm 29 lqaagdavtfnvdvpkaGsYelslrYang 57 + +++++++++ v ka +Y l+ +Y++g WYH46475.1|CBM2|CBM35|PL10_1 388 VYQNTGQTKYRDAVRKAMDYLLEAQYSSG 416 44566667777777888888888888875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (631 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 261.97 // Query: BCE03175.1|CBM35|PL1_5|PL1 [L=1161] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-16 46.1 2.8 5.3e-16 46.1 2.8 2.6 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.1 2.8 2.6e-16 5.3e-16 9 119 .] 145 255 .. 138 255 .. 0.90 2 ? -4.1 0.3 0.95 1.9 83 102 .. 295 312 .. 273 321 .. 0.56 Alignments for each domain: == domain 1 score: 46.1 bits; conditional E-value: 2.6e-16 CBM35.hmm 9 tgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaG.sYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgta 90 ++v+++t+hagy+G+g + +++g+ + ++ ++++++ + +++++Yang ++ ++ ++ G ++v+f +t++w++w+t BCE03175.1|CBM35|PL1_5|PL1 145 DNVQIETEHAGYEGTGALNATNETGSGIGWTFNANQSDsNATMQITYANG--GDVSRPASISGVM-GSVDFAQTTQWNNWTTI 224 56899****************************977651578*******6..7777888888765.88*************** PP CBM35.hmm 91 agtvtLkaGkntitiks..dwGwinldslel 119 + v+ aG n +++ + +G n+d +e+ BCE03175.1|CBM35|PL1_5|PL1 225 SVPVSVYAGMNDFEMVAlqATGLANIDFIEI 255 ***************************9986 PP == domain 2 score: -4.1 bits; conditional E-value: 0.95 CBM35.hmm 83 nwdtwgtaagtvtLkaGknt 102 + + ++++++v L G+n+ BCE03175.1|CBM35|PL1_5|PL1 295 SGN--TETQTDVDLVVGSNK 312 222..255666777777776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1161 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 359.95 // Query: UFN57338.1|CBM35|PL1_11|PL1_5 [L=1238] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-25 76.3 1.8 8e-25 74.6 1.8 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 74.6 1.8 4e-25 8e-25 12 118 .. 585 693 .. 576 694 .. 0.95 Alignments for each domain: == domain 1 score: 74.6 bits; conditional E-value: 4e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gta 90 +++t+h+gy+G g+ + +++g v ++v vp+aG+Y+l++++an +++++ v +nG+ + ++ ++ +g+w+++ +a UFN57338.1|CBM35|PL1_11|PL1_5 585 AIETEHSGYTGFGYANTENDNGMGVDWSVVVPTAGTYTLQWTFAN-GSGDRPAAVLINGSGQASIAMDDSGAWGNYvDSA 663 4899*****************************************.6**************************9988999 PP CBM35.hmm 91 agtvtLkaGkntitiks..dwGwinldsle 118 +tv+L+aG+n i++++ ++G n+d++ UFN57338.1|CBM35|PL1_11|PL1_5 664 SVTVNLDAGYNEIRLQAtgSSGLANIDNMA 693 ***************************986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1238 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 414.30 // Query: XOU89022.1|CBM35|PL1_11 [L=748] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-27 81.0 1.3 2.5e-26 79.4 1.3 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.4 1.3 1.3e-26 2.5e-26 9 119 .] 101 211 .. 96 211 .. 0.96 Alignments for each domain: == domain 1 score: 79.4 bits; conditional E-value: 1.3e-26 CBM35.hmm 9 tgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtv 94 t + v+ +h gy+Gsgf + ++ g+ +t++v v ++G Y++++rYa+ +st+ s++ n+ + ++tf+s+g w++w + ++t+ XOU89022.1|CBM35|PL1_11 101 TDLVVEDEHLGYTGSGFTNTDNDLGADITWQVSVAEQGFYDVTFRYAA--SSTRAGSLTANDIGAADYTFTSSGGWTSWLEETQTI 184 557899*****************************************9..6*********************************** PP CBM35.hmm 95 tLkaGkntitiks..dwGwinldslel 119 +L+ G+nt+ +++ d+G n+d++el XOU89022.1|CBM35|PL1_11 185 ELQTGTNTLVLTAtgDSGLPNIDYIEL 211 *************************97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (748 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 332.58 // Query: BCE00371.1|CBM35|CBM6|PL10_1 [L=1077] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-21 64.4 5.3 1.2e-21 64.4 5.3 4.8 5 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 6.0 1.1 0.00072 0.0014 14 81 .. 151 223 .. 128 233 .. 0.67 2 ? 0.3 0.5 0.042 0.083 45 107 .. 438 499 .. 398 511 .. 0.75 3 ? -1.1 0.2 0.11 0.22 24 94 .. 493 565 .. 474 595 .. 0.58 4 ! 64.4 5.3 5.8e-22 1.2e-21 11 119 .] 624 736 .. 616 736 .. 0.93 5 ? -2.6 0.0 0.33 0.66 66 100 .. 888 922 .. 867 935 .. 0.49 Alignments for each domain: == domain 1 score: 6.0 bits; conditional E-value: 0.00072 CBM35.hmm 14 ntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYang..tgstktlsvvvnGtkvs....evtfpst 81 +++ + s + fv++ q+ + t+n d +aG+Y++++ + ++++ ++sv+v ++++ +++f t BCE00371.1|CBM35|CBM6|PL10_1 151 DSDGDQVSVEWFVND-QSVATSQTLNYDFSQAGQYTIKVVVTDQygETDETQTSVTVQDENSTaqkpTAEFSVT 223 555556666667744.4555666888999999999999998777545666677778876665544454444444 PP == domain 2 score: 0.3 bits; conditional E-value: 0.042 CBM35.hmm 45 aGsYelslrYang.tgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitiks 107 G+Y+++l+ + + + ++++v+n f+ ++ + + v L++ + t+ + + BCE00371.1|CBM35|CBM6|PL10_1 438 PGEYNVQLTVSDNdHTVPISKNIVINEIVLPVNAFKVEAESYS--NNSAAVMLENSNTTVGYFN 499 599******9998566677899999998888888887743333..5777788887777776655 PP == domain 3 score: -1.1 bits; conditional E-value: 0.11 CBM35.hmm 24 gfvdglqaagdavtfnvdvpkaGsYelslrYang...tgstktlsvvvnGtkvs...evtfpstgnwdtwgtaagtv 94 + v+++++++ v +vd ++ +++++Ya++ +t l++ ++G + ++++stg+w + ++++t+ BCE00371.1|CBM35|CBM6|PL10_1 493 TTVGYFNGDDYLVYDDVDL--TEIQSVTVNYAANladVEQTGFLEIRIDGLDGLliaLIKMDSTGTWIN--YSDKTM 565 5566664333334444554..334555666665543334445556666655544333555666666655..333333 PP == domain 4 score: 64.4 bits; conditional E-value: 5.8e-22 CBM35.hmm 11 vsvntnhagysGsg..fvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgt 89 ++++nhag +Gs+ f++ ++ g++v+++++v++ G Y+ ++r+ang+ ++++ +++vn t + v +++tg+wd+w+t BCE00371.1|CBM35|CBM6|PL10_1 624 GTIDSNHAGATGSSneFINTDNSIGATVSWSINVTQVGVYDTQVRFANGGDTARSGTITVNQTGEQYVLLDATGAWDSWAT 704 46999*****99753489999999********************************************************* PP CBM35.hmm 90 aagtvtLkaGkntitiks..dwGwinldslel 119 +++ L+ G+n it+k+ G n+d+l+l BCE00371.1|CBM35|CBM6|PL10_1 705 ENVKLALESGNNLITFKAttAGGLANIDKLSL 736 ******************9889999****976 PP == domain 5 score: -2.6 bits; conditional E-value: 0.33 CBM35.hmm 66 vvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGk 100 ++v +++v+++ t+ +++ a++++ ++G BCE00371.1|CBM35|CBM6|PL10_1 888 LTVLDHAVKQTAPFDTDVFSDADRAQMQIAINKGV 922 34444444444333444555555555565555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1077 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 115.60 // Query: WYH55522.1|CBM2|CBM35|CE12 [L=688] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-49 153.4 18.1 4.5e-29 88.3 2.1 3.4 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.4 0.2 0.61 1.2 37 41 .. 63 67 .. 40 85 .. 0.52 2 ! 88.3 2.1 2.3e-29 4.5e-29 12 119 .] 184 293 .. 174 293 .. 0.96 3 ! 75.5 1.4 2e-25 4e-25 12 119 .] 338 449 .. 324 449 .. 0.95 4 ? -2.5 0.0 0.31 0.62 44 74 .. 531 559 .. 524 571 .. 0.69 Alignments for each domain: == domain 1 score: -3.4 bits; conditional E-value: 0.61 CBM35.hmm 37 tfnvd 41 ++v+ WYH55522.1|CBM2|CBM35|CE12 63 NWQVQ 67 22222 PP == domain 2 score: 88.3 bits; conditional E-value: 2.3e-29 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaagt 93 ++++n+agy+Gsgf + +aag+ ++++v + ++GsY++++rYang+++++ +v+vnG+ + + f stg+w+tw ++a++ WYH55522.1|CBM2|CBM35|CE12 184 TIDSNNAGYTGSGFANTENAAGKGIEWSVAA-QGGSYQMQWRYANGSSANRPGDVFVNGALQTSSAFGSTGDWTTWaDSSAVS 265 6899*************************97.78******************************************8899*** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 ++L aG nti++++ ++G n+dsl++ WYH55522.1|CBM2|CBM35|CE12 266 INLAAGINTIRLQAssSEGLANIDSLSV 293 **************99*********986 PP == domain 3 score: 75.5 bits; conditional E-value: 2e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvv.nGtkvs.evtfpstgnwdtwgtaag 92 svn+n ag+++ gf + +a + +v ++vd+ +aG Y+l lr+ang+g+++ +++ G++vs ++tf +tg+w+tw+t + WYH55522.1|CBM2|CBM35|CE12 338 SVNSNEAGFTSGGFANTTNAVNTSVDWAVDAATAGYYDLALRFANGSGAARPGVLTLtSGASVSyDITFATTGAWSTWATEIM 420 69********************************************9999999999878999999****************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 + L+aGkn it+++ d+G n+d+l+l WYH55522.1|CBM2|CBM35|CE12 421 PIFLNAGKNLITLTAtgDSGLANIDYLSL 449 **************************986 PP == domain 4 score: -2.5 bits; conditional E-value: 0.31 CBM35.hmm 44 kaGsYelslrYangtgstktlsvvvnGtkvs 74 ++G+Y l l++ + + s++t + v++G + WYH55522.1|CBM2|CBM35|CE12 531 STGDYLL-LQFGT-NDSHRTATYVIDGVTIP 559 5677754.45555.47999999999998765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (688 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.85 // Query: XOU90536.1|CBM2|CBM35|PL3_1 [L=511] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-30 93.2 2.2 1.4e-30 93.2 2.2 2.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.3 0.07 0.14 36 47 .. 38 49 .. 18 85 .. 0.61 2 ! 93.2 2.2 6.8e-31 1.4e-30 12 119 .] 170 277 .. 160 277 .. 0.97 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.07 CBM35.hmm 36 vtfnvdvpkaGs 47 t+nv+v+++Gs XOU90536.1|CBM2|CBM35|PL3_1 38 YTVNVNVTNTGS 49 222333333332 PP == domain 2 score: 93.2 bits; conditional E-value: 6.8e-31 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagt 93 s+++n++gy+Gsgf + +++g+av+++ +vp++G+Y l rYa+ ++t++ svvvnG++v++ +fpstg+w++w++ + XOU90536.1|CBM2|CBM35|PL3_1 170 SIDNNNSGYTGSGFANTENQNGSAVEYALNVPSNGNYLLDARYAS--ATTRSASVVVNGSSVGSFSFPSTGSWTSWTVDSAN 249 689*****************************************9..6********************************** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 v+Lk G+n ++i + ++G n+dsl++ XOU90536.1|CBM2|CBM35|PL3_1 250 VPLKGGNNIVRIVAtnSSGLPNIDSLKV 277 *************999**********97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (511 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 181.42 // Query: BCD95966.1|CBM35|CE12 [L=466] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-24 72.9 0.0 5.5e-24 71.9 0.0 1.5 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.9 0.0 2.8e-24 5.5e-24 13 119 .] 100 207 .. 92 207 .. 0.94 Alignments for each domain: == domain 1 score: 71.9 bits; conditional E-value: 2.8e-24 CBM35.hmm 13 vntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGk 100 ++++h+gy+G g+ +g+++ag ++t++++ + aG+Y + +rYang+++ + ++ G++ ++f st++w +w++ + ++ L+aG BCD95966.1|CBM35|CE12 100 IESDHQGYEGPGYANGVNSAGVKLTWAITLERAGNYPIAIRYANGSAEPRPARLAA-GEQTAALDFSSTTAWAEWQSEQASLFLSAGV 186 799*****************************************999999999876.677889************************* PP CBM35.hmm 101 ntitiks..dwGwinldslel 119 n it+++ G n+ds+++ BCD95966.1|CBM35|CE12 187 NIITLEAleAAGLANIDSISI 207 ******************975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (466 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 252.86 // Query: BCD96246.1|CBM35|PL1 [L=715] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-22 66.6 2.1 4e-22 65.9 1.2 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.9 1.2 2e-22 4e-22 13 119 .] 83 191 .. 70 191 .. 0.97 2 ? -4.1 0.0 0.95 1.9 41 55 .. 488 499 .. 482 508 .. 0.72 Alignments for each domain: == domain 1 score: 65.9 bits; conditional E-value: 2e-22 CBM35.hmm 13 vntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkn 101 ++t+hag+ G+gf d + +g+++++++++ +a + + ++rYang+gs++ ++++G+++ ++ + tg+wd+w++ v+ +aG+n BCD96246.1|CBM35|PL1 83 IDTEHAGFGGTGFADTENVTGSTIQWKINSSTAQTITATIRYANGGGSARPGALSIDGQASANYMLGDTGAWDNWQEESYPVSVSAGDN 171 89*************************************************************************************** PP CBM35.hmm 102 titiks..dwGwinldslel 119 t+ +++ ++G n+ds++l BCD96246.1|CBM35|PL1 172 TLLLTAagSSGLANVDSIKL 191 ******************97 PP == domain 2 score: -4.1 bits; conditional E-value: 0.95 CBM35.hmm 41 dvpkaGsYelslrYa 55 +v G Y++++++ BCD96246.1|CBM35|PL1 488 KV---GAYNITISFN 499 33...8899998875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (715 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 307.85 // Query: XOU90533.1|CBM2|CBM35|PL1_2 [L=769] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-26 80.1 2.6 1.5e-26 80.1 2.6 3.4 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.0 0.2 0.051 0.1 15 60 .. 39 85 .. 29 121 .. 0.71 2 ! 80.1 2.6 7.7e-27 1.5e-26 12 119 .] 194 302 .. 186 302 .. 0.96 3 ? -3.2 0.1 0.53 1.1 13 30 .. 539 556 .. 534 567 .. 0.72 Alignments for each domain: == domain 1 score: 0.0 bits; conditional E-value: 0.051 CBM35.hmm 15 tnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgs 60 tn++g +g+v + +++ + ++v+ + aG+ ++s ++ ++ ++ XOU90533.1|CBM2|CBM35|PL1_2 39 TNQWGSAFTGNVRITNsGNTPTNDWAVNWQYAGDNRISNSWGAQLSG 85 56666666666643331333346788999999999888888776444 PP == domain 2 score: 80.1 bits; conditional E-value: 7.7e-27 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagt 93 s+++n+ g++G+gf + + +g+++ ++v+v+ +G Y+l++rYang+g+++t sv+ nG++ se++fp+tg+wd+w +t XOU90533.1|CBM2|CBM35|PL1_2 194 SIDSNNGGFTGTGFANTDNVNGSQINWKVNVDFDGYYALEWRYANGSGTARTASVSANGAQ-SEISFPTTGSWDSWLLDSTT 274 6899******************************************************987.88****************** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 + LkaG n + +++ ++G n+dsl++ XOU90533.1|CBM2|CBM35|PL1_2 275 LFLKAGVNDVILSAntSSGLANIDSLTV 302 ************9999**********97 PP == domain 3 score: -3.2 bits; conditional E-value: 0.53 CBM35.hmm 13 vntnhagysGsgfvdglq 30 v n + sGsg+ d+ + XOU90533.1|CBM2|CBM35|PL1_2 539 VARNVRFASGSGYTDYRN 556 566777778888877654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (769 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 237.92 // Query: BCD99782.1|CBM35|PL1_5 [L=587] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-25 76.4 10.9 2.3e-25 76.3 7.6 2.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 76.3 7.6 1.2e-25 2.3e-25 12 119 .] 98 209 .. 86 209 .. 0.94 2 ? -1.3 0.1 0.13 0.26 58 80 .. 303 325 .. 266 336 .. 0.62 Alignments for each domain: == domain 1 score: 76.3 bits; conditional E-value: 1.2e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs..evtfpstgnwdtwgtaagtvtL 96 ++t+h+gy G gfvd +a+g++++++v++ ++ +Y++++rYang+ ++++ +++ nG++ +v++++tg+w tw + +++++L BCD99782.1|CBM35|PL1_5 98 VIDTKHSGYVGAGFVDSENATGASIEWQVNASESNTYQVTFRYANGGDAARSGTLTANGNAGAsvTVNMDTTGAWATWVEETVEISL 184 589********************************************************9988778889999*************** PP CBM35.hmm 97 kaGkntitiks..dwGwinldslel 119 +aG n++ + + +G n ds+++ BCD99782.1|CBM35|PL1_5 185 NAGVNKLVLAAngAEGLANTDSISI 209 **********99999*******975 PP == domain 2 score: -1.3 bits; conditional E-value: 0.13 CBM35.hmm 58 tgstktlsvvvnGtkvsevtfps 80 g+t++ s + nGtk++++ +++ BCD99782.1|CBM35|PL1_5 303 HGNTASASGSCNGTKADTIVLKE 325 23444444444444444444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (587 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.30 // Query: XOU86452.1|CBM2|CBM35|PL3_1 [L=511] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-30 93.2 2.2 1.4e-30 93.2 2.2 2.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.3 0.07 0.14 36 47 .. 38 49 .. 18 85 .. 0.61 2 ! 93.2 2.2 6.8e-31 1.4e-30 12 119 .] 170 277 .. 160 277 .. 0.97 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.07 CBM35.hmm 36 vtfnvdvpkaGs 47 t+nv+v+++Gs XOU86452.1|CBM2|CBM35|PL3_1 38 YTVNVNVTNTGS 49 222333333332 PP == domain 2 score: 93.2 bits; conditional E-value: 6.8e-31 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagt 93 s+++n++gy+Gsgf + +++g+av+++ +vp++G+Y l rYa+ ++t++ svvvnG++v++ +fpstg+w++w++ + XOU86452.1|CBM2|CBM35|PL3_1 170 SIDNNNSGYTGSGFANTENQNGSAVEYALNVPSNGNYLLDARYAS--ATTRSASVVVNGSSVGSFSFPSTGSWTSWTVDSAN 249 689*****************************************9..6********************************** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 v+Lk G+n ++i + ++G n+dsl++ XOU86452.1|CBM2|CBM35|PL3_1 250 VPLKGGNNIVRIVAtnSSGLPNIDSLKV 277 *************999**********97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (511 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 196.91 // Query: BFM21296.1|CBM35|PL1_11|PL1_5 [L=1413] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-29 89.8 3.8 9.7e-29 87.2 3.8 2.5 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.2 3.8 4.9e-29 9.7e-29 12 119 .] 638 747 .. 630 747 .. 0.96 Alignments for each domain: == domain 1 score: 87.2 bits; conditional E-value: 4.9e-29 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gta 90 ++++nh+gy+Gsgf + +++g+ + ++v+vp++G+Y+l++rYan +g+++ +v vnG+++ v+++ t++wd++ g+ BFM21296.1|CBM35|PL1_11|PL1_5 638 TIDNNHSGYEGSGFANTENTQGSGINWSVNVPTSGTYQLNWRYAN-GGNNRPGNVLVNGSNQAYVDLNPTSAWDDFtGSG 716 689******************************************.7*****************************99** PP CBM35.hmm 91 agtvtLkaGkntitiks..dwGwinldslel 119 +++v+L+aG+n +++++ ++G n+dsl++ BFM21296.1|CBM35|PL1_11|PL1_5 717 TVSVSLDAGYNELRLEAttSSGLANIDSLSI 747 ****************************975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1413 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 423.86 // Query: WGL15779.1|CBM35|PL1_11|PL1_5 [L=1296] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-28 87.0 3.7 1.1e-28 87.0 3.7 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.5 0.24 0.49 25 52 .. 531 557 .. 511 572 .. 0.51 2 ! 87.0 3.7 5.7e-29 1.1e-28 10 119 .] 646 756 .. 638 756 .. 0.95 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.24 CBM35.hmm 25 fvdglqaagdavtfnvdvpkaGsYelsl 52 + ++ +++vt+nv v + s +l++ WGL15779.1|CBM35|PL1_11|PL1_5 531 SSSSSSGGTGSVTLNVAVA-GSSANLTW 557 3334445555566666652.23334444 PP == domain 2 score: 87.0 bits; conditional E-value: 5.7e-29 CBM35.hmm 10 gvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.g 88 gv ++t+h+gy+G g+ + ++++g+ v ++v vp+aG+Y+l++rYan +gs++ v vnG+++ ++ + stg+w+++ WGL15779.1|CBM35|PL1_11|PL1_5 646 GV-IETEHSGYTGAGYANTVNETGAGVNWSVVVPTAGNYTLQWRYAN-SGSDRPAAVLVNGSSQTSLGMGSTGAWNSFaD 723 44.89******************************************.8*****************************88 PP CBM35.hmm 89 taagtvtLkaGkntitiks..dwGwinldslel 119 + ++v+L+aG+nti++++ ++G n+ds+ + WGL15779.1|CBM35|PL1_11|PL1_5 724 SGSVSVYLNAGYNTIRLQAtgSSGLANIDSIAV 756 899***************************986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1296 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 397.37 // Query: XOU78267.1|CBM2|CBM35|PL3_1 [L=511] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-30 93.2 2.2 1.4e-30 93.2 2.2 2.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.3 0.07 0.14 36 47 .. 38 49 .. 18 85 .. 0.61 2 ! 93.2 2.2 6.8e-31 1.4e-30 12 119 .] 170 277 .. 160 277 .. 0.97 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.07 CBM35.hmm 36 vtfnvdvpkaGs 47 t+nv+v+++Gs XOU78267.1|CBM2|CBM35|PL3_1 38 YTVNVNVTNTGS 49 222333333332 PP == domain 2 score: 93.2 bits; conditional E-value: 6.8e-31 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagt 93 s+++n++gy+Gsgf + +++g+av+++ +vp++G+Y l rYa+ ++t++ svvvnG++v++ +fpstg+w++w++ + XOU78267.1|CBM2|CBM35|PL3_1 170 SIDNNNSGYTGSGFANTENQNGSAVEYALNVPSNGNYLLDARYAS--ATTRSASVVVNGSSVGSFSFPSTGSWTSWTVDSAN 249 689*****************************************9..6********************************** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 v+Lk G+n ++i + ++G n+dsl++ XOU78267.1|CBM2|CBM35|PL3_1 250 VPLKGGNNIVRIVAtnSSGLPNIDSLKV 277 *************999**********97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (511 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 236.45 // Query: XOU73581.1|CBM35|PL10_1 [L=572] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-27 80.9 4.2 2.6e-26 79.4 4.2 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.4 4.2 1.3e-26 2.6e-26 11 119 .] 94 201 .. 83 201 .. 0.90 Alignments for each domain: == domain 1 score: 79.4 bits; conditional E-value: 1.3e-26 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtL 96 ++ +nh gysG+gfvd +a+g+++t++vdv ++G+Y++s+r+an +++++ +++ n + + ++ f +tg+w tw++ + tv+L XOU73581.1|CBM35|PL10_1 94 GEIVNNHEGYSGTGFVDTANAEGASITWKVDV-DGGNYDVSVRFAN-GSTARGATLSSN-EINTTYGFATTGDWATWADETHTVSL 176 567899*************************9.67***********.699999999999.66689********************* PP CBM35.hmm 97 kaGkntitiks..dwGwinldslel 119 aG+nti++++ G n+d++++ XOU73581.1|CBM35|PL10_1 177 AAGENTIQLSAltAGGLPNVDAITI 201 ************888999****986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (572 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 293.06 // Query: XOU75680.1|CBM35|PL1_11|PL1_5 [L=1318] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-25 76.2 2.7 2.5e-25 76.2 2.7 4.8 5 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.2 0.08 0.16 28 82 .. 444 497 .. 430 515 .. 0.75 2 ? -1.2 0.3 0.12 0.25 56 80 .. 552 577 .. 504 590 .. 0.66 3 ? -1.5 0.9 0.15 0.31 18 63 .. 601 645 .. 591 662 .. 0.67 4 ! 76.2 2.7 1.3e-25 2.5e-25 12 119 .] 663 772 .. 653 772 .. 0.95 5 ? -0.9 0.0 0.098 0.2 53 103 .. 1262 1309 .. 1245 1313 .. 0.84 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.08 CBM35.hmm 28 glqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstg 82 ++++g+++ ++ +++a Ye +++ + +++ t v G++v+++tf++ + XOU75680.1|CBM35|PL1_11|PL1_5 444 SIKWSGSQTVNAIVIKEAAGYEGNISGWQ-VTDNDTGAVLAAGSSVGTITFDAVT 497 56777888888888888888888888666.5888999999999999999998764 PP == domain 2 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 56 ngtgstktlsvvvnGtkvs.evtfps 80 ++tg+t+tls +v G++v + ++++ XOU75680.1|CBM35|PL1_11|PL1_5 552 SSTGGTATLSTTVSGDQVTlNWSVNN 577 33555555555555555544333333 PP == domain 3 score: -1.5 bits; conditional E-value: 0.15 CBM35.hmm 18 agysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstkt 63 +g +G+++ d a+++ + v+v+++ s +++ +Y++++ + t XOU75680.1|CBM35|PL1_11|PL1_5 601 SGVTGNTYTDTG-LANGTYYYWVKVTDSNSATINSNYSEAQVNVYT 645 566777777654.344444455888888888888888876554444 PP == domain 4 score: 76.2 bits; conditional E-value: 1.3e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gta 90 sv++n++g+ Gsgf + +a+g+ v ++v vp aG Y+l++r+an ++s++ +v vn ++++ ++pstg+w++w +++ XOU75680.1|CBM35|PL1_11|PL1_5 663 SVDSNNSGFAGSGFANTDNASGNGVNYAVSVPVAGVYTLQVRFAN-GSSARPADVLVNYGNAGVFDLPSTGSWTSWsNSN 741 699******************************************.6*****************************99** PP CBM35.hmm 91 agtvtLkaGkntitiks..dwGwinldslel 119 +++v+L aG+n +++++ + G n+dsl++ XOU75680.1|CBM35|PL1_11|PL1_5 742 EISVNLVAGNNIVRLEAttSGGLANIDSLSV 772 ******************999999****986 PP == domain 5 score: -0.9 bits; conditional E-value: 0.098 CBM35.hmm 53 rYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGknti 103 Y++++++t + + +v G++ ++ f + g+ ++ a t +aG+n++ XOU75680.1|CBM35|PL1_11|PL1_5 1262 DYSSASKNTISANRFVAGDDLTDYVFATAGKGGK---APYVSTFTAGQNSL 1309 589999999999999*************999888...88888888999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1318 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.90 // Query: XOU71588.1|CBM35|PL1_11|PL1_5 [L=1318] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-25 76.2 2.7 2.5e-25 76.2 2.7 4.8 5 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.2 0.08 0.16 28 82 .. 444 497 .. 430 515 .. 0.75 2 ? -1.2 0.3 0.12 0.25 56 80 .. 552 577 .. 504 590 .. 0.66 3 ? -1.5 0.9 0.15 0.31 18 63 .. 601 645 .. 591 662 .. 0.67 4 ! 76.2 2.7 1.3e-25 2.5e-25 12 119 .] 663 772 .. 653 772 .. 0.95 5 ? -0.9 0.0 0.098 0.2 53 103 .. 1262 1309 .. 1245 1313 .. 0.84 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.08 CBM35.hmm 28 glqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstg 82 ++++g+++ ++ +++a Ye +++ + +++ t v G++v+++tf++ + XOU71588.1|CBM35|PL1_11|PL1_5 444 SIKWSGSQTVNAIVIKEAAGYEGNISGWQ-VTDNDTGAVLAAGSSVGTITFDAVT 497 56777888888888888888888888666.5888999999999999999998764 PP == domain 2 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 56 ngtgstktlsvvvnGtkvs.evtfps 80 ++tg+t+tls +v G++v + ++++ XOU71588.1|CBM35|PL1_11|PL1_5 552 SSTGGTATLSTTVSGDQVTlNWSVNN 577 33555555555555555544333333 PP == domain 3 score: -1.5 bits; conditional E-value: 0.15 CBM35.hmm 18 agysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstkt 63 +g +G+++ d a+++ + v+v+++ s +++ +Y++++ + t XOU71588.1|CBM35|PL1_11|PL1_5 601 SGVTGNTYTDTG-LANGTYYYWVKVTDSNSATINSNYSEAQVNVYT 645 566777777654.344444455888888888888888876554444 PP == domain 4 score: 76.2 bits; conditional E-value: 1.3e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gta 90 sv++n++g+ Gsgf + +a+g+ v ++v vp aG Y+l++r+an ++s++ +v vn ++++ ++pstg+w++w +++ XOU71588.1|CBM35|PL1_11|PL1_5 663 SVDSNNSGFAGSGFANTDNASGNGVNYAVSVPVAGVYTLQVRFAN-GSSARPADVLVNYGNAGVFDLPSTGSWTSWsNSN 741 699******************************************.6*****************************99** PP CBM35.hmm 91 agtvtLkaGkntitiks..dwGwinldslel 119 +++v+L aG+n +++++ + G n+dsl++ XOU71588.1|CBM35|PL1_11|PL1_5 742 EISVNLVAGNNIVRLEAttSGGLANIDSLSV 772 ******************999999****986 PP == domain 5 score: -0.9 bits; conditional E-value: 0.098 CBM35.hmm 53 rYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGknti 103 Y++++++t + + +v G++ ++ f + g+ ++ a t +aG+n++ XOU71588.1|CBM35|PL1_11|PL1_5 1262 DYSSASKNTISANRFVAGDDLTDYVFATAGKGGK---APYVSTFTAGQNSL 1309 589999999999999*************999888...88888888999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1318 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 93.63 // Query: XOU74173.1|CBM2|CBM35|PL1_2 [L=769] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-26 80.1 2.6 1.5e-26 80.1 2.6 3.4 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.0 0.2 0.051 0.1 15 60 .. 39 85 .. 29 121 .. 0.71 2 ! 80.1 2.6 7.7e-27 1.5e-26 12 119 .] 194 302 .. 186 302 .. 0.96 3 ? -3.2 0.1 0.53 1.1 13 30 .. 539 556 .. 534 567 .. 0.72 Alignments for each domain: == domain 1 score: 0.0 bits; conditional E-value: 0.051 CBM35.hmm 15 tnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgs 60 tn++g +g+v + +++ + ++v+ + aG+ ++s ++ ++ ++ XOU74173.1|CBM2|CBM35|PL1_2 39 TNQWGSAFTGNVRITNsGNTPTNDWAVNWQYAGDNRISNSWGAQLSG 85 56666666666643331333346788999999999888888776444 PP == domain 2 score: 80.1 bits; conditional E-value: 7.7e-27 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagt 93 s+++n+ g++G+gf + + +g+++ ++v+v+ +G Y+l++rYang+g+++t sv+ nG++ se++fp+tg+wd+w +t XOU74173.1|CBM2|CBM35|PL1_2 194 SIDSNNGGFTGTGFANTDNVNGSQINWKVNVDFDGYYALEWRYANGSGTARTASVSANGAQ-SEISFPTTGSWDSWLLDSTT 274 6899******************************************************987.88****************** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 + LkaG n + +++ ++G n+dsl++ XOU74173.1|CBM2|CBM35|PL1_2 275 LFLKAGVNDVILSAntSSGLANIDSLTV 302 ************9999**********97 PP == domain 3 score: -3.2 bits; conditional E-value: 0.53 CBM35.hmm 13 vntnhagysGsgfvdglq 30 v n + sGsg+ d+ + XOU74173.1|CBM2|CBM35|PL1_2 539 VARNVRFASGSGYTDYRN 556 566777778888877654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (769 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 223.06 // Query: BCD98629.1|CBM35|CE8 [L=678] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-25 76.7 2.3 1.8e-25 76.7 2.3 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 76.7 2.3 9.1e-26 1.8e-25 12 119 .] 91 201 .. 82 201 .. 0.94 2 ? -1.9 0.1 0.2 0.39 35 44 .. 352 361 .. 323 420 .. 0.53 Alignments for each domain: == domain 1 score: 76.7 bits; conditional E-value: 9.1e-26 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgtaagtvtLkaG 99 v+t+h g+sG gf+d l++ag+++ f+v+v +aGsY + +rYang+++++ +++ + +++ ++ t++wd+w++ g + L +G BCD98629.1|CBM35|CE8 91 VVDTKHVGFSGAGFIDTLNEAGASIVFAVNVSNAGSYGIDIRYANGSTQARGGNLSAEQASSTtAFNLGITNTWDNWQVESGALALAQG 179 499*******************************************************998885667888899**************** PP CBM35.hmm 100 kntitiks..dwGwinldslel 119 +n +++++ +G n+ds+++ BCD98629.1|CBM35|CE8 180 NNIVRLSAttANGLANIDSITI 201 ********999*********86 PP == domain 2 score: -1.9 bits; conditional E-value: 0.2 CBM35.hmm 35 avtfnvdvpk 44 ++ nv+v++ BCD98629.1|CBM35|CE8 352 PTSANVTVDD 361 3333333322 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (678 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 279.62 // Query: XOU87952.1|CBM35|PL1_11|PL1_5 [L=1318] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-25 76.2 2.7 2.5e-25 76.2 2.7 4.8 5 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.2 0.08 0.16 28 82 .. 444 497 .. 430 515 .. 0.75 2 ? -1.2 0.3 0.12 0.25 56 80 .. 552 577 .. 504 590 .. 0.66 3 ? -1.5 0.9 0.15 0.31 18 63 .. 601 645 .. 591 662 .. 0.67 4 ! 76.2 2.7 1.3e-25 2.5e-25 12 119 .] 663 772 .. 653 772 .. 0.95 5 ? -0.9 0.0 0.098 0.2 53 103 .. 1262 1309 .. 1245 1313 .. 0.84 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.08 CBM35.hmm 28 glqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstg 82 ++++g+++ ++ +++a Ye +++ + +++ t v G++v+++tf++ + XOU87952.1|CBM35|PL1_11|PL1_5 444 SIKWSGSQTVNAIVIKEAAGYEGNISGWQ-VTDNDTGAVLAAGSSVGTITFDAVT 497 56777888888888888888888888666.5888999999999999999998764 PP == domain 2 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 56 ngtgstktlsvvvnGtkvs.evtfps 80 ++tg+t+tls +v G++v + ++++ XOU87952.1|CBM35|PL1_11|PL1_5 552 SSTGGTATLSTTVSGDQVTlNWSVNN 577 33555555555555555544333333 PP == domain 3 score: -1.5 bits; conditional E-value: 0.15 CBM35.hmm 18 agysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstkt 63 +g +G+++ d a+++ + v+v+++ s +++ +Y++++ + t XOU87952.1|CBM35|PL1_11|PL1_5 601 SGVTGNTYTDTG-LANGTYYYWVKVTDSNSATINSNYSEAQVNVYT 645 566777777654.344444455888888888888888876554444 PP == domain 4 score: 76.2 bits; conditional E-value: 1.3e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gta 90 sv++n++g+ Gsgf + +a+g+ v ++v vp aG Y+l++r+an ++s++ +v vn ++++ ++pstg+w++w +++ XOU87952.1|CBM35|PL1_11|PL1_5 663 SVDSNNSGFAGSGFANTDNASGNGVNYAVSVPVAGVYTLQVRFAN-GSSARPADVLVNYGNAGVFDLPSTGSWTSWsNSN 741 699******************************************.6*****************************99** PP CBM35.hmm 91 agtvtLkaGkntitiks..dwGwinldslel 119 +++v+L aG+n +++++ + G n+dsl++ XOU87952.1|CBM35|PL1_11|PL1_5 742 EISVNLVAGNNIVRLEAttSGGLANIDSLSV 772 ******************999999****986 PP == domain 5 score: -0.9 bits; conditional E-value: 0.098 CBM35.hmm 53 rYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGknti 103 Y++++++t + + +v G++ ++ f + g+ ++ a t +aG+n++ XOU87952.1|CBM35|PL1_11|PL1_5 1262 DYSSASKNTISANRFVAGDDLTDYVFATAGKGGK---APYVSTFTAGQNSL 1309 589999999999999*************999888...88888888999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1318 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.81 // Query: UII26429.1|CBM35|CBM6|CBM88|CE8|PL1_2 [L=1361] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-26 78.8 3.6 4e-26 78.8 3.6 6.0 7 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.6 0.6 0.00094 0.0019 22 117 .. 372 470 .. 354 472 .. 0.77 2 ? 1.5 0.3 0.018 0.035 27 79 .. 524 577 .. 506 590 .. 0.75 3 ? -3.3 0.2 0.55 1.1 66 85 .. 848 867 .. 839 869 .. 0.77 4 ? -0.0 0.6 0.054 0.11 15 77 .. 896 931 .. 884 944 .. 0.57 5 ? -3.7 0.2 0.74 1.5 46 74 .. 988 1009 .. 979 1019 .. 0.63 6 ? -2.3 0.0 0.27 0.54 28 69 .. 1081 1123 .. 1079 1139 .. 0.73 7 ! 78.8 3.6 2e-26 4e-26 12 119 .] 1144 1256 .. 1130 1256 .. 0.95 Alignments for each domain: == domain 1 score: 5.6 bits; conditional E-value: 0.00094 CBM35.hmm 22 Gsgfvdglqaagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvn...Gtkvsevtfpstgnwdtwgt 89 G +v+++ ++gd ++f+ vd k+G ++ r a+ ++t + s+ ++ Gt+++++t++s+g w+t++ UII26429.1|CBM35|CBM6|CBM88|CE8|PL1_2 372 GGLNVGYI-ENGDWISFSnVDF-KNGAQSFLARAAT--TATGNISIHIDsptGTEIGNCTITSSGGWQTYSN 439 44566555.7888888886776.5688887777776..6778888888655599999*************** PP CBM35.hmm 90 aagtvtLkaGkntitiks..dwGwi.nldsl 117 + +v+ G + + + +G++ nl+++ UII26429.1|CBM35|CBM6|CBM88|CE8|PL1_2 440 FTSSVSSVSGIHDLFLVFegGSGYLfNLNYI 470 **99999999999888886777777788887 PP == domain 2 score: 1.5 bits; conditional E-value: 0.018 CBM35.hmm 27 dglqaagdavtfnvdvpkaGsYelslrYang.tgstktlsvvvnGtkvsevtfp 79 ++++ +av f+ +++G+ + +++ g + ++k+ +++vn + e++ p UII26429.1|CBM35|CBM6|CBM88|CE8|PL1_2 524 ATIDNSAQAVYFSGAPTQSGTFQYTINTVGGsPNASKSGTITVNQVTAPETDAP 577 45667777788887777888777777766666999*********9888876655 PP == domain 3 score: -3.3 bits; conditional E-value: 0.55 CBM35.hmm 66 vvvnGtkvsevtfpstgnwd 85 ++vnG++ + + s++nw+ UII26429.1|CBM35|CBM6|CBM88|CE8|PL1_2 848 FYVNGNYMNGSSTVSNDNWQ 867 57888888877777777886 PP == domain 4 score: -0.0 bits; conditional E-value: 0.054 CBM35.hmm 15 tnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevt 77 + + y++ g +++ da+ + v+ +++G+Y t UII26429.1|CBM35|CBM6|CBM88|CE8|PL1_2 896 SASGAYTAVLAYAGASNDRDAIDARiVNETTNGTY----------------------------T 931 34444555555555555555555554555555555............................4 PP == domain 5 score: -3.7 bits; conditional E-value: 0.74 CBM35.hmm 46 GsYelslrYangtgstktlsvvvnGtkvs 74 Y+ls Y n ++v++nG +s UII26429.1|CBM35|CBM6|CBM88|CE8|PL1_2 988 SAYTLSSVYTN-------VEVYINGLIAS 1009 45666666655.......67777776655 PP == domain 6 score: -2.3 bits; conditional E-value: 0.27 CBM35.hmm 28 glqaagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvn 69 g++a g +++++ ++ + G+Y ++ + g +st+ +++++ UII26429.1|CBM35|CBM6|CBM88|CE8|PL1_2 1081 GFNAGGREMELTnIQPAQMGNYVATYANSCGAQSTQIFTITIE 1123 7888888888877999999999877777777777777777776 PP == domain 7 score: 78.8 bits; conditional E-value: 2e-26 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst 81 s+++n+ag++G+gf + +a+g+ +++++ +p +GsY+l++rYang+++++ +++v+G+ v ++ f+st UII26429.1|CBM35|CBM6|CBM88|CE8|PL1_2 1144 SIDNNNAGFQGDGFANTTNASGAGIEWSIAIPYSGSYTLRWRYANGSTEARAGNIMVDGNTVASAAFNST 1213 789******************************************************************* PP CBM35.hmm 82 gnwdtw...gtaagtvtLkaGkntitiks..dwGwinldslel 119 ++w++w +++ +t++L+aG++ +++++ G n+d++e+ UII26429.1|CBM35|CBM6|CBM88|CE8|PL1_2 1214 EAWTSWsenSSSYVTISLSAGTHRVRLEAttAAGLANIDKMEV 1256 ******77667889***************9999*******987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1361 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 137.62 // Query: XMO78188.1|CBM35|GH168 [L=851] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-53 166.0 20.5 4.6e-20 59.2 1.0 3.8 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.2 1.0 2.3e-20 4.6e-20 12 118 .. 361 468 .. 352 469 .. 0.94 2 ! 58.8 1.7 3.2e-20 6.4e-20 12 119 .] 502 610 .. 491 610 .. 0.92 3 ! 59.2 1.9 2.3e-20 4.7e-20 12 119 .] 641 749 .. 634 749 .. 0.94 4 ? -3.3 0.0 0.56 1.1 34 57 .. 818 841 .. 798 845 .. 0.66 Alignments for each domain: == domain 1 score: 59.2 bits; conditional E-value: 2.3e-20 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtw.gtaagtvtL 96 ++n+n++gy+G+gfv+ +aag+ + + + +aGsY++++r+a s++ ++ vnG+++ ++t++ tg+w w + + +tv+L XMO78188.1|CBM35|GH168 361 AINNNQPGYTGDGFVNTDNAAGNGINWLIS-GSAGSYTFTWRHACP--SDRIGNLLVNGESILnNITLDGTGDWAVWeENTSVTVNL 444 489**************************9.699***********5..9***********9877*************88899***** PP CBM35.hmm 97 kaGkntitiks..dwGwinldsle 118 aG + ++++s +G n+d+++ XMO78188.1|CBM35|GH168 445 PAGIKDVRLESvsTNGLGNIDYMK 468 ************999******986 PP == domain 2 score: 58.8 bits; conditional E-value: 3.2e-20 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtw.gtaagtvtL 96 ++n+n+++y+G+gfv+ +a+g+ + +++ +aG Y++ +++a s+++ +++vnG ++ +tf++t+ w+ w + + +tv+L XMO78188.1|CBM35|GH168 502 AINNNQPDYTGDGFVNTDNATGNGINWKIS-GDAGLYTFIWNHACP--SDRQGELFVNGVSAIgAITFNKTTGWNIWeENTSVTVNL 585 589**************************9.688***********5..99*********87655*************88899***** PP CBM35.hmm 97 kaGkntitiks..dwGwinldslel 119 aG + i+++s +G n+d++++ XMO78188.1|CBM35|GH168 586 PAGIKDIRLESisTNGLGNIDYMKV 610 ************999*******997 PP == domain 3 score: 59.2 bits; conditional E-value: 2.3e-20 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtw.gtaagtvtL 96 ++n+n++gy+G+gf + +a+g+ v +++ ++GsY++++++a s+++ +++vnG +v +tf++t++w+ w + + +tv+L XMO78188.1|CBM35|GH168 641 AINNNQPGYTGDGFANTDNASGNGVNWKIF-GDSGSYTFTWNHACP--SDRQGELFVNGVSVLdAITFNKTTEWNIWkENTSVTVYL 724 489**************************8.578***********5..99*********999879************878899**** PP CBM35.hmm 97 kaGkntitiks..dwGwinldslel 119 aG + i+i+s +G n+d++++ XMO78188.1|CBM35|GH168 725 PAGVKDIRIESisTNGLGNIDYMKV 749 ************999*******997 PP == domain 4 score: -3.3 bits; conditional E-value: 0.56 CBM35.hmm 34 davtfnvdvpkaGsYelslrYang 57 +++ f++ ++G Y l++ ng XMO78188.1|CBM35|GH168 818 NETNFDILELSSGVYVLKIVSENG 841 455666666667777777766654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (851 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 206.73 // Query: WGO97622.1|CBM35|PL1_5 [L=772] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-27 82.2 3.3 3.5e-27 82.2 3.3 2.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.7 0.24 0.48 25 25 .. 503 503 .. 432 570 .. 0.63 2 ! 82.2 3.3 1.7e-27 3.5e-27 11 119 .] 651 761 .. 640 761 .. 0.94 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.24 CBM35.hmm 25 f 25 WGO97622.1|CBM35|PL1_5 503 T 503 1 PP == domain 2 score: 82.2 bits; conditional E-value: 1.7e-27 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaagtvtL 96 sv++n+agy+G+gfv+ +a+g+a ++ ++p+aG+Y+l++rYan ++s++ +v vn +++++ +f stg+w++w ++++ +++ WGO97622.1|CBM35|PL1_5 651 GSVDSNNAGYTGDGFVNTDNASGNAAVYAFNAPSAGMYTLQVRYAN-GSSARPGDVLVNAGNIGTFDFSSTGSWTSWaNSNELSAYF 736 469*******************************************.6*****************************99******** PP CBM35.hmm 97 kaGkntitiks..dwGwinldslel 119 +aG+nt++i++ + G nlds+++ WGO97622.1|CBM35|PL1_5 737 SAGNNTVRIQAtnSGGLPNLDSVSV 761 ************778888***9876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (772 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 119.89 // Query: XOU87953.1|CBM35|PL1_5 [L=772] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-27 82.2 3.3 3.5e-27 82.2 3.3 2.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.7 0.24 0.48 25 25 .. 503 503 .. 432 570 .. 0.63 2 ! 82.2 3.3 1.7e-27 3.5e-27 11 119 .] 651 761 .. 640 761 .. 0.94 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.24 CBM35.hmm 25 f 25 XOU87953.1|CBM35|PL1_5 503 T 503 1 PP == domain 2 score: 82.2 bits; conditional E-value: 1.7e-27 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaagtvtL 96 sv++n+agy+G+gfv+ +a+g+a ++ ++p+aG+Y+l++rYan ++s++ +v vn +++++ +f stg+w++w ++++ +++ XOU87953.1|CBM35|PL1_5 651 GSVDSNNAGYTGDGFVNTDNASGNAAVYAFNAPSAGMYTLQVRYAN-GSSARPGDVLVNAGNIGTFDFSSTGSWTSWaNSNELSAYF 736 469*******************************************.6*****************************99******** PP CBM35.hmm 97 kaGkntitiks..dwGwinldslel 119 +aG+nt++i++ + G nlds+++ XOU87953.1|CBM35|PL1_5 737 SAGNNTVRIQAtnSGGLPNLDSVSV 761 ************778888***9876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (772 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 136.18 // Query: XOU71476.1|CBM2|CBM35|PL10_1 [L=700] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-30 90.8 3.2 7.8e-30 90.8 3.2 2.7 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 1.6 0.11 0.22 46 78 .. 82 116 .. 46 143 .. 0.59 2 ? -0.7 1.0 0.088 0.18 11 65 .. 104 157 .. 90 184 .. 0.66 3 ! 90.8 3.2 3.9e-30 7.8e-30 12 119 .] 221 330 .. 213 330 .. 0.96 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.11 CBM35.hmm 46 GsYelslrYang..tgstktlsvvvnGtkvsevtf 78 + +l l+Y ++ +++ + sv+ nG+ v+ +++ XOU71476.1|CBM2|CBM35|PL10_1 82 SNWALALNYDQAaaITNSWNASVSANGNVVNATNI 116 34555566655533555666677777777765544 PP == domain 2 score: -0.7 bits; conditional E-value: 0.088 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktls 65 vs+n n + + g+ ++l aag++++f + + +G+ +l ++ +g++s+++ s XOU71476.1|CBM2|CBM35|PL10_1 104 VSANGNVVNATNIGWNGNL-AAGQSTSFGLQGTYTGNFSLPVCVGQGQSSSSSSS 157 4445555555555655555.77888888888888888888888888755555544 PP == domain 3 score: 90.8 bits; conditional E-value: 3.9e-30 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaag 92 s+++n++g++Gsgf + +a+g++v ++v vp +G+Y l++rYang+g+++ + vnG+++++ +fp+tg+w++w+ta XOU71476.1|CBM2|CBM35|PL10_1 221 SIDSNNSGFTGSGFANTDNATGKSVDWSVSVPYSGNYLLEWRYANGSGNNRAGAIEVNGNARGNQSFPTTGAWTSWTTASA 301 6899***************************************************************************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 +v+L+aG+n i++ + +G n+dsl++ XOU71476.1|CBM2|CBM35|PL10_1 302 NVSLDAGTNLISLVAstGEGLGNIDSLTV 330 ***************8888888****997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (700 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 120.01 // Query: XOU89942.1|CBM35|PL10_1 [L=572] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-27 80.9 4.2 2.6e-26 79.4 4.2 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.4 4.2 1.3e-26 2.6e-26 11 119 .] 94 201 .. 83 201 .. 0.90 Alignments for each domain: == domain 1 score: 79.4 bits; conditional E-value: 1.3e-26 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtL 96 ++ +nh gysG+gfvd +a+g+++t++vdv ++G+Y++s+r+an +++++ +++ n + + ++ f +tg+w tw++ + tv+L XOU89942.1|CBM35|PL10_1 94 GEIVNNHEGYSGTGFVDTANAEGASITWKVDV-DGGNYDVSVRFAN-GSTARGATLSSN-EINTTYGFATTGDWATWADETHTVSL 176 567899*************************9.67***********.699999999999.66689********************* PP CBM35.hmm 97 kaGkntitiks..dwGwinldslel 119 aG+nti++++ G n+d++++ XOU89942.1|CBM35|PL10_1 177 AAGENTIQLSAltAGGLPNVDAITI 201 ************888999****986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (572 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 289.84 // Query: XOU85856.1|CBM35|PL10_1 [L=572] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-27 80.9 4.2 2.6e-26 79.4 4.2 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.4 4.2 1.3e-26 2.6e-26 11 119 .] 94 201 .. 83 201 .. 0.90 Alignments for each domain: == domain 1 score: 79.4 bits; conditional E-value: 1.3e-26 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtL 96 ++ +nh gysG+gfvd +a+g+++t++vdv ++G+Y++s+r+an +++++ +++ n + + ++ f +tg+w tw++ + tv+L XOU85856.1|CBM35|PL10_1 94 GEIVNNHEGYSGTGFVDTANAEGASITWKVDV-DGGNYDVSVRFAN-GSTARGATLSSN-EINTTYGFATTGDWATWADETHTVSL 176 567899*************************9.67***********.699999999999.66689********************* PP CBM35.hmm 97 kaGkntitiks..dwGwinldslel 119 aG+nti++++ G n+d++++ XOU85856.1|CBM35|PL10_1 177 AAGENTIQLSAltAGGLPNVDAITI 201 ************888999****986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (572 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 290.22 // Query: XQQ77752.1|CBM35|CE8|PL10_1 [L=1011] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-24 71.6 0.9 3.6e-23 69.3 0.9 2.3 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.3 0.9 1.8e-23 3.6e-23 12 118 .. 261 367 .. 253 368 .. 0.96 Alignments for each domain: == domain 1 score: 69.3 bits; conditional E-value: 1.8e-23 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagt 93 ++++nhagysGsgf++ + +g+a ++++d++ a s + +rYa+ ++++ + vnGt v ++ f+ +g+w+tw+ + XQQ77752.1|CBM35|CE8|PL10_1 261 TIDNNHAGYSGSGFINTDNVTGAAASYSIDADYAHSALVDIRYAS--TTSRPAAIEVNGTVVANAYFNGSGAWTTWSNESVA 340 689*****************************************9..7********************************** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldsle 118 v+L+aG+n i++ + G n+dsl+ XQQ77752.1|CBM35|CE8|PL10_1 341 VPLQAGNNRIRLVAqtAGGLPNIDSLT 367 **************9888999***996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1011 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 385.78 // Query: BCD98628.1|CBM35|PL1_2 [L=627] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-22 66.4 0.3 7.7e-22 65.0 0.3 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.0 0.3 3.9e-22 7.7e-22 11 119 .] 88 200 .. 81 200 .. 0.94 Alignments for each domain: == domain 1 score: 65.0 bits; conditional E-value: 3.9e-22 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs..evtfpstgnwdtwgtaagtvt 95 ++++t+h gy G g+ + +a g ++++ dv+++G +ls+rYang+ ++++ +++n + + ++fp+t+ w++w + +++ BCD98628.1|CBM35|PL1_2 88 AAIETEHDGYLGAGYANTQNAIGYGLSWRLDVEHSGVATLSIRYANGGDAARSALLSINSGVDGqyALNFPATAGWNDWLLETRNIQ 174 6799*******************************************************9998877889****************** PP CBM35.hmm 96 LkaGkntitiks..dwGwinldslel 119 L++G n it+ + G n+ds+++ BCD98628.1|CBM35|PL1_2 175 LQQGVNDITLLAntAAGLANIDSITV 200 **********998999********97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (627 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 299.75 // Query: XQQ77751.1|CBM35|PL1_5 [L=669] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-27 81.6 2.8 1.8e-26 79.9 2.8 2.1 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.9 2.8 9.2e-27 1.8e-26 12 118 .. 547 655 .. 517 656 .. 0.96 Alignments for each domain: == domain 1 score: 79.9 bits; conditional E-value: 9.2e-27 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaagtvtLk 97 +v+++h+g++G g+ + +a+g+ v ++v+vp+aG+Y+l++rYan +gs++ v vnG+++ ++++ stg+w+++ ++a+tv L+ XQQ77751.1|CBM35|PL1_5 547 AVESEHSGFTGAGYANTDNASGEGVDWSVTVPAAGNYSLKWRYAN-SGSDRPAAVLVNGGNQASLSMGSTGAWSSYsDSSAVTVWLN 632 589******************************************.8****************************98899******* PP CBM35.hmm 98 aGkntitiks..dwGwinldsle 118 G+n+i++++ ++G n+ds++ XQQ77751.1|CBM35|PL1_5 633 GGTNSIRLQAtgSSGLGNIDSMS 655 ********************987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (669 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 297.08 // Query: XOU72659.1|CBM35|PL1_11 [L=748] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-27 81.0 1.3 2.5e-26 79.4 1.3 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.4 1.3 1.3e-26 2.5e-26 9 119 .] 101 211 .. 96 211 .. 0.96 Alignments for each domain: == domain 1 score: 79.4 bits; conditional E-value: 1.3e-26 CBM35.hmm 9 tgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtv 94 t + v+ +h gy+Gsgf + ++ g+ +t++v v ++G Y++++rYa+ +st+ s++ n+ + ++tf+s+g w++w + ++t+ XOU72659.1|CBM35|PL1_11 101 TDLVVEDEHLGYTGSGFTNTDNDLGADITWQVSVAEQGFYDVTFRYAA--SSTRAGSLTANDIGAADYTFTSSGGWTSWLEETQTI 184 557899*****************************************9..6*********************************** PP CBM35.hmm 95 tLkaGkntitiks..dwGwinldslel 119 +L+ G+nt+ +++ d+G n+d++el XOU72659.1|CBM35|PL1_11 185 ELQTGTNTLVLTAtgDSGLPNIDYIEL 211 *************************97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (748 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 318.05 // Query: BCD99653.1|CBM35|CE12 [L=443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-25 75.4 0.1 9.1e-25 74.4 0.1 1.5 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 74.4 0.1 4.6e-25 9.1e-25 13 119 .] 78 185 .. 68 185 .. 0.95 Alignments for each domain: == domain 1 score: 74.4 bits; conditional E-value: 4.6e-25 CBM35.hmm 13 vntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGk 100 ++ +h+g++G+g+ + +a ++a+t++++ ++ G+Y+l +r+ang+++++t +++ G+++s + fp+ + w++w+t++ +v+L+aG+ BCD99653.1|CBM35|CE12 78 IEIDHTGFTGDGYANASNALNAALTWSIQLDEPGNYSLDIRFANGGATDRTATFTASGKSQS-LAFPAGSGWTDWQTQTLNVSLNAGN 164 7789*****************************************************99966.99*********************** PP CBM35.hmm 101 ntitiks..dwGwinldslel 119 + +t++ + G n+dsl++ BCD99653.1|CBM35|CE12 165 HLLTLTPqtSAGLANIDSLSI 185 *****9999*********975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (443 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 226.31 // Query: UII29534.1|CBM35|CBM60 [L=301] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-26 78.7 1.9 4.3e-26 78.7 1.9 2.4 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.2 0.1 0.062 0.12 63 86 .. 11 35 .. 4 39 .. 0.77 2 ! 78.7 1.9 2.2e-26 4.3e-26 12 118 .. 78 187 .. 68 188 .. 0.95 3 ? -2.5 0.0 0.32 0.64 40 60 .. 276 296 .. 267 299 .. 0.60 Alignments for each domain: == domain 1 score: -0.2 bits; conditional E-value: 0.062 CBM35.hmm 63 tlsvvvnGtkvs.evtfpstgnwdt 86 +vv+G v+ e ++++tg w++ UII29534.1|CBM35|CBM60 11 IDYIVVDGVTVQsEDQVTNTGVWQD 35 5679999998886788888898886 PP == domain 2 score: 78.7 bits; conditional E-value: 2.2e-26 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtwgtaagtvtLk 97 ++++n++gy+Gsgf + ++ g+ + ++v ++ ++Y++++rYang+g++++ ++ vnG+ + +v+fp+t++w++w+t++++v+L UII29534.1|CBM35|CBM60 78 AIESNNSGYTGSGFANTDNTIGSGINWSVSFNSLENYNFTWRYANGGGTDRSARLLVNGSVIAsSVSFPQTAEWTSWNTVTVNVSLP 164 4899********************************************************9988*********************** PP CBM35.hmm 98 aGkntitiks..dwGwinldsle 118 aG i++++ +G n+d +e UII29534.1|CBM35|CBM60 165 AGISDIRLEAtqASGLANIDFME 187 **********9999******887 PP == domain 3 score: -2.5 bits; conditional E-value: 0.32 CBM35.hmm 40 vdvpkaGsYelslrYangtgs 60 v +G Y +s++ ngt s UII29534.1|CBM35|CBM60 276 VSDYPSGIYIVSFTTENGTVS 296 444446677777777776555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (301 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 131.80 // Query: UZJ43643.1|CBM35|PL1_5 [L=652] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-32 98.1 3.7 4.1e-32 98.1 3.7 3.0 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.1 3.7 2.1e-32 4.1e-32 1 119 [] 180 301 .. 180 301 .. 0.97 2 ? -1.7 0.0 0.17 0.35 58 73 .. 375 390 .. 362 405 .. 0.77 3 ? -3.3 0.0 0.56 1.1 50 80 .. 436 467 .. 434 488 .. 0.46 4 ? -0.3 0.0 0.063 0.13 31 69 .. 602 640 .. 596 647 .. 0.87 Alignments for each domain: == domain 1 score: 98.1 bits; conditional E-value: 2.1e-32 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdt 86 yeAe+a + +nh+gysGsgfvd l++ ++++++ v+ ++Gs +l++rYangt++++ ++v+vnG+ + +v+f+ tg w++ UZJ43643.1|CBM35|PL1_5 180 YEAENALDYDGVIASNHSGYSGSGFVDLLNDGNSYIEWIVNQADSGSATLTFRYANGTTANRPMTVSVNGQVAHsSVDFEGTGGWSS 266 9*****999999**********************************************************98766************ PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldslel 119 w t+++tv+L aG+n i+ ++ ++G n+d++e+ UZJ43643.1|CBM35|PL1_5 267 WDTQTVTVSLAAGSNVIRADAtvSEGGPNFDYIEV 301 *********************************97 PP == domain 2 score: -1.7 bits; conditional E-value: 0.17 CBM35.hmm 58 tgstktlsvvvnGtkv 73 +++++ l+++v+Gt UZJ43643.1|CBM35|PL1_5 375 NKGSNPLTIYVDGTIT 390 4688899999999865 PP == domain 3 score: -3.3 bits; conditional E-value: 0.56 CBM35.hmm 50 lslrYangtgstktlsvvvnGtkvs....evtfps 80 +++rY n + ++++G +++ + tf + UZJ43643.1|CBM35|PL1_5 436 VTMRYVNI---GDKDHITIDGPSSNiwidHNTFYN 467 55566652...233455666555443333333333 PP == domain 4 score: -0.3 bits; conditional E-value: 0.063 CBM35.hmm 31 aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvn 69 ++gd v +v+++ sY+ ++Ya+ ++s+++ v n UZJ43643.1|CBM35|PL1_5 602 GSGDDVIAGPNVQSTVSYTPPYSYAALPASDAKGHVLAN 640 6789999999****************9999999888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (652 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 258.81 // Query: XOU74176.1|CBM2|CBM35|PL3_1 [L=511] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-30 93.2 2.2 1.4e-30 93.2 2.2 2.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.3 0.07 0.14 36 47 .. 38 49 .. 18 85 .. 0.61 2 ! 93.2 2.2 6.8e-31 1.4e-30 12 119 .] 170 277 .. 160 277 .. 0.97 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.07 CBM35.hmm 36 vtfnvdvpkaGs 47 t+nv+v+++Gs XOU74176.1|CBM2|CBM35|PL3_1 38 YTVNVNVTNTGS 49 222333333332 PP == domain 2 score: 93.2 bits; conditional E-value: 6.8e-31 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagt 93 s+++n++gy+Gsgf + +++g+av+++ +vp++G+Y l rYa+ ++t++ svvvnG++v++ +fpstg+w++w++ + XOU74176.1|CBM2|CBM35|PL3_1 170 SIDNNNSGYTGSGFANTENQNGSAVEYALNVPSNGNYLLDARYAS--ATTRSASVVVNGSSVGSFSFPSTGSWTSWTVDSAN 249 689*****************************************9..6********************************** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 v+Lk G+n ++i + ++G n+dsl++ XOU74176.1|CBM2|CBM35|PL3_1 250 VPLKGGNNIVRIVAtnSSGLPNIDSLKV 277 *************999**********97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (511 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 195.47 // Query: WYH48454.1|CBM2|CBM35|PL10_1 [L=630] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 94.5 4.8 5.3e-31 94.5 4.8 2.5 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.1 0.26 0.51 75 99 .. 73 97 .. 19 111 .. 0.58 2 ! 94.5 4.8 2.6e-31 5.3e-31 12 119 .] 186 295 .. 180 295 .. 0.98 3 ? -1.5 0.2 0.15 0.31 28 57 .. 386 415 .. 359 441 .. 0.70 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.26 CBM35.hmm 75 evtfpstgnwdtwgtaagtvtLkaG 99 ++++ ++gn +t + + +L aG WYH48454.1|CBM2|CBM35|PL10_1 73 NAELATNGNITTASNISWNGNLAAG 97 4555555555555555555555555 PP == domain 2 score: 94.5 bits; conditional E-value: 2.6e-31 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaag 92 s+++n++gy+G gf + +a+g+a++++v +p + sY+l +rYang+++ +t s+ vnG++ ++v+f++tg+w++w+++ + WYH48454.1|CBM2|CBM35|PL10_1 186 SIDNNNTGYTGAGFANTTNANGAAIRWSVASPYGSSYQLDWRYANGSSNPRTASIRVNGNNTGSVDFDTTGDWTSWTSSGV 266 689****************************************************************************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 v L++G+n+i++ s ++G n+dsl++ WYH48454.1|CBM2|CBM35|PL10_1 267 VVALEQGQNSIELVStnSEGLANIDSLTV 295 ****************9**********97 PP == domain 3 score: -1.5 bits; conditional E-value: 0.15 CBM35.hmm 28 glqaagdavtfnvdvpkaGsYelslrYang 57 ++ +++++++++ v ka +Y l+ +Y++g WYH48454.1|CBM2|CBM35|PL10_1 386 QVYQNTGQTKYRDAVRKAMDYLLEAQYSSG 415 444566667777777778888888888875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (630 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 221.01 // Query: XOU77672.1|CBM35|PL10_1 [L=572] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-27 80.9 4.2 2.6e-26 79.4 4.2 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.4 4.2 1.3e-26 2.6e-26 11 119 .] 94 201 .. 83 201 .. 0.90 Alignments for each domain: == domain 1 score: 79.4 bits; conditional E-value: 1.3e-26 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtL 96 ++ +nh gysG+gfvd +a+g+++t++vdv ++G+Y++s+r+an +++++ +++ n + + ++ f +tg+w tw++ + tv+L XOU77672.1|CBM35|PL10_1 94 GEIVNNHEGYSGTGFVDTANAEGASITWKVDV-DGGNYDVSVRFAN-GSTARGATLSSN-EINTTYGFATTGDWATWADETHTVSL 176 567899*************************9.67***********.699999999999.66689********************* PP CBM35.hmm 97 kaGkntitiks..dwGwinldslel 119 aG+nti++++ G n+d++++ XOU77672.1|CBM35|PL10_1 177 AAGENTIQLSAltAGGLPNVDAITI 201 ************888999****986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (572 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 294.77 // Query: XOU87840.1|CBM2|CBM35|PL10_1 [L=700] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-30 90.8 3.2 7.8e-30 90.8 3.2 2.7 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 1.6 0.11 0.22 46 78 .. 82 116 .. 46 143 .. 0.59 2 ? -0.7 1.0 0.088 0.18 11 65 .. 104 157 .. 90 184 .. 0.66 3 ! 90.8 3.2 3.9e-30 7.8e-30 12 119 .] 221 330 .. 213 330 .. 0.96 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.11 CBM35.hmm 46 GsYelslrYang..tgstktlsvvvnGtkvsevtf 78 + +l l+Y ++ +++ + sv+ nG+ v+ +++ XOU87840.1|CBM2|CBM35|PL10_1 82 SNWALALNYDQAaaITNSWNASVSANGNVVNATNI 116 34555566655533555666677777777765544 PP == domain 2 score: -0.7 bits; conditional E-value: 0.088 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktls 65 vs+n n + + g+ ++l aag++++f + + +G+ +l ++ +g++s+++ s XOU87840.1|CBM2|CBM35|PL10_1 104 VSANGNVVNATNIGWNGNL-AAGQSTSFGLQGTYTGNFSLPVCVGQGQSSSSSSS 157 4445555555555655555.77888888888888888888888888755555544 PP == domain 3 score: 90.8 bits; conditional E-value: 3.9e-30 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaag 92 s+++n++g++Gsgf + +a+g++v ++v vp +G+Y l++rYang+g+++ + vnG+++++ +fp+tg+w++w+ta XOU87840.1|CBM2|CBM35|PL10_1 221 SIDSNNSGFTGSGFANTDNATGKSVDWSVSVPYSGNYLLEWRYANGSGNNRAGAIEVNGNARGNQSFPTTGAWTSWTTASA 301 6899***************************************************************************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 +v+L+aG+n i++ + +G n+dsl++ XOU87840.1|CBM2|CBM35|PL10_1 302 NVSLDAGTNLISLVAstGEGLGNIDSLTV 330 ***************8888888****997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (700 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 116.05 // Query: XOU71589.1|CBM35|PL1_5 [L=772] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-27 82.2 3.3 3.5e-27 82.2 3.3 2.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.7 0.24 0.48 25 25 .. 503 503 .. 432 570 .. 0.63 2 ! 82.2 3.3 1.7e-27 3.5e-27 11 119 .] 651 761 .. 640 761 .. 0.94 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.24 CBM35.hmm 25 f 25 XOU71589.1|CBM35|PL1_5 503 T 503 1 PP == domain 2 score: 82.2 bits; conditional E-value: 1.7e-27 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaagtvtL 96 sv++n+agy+G+gfv+ +a+g+a ++ ++p+aG+Y+l++rYan ++s++ +v vn +++++ +f stg+w++w ++++ +++ XOU71589.1|CBM35|PL1_5 651 GSVDSNNAGYTGDGFVNTDNASGNAAVYAFNAPSAGMYTLQVRYAN-GSSARPGDVLVNAGNIGTFDFSSTGSWTSWaNSNELSAYF 736 469*******************************************.6*****************************99******** PP CBM35.hmm 97 kaGkntitiks..dwGwinldslel 119 +aG+nt++i++ + G nlds+++ XOU71589.1|CBM35|PL1_5 737 SAGNNTVRIQAtnSGGLPNLDSVSV 761 ************778888***9876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (772 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 137.20 // Query: UZJ44248.1|CBM35|PL10_1 [L=515] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-27 82.3 0.4 1.2e-26 80.5 0.1 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 80.5 0.1 5.8e-27 1.2e-26 12 119 .] 74 181 .. 67 181 .. 0.96 2 ? -1.2 0.1 0.12 0.25 31 80 .. 274 320 .. 255 333 .. 0.70 Alignments for each domain: == domain 1 score: 80.5 bits; conditional E-value: 5.8e-27 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLk 97 +v++++ g++G gf + +a+++a+t++++vp+aG +l++rYa+ +t+ ++ vnG+ +++ f +tg+w++w+t +tv+L+ UZJ44248.1|CBM35|PL10_1 74 TVDSDNEGFTGPGFANTDNAPDSAITYRITVPDAGHFALEVRYAS--LNTRPGDLHVNGAVAGTFGFATTGAWTSWTTESQTVELN 157 599*****************************************9..6************************************** PP CBM35.hmm 98 aGkntitiks..dwGwinldslel 119 aG+n+i++ + G n+dsl++ UZJ44248.1|CBM35|PL10_1 158 AGENSIALIAtsMDGLPNVDSLTV 181 ********999899********97 PP == domain 2 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 31 aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 +++++++++ v ka +Y l+ +Y++g + + G+++++vtf+ UZJ44248.1|CBM35|PL10_1 274 KDTGETRYRDAVRKAMDYLLEAQYSSG---GWPQYYPLRGGYSDHVTFND 320 555666666678888889999999985...44455555566666666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (515 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 243.72 // Query: UTF59950.1|CBM35|PL1_11|PL1_5 [L=1340] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-29 87.2 0.8 5.2e-28 84.9 0.8 2.3 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 84.9 0.8 2.6e-28 5.2e-28 12 119 .] 554 663 .. 544 663 .. 0.94 Alignments for each domain: == domain 1 score: 84.9 bits; conditional E-value: 2.6e-28 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gta 90 ++++nhag+ Gsgf + + +g+ + ++v+vp+aG+Yel++rYan +++++ +v vnG+ + ++++p+t++wd++ g+ UTF59950.1|CBM35|PL1_11|PL1_5 554 TIDSNHAGFAGSGFANTENVSGAGIDWSVEVPTAGTYELNWRYAN-GSDNRPGEVLVNGQTQASIDMPATNAWDDFtGSG 632 699******************************************.7*****************************99** PP CBM35.hmm 91 agtvtLkaGkntitiks..dwGwinldslel 119 ++ v+L+aG+n +++++ +G n+dsl++ UTF59950.1|CBM35|PL1_11|PL1_5 633 TVAVYLDAGYNELRLQAsgGSGLANIDSLSV 663 *****************9989999****986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1340 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 425.36 // Query: XOU84933.1|CBM35|PL1_11 [L=748] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-27 81.0 1.3 2.5e-26 79.4 1.3 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.4 1.3 1.3e-26 2.5e-26 9 119 .] 101 211 .. 96 211 .. 0.96 Alignments for each domain: == domain 1 score: 79.4 bits; conditional E-value: 1.3e-26 CBM35.hmm 9 tgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtv 94 t + v+ +h gy+Gsgf + ++ g+ +t++v v ++G Y++++rYa+ +st+ s++ n+ + ++tf+s+g w++w + ++t+ XOU84933.1|CBM35|PL1_11 101 TDLVVEDEHLGYTGSGFTNTDNDLGADITWQVSVAEQGFYDVTFRYAA--SSTRAGSLTANDIGAADYTFTSSGGWTSWLEETQTI 184 557899*****************************************9..6*********************************** PP CBM35.hmm 95 tLkaGkntitiks..dwGwinldslel 119 +L+ G+nt+ +++ d+G n+d++el XOU84933.1|CBM35|PL1_11 185 ELQTGTNTLVLTAtgDSGLPNIDYIEL 211 *************************97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (748 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 322.88 // Query: WYH51534.1|CBM35|CBM5|PL1_11|PL1_5 [L=1264] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-25 74.9 4.4 2.7e-24 72.9 4.4 2.2 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.9 4.4 1.4e-24 2.7e-24 12 119 .] 654 762 .. 643 762 .. 0.96 Alignments for each domain: == domain 1 score: 72.9 bits; conditional E-value: 1.4e-24 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 +v++n+ g++Gsgf + +a+g + ++++ ++GsY+l++rYang+ ++++ ++vnG +vs+ +f tg+w++ WYH51534.1|CBM35|CBM5|PL1_11|PL1_5 654 TVDSNNGGFTGSGFANTDNANGTGIDWTITG-DSGSYTLRWRYANGSDANRSAILSVNGVAVSTEDFVGTGSWTS 727 699***************************5.77***************************************** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldslel 119 w+t+ ++++L aG++ i++++ ++G n+d++e+ WYH51534.1|CBM35|CBM5|PL1_11|PL1_5 728 WATTSVQLNLGAGYKEIRLQAnqSSGLANIDYVEI 762 *********************99*********986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1264 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 419.75 // Query: XTP29387.1|CBM35|PL1_11|PL1_5 [L=1241] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-28 84.8 2.3 2.1e-27 82.9 2.3 2.1 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 82.9 2.3 1.1e-27 2.1e-27 12 119 .] 588 696 .. 578 696 .. 0.95 Alignments for each domain: == domain 1 score: 82.9 bits; conditional E-value: 1.1e-27 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaa 91 +++t+hag++G g+ + +a+g v+++v vp+aG+Y+l +r+an +g+++ +v vnG + +v ++ tg+w+ +++ XTP29387.1|CBM35|PL1_11|PL1_5 588 ALETEHAGFTGFGYANTENASGTGVEWSVVVPTAGTYTLDVRFAN-GGGDRPGTVLVNGVGQATVALNDTGAWNAYTSES 666 3799*****************************************.6********************************* PP CBM35.hmm 92 gtvtLkaGkntitiks..dwGwinldslel 119 +tvtL aG+n i++++ ++G n+dsl++ XTP29387.1|CBM35|PL1_11|PL1_5 667 VTVTLAAGYNDIRLQAtgSSGLANIDSLSV 696 ***************************986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1241 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 413.81 // Query: UUA71551.1|CBM35|PL1_11 [L=858] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-31 96.0 7.2 1.9e-31 96.0 7.2 2.2 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.1 0.44 0.87 37 55 .. 66 84 .. 30 110 .. 0.57 2 ! 96.0 7.2 9.5e-32 1.9e-31 1 119 [] 199 320 .. 199 320 .. 0.98 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.44 CBM35.hmm 37 tfnvdvpkaGsYelslrYa 55 + ++ + + ++s+++ UUA71551.1|CBM35|PL1_11 66 GTYTQASGTSNQRVSVKWG 84 3333444444444444443 PP == domain 2 score: 96.0 bits; conditional E-value: 9.5e-32 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwd 85 yeAe++sl++++v++nh+gy+Gsgfv+ + g++ +++v+ +aG+ ++++rYangt+s++ + ++vnGt ++ + f+ tg+w UUA71551.1|CBM35|PL1_11 199 YEAESGSLSQAAVESNHTGYNGSGFVNFDNLVGSSAQWTVNQASAGTATITFRYANGTTSNRAMAISVNGTVINsALAFNGTGAWA 284 9*************************99999****************************************9987899******** PP CBM35.hmm 86 twgtaagtvtLkaGkntitiks..dwGwinldslel 119 tw+t+ t++L+aG+n i+ s + G nld+l++ UUA71551.1|CBM35|PL1_11 285 TWATQSLTANLNAGSNVIRAVSttSDGGPNLDQLSV 320 **********************9**********986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (858 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 267.11 // Query: UFN57339.1|CBM35|CE8|PL10_1 [L=1014] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-25 75.5 0.5 4e-25 75.5 0.5 2.8 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.5 0.5 2e-25 4e-25 12 119 .] 263 370 .. 239 370 .. 0.96 2 ? -3.9 0.1 0.84 1.7 19 49 .. 378 408 .. 373 425 .. 0.60 3 ? -3.5 0.0 0.63 1.3 31 57 .. 845 871 .. 841 876 .. 0.79 Alignments for each domain: == domain 1 score: 75.5 bits; conditional E-value: 2e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagt 93 ++++nh g+ Gsgf + ++ g++v +++++++a s l +rYa+ +s++ ++ vnGt v++v +p+tg+w++w++ +t UFN57339.1|CBM35|CE8|PL10_1 263 TIDSNHEGFGGSGFANTDNKYGASVAYSINADHAHSALLDIRYAA--TSDRPADIEVNGTVVGTVYLPATGAWSSWNSENMT 342 689*****************************************9..7********************************** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 v+L+aG+n+i++ + ++G n+d++++ UFN57339.1|CBM35|CE8|PL10_1 343 VPLQAGENQIRLIAqtESGLPNIDAITV 370 ************99999*********97 PP == domain 2 score: -3.9 bits; conditional E-value: 0.84 CBM35.hmm 19 gysGsgfvdglqaagdavtfnvdvpkaGsYe 49 g G +v + ++ +++ ++v + +G+Y+ UFN57339.1|CBM35|CE8|PL10_1 378 GSCGAAVVMDCNDVTGQPAITVAQDGSGQYS 408 5566666666666666666666666666664 PP == domain 3 score: -3.5 bits; conditional E-value: 0.63 CBM35.hmm 31 aagdavtfnvdvpkaGsYelslrYang 57 ++gd+ +f+ +k+ +Y l+ +++++ UFN57339.1|CBM35|CE8|PL10_1 845 NSGDRAQFRAALDKGVEYILNAQWKQN 871 678899999999999999999999885 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1014 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 344.28 // Query: WYH43297.1|CBM2|CBM35|CE12 [L=688] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-50 155.3 20.0 1e-28 87.2 1.6 3.5 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.4 0.2 0.57 1.1 37 42 .. 63 68 .. 40 87 .. 0.53 2 ! 87.2 1.6 5.1e-29 1e-28 12 119 .] 184 293 .. 174 293 .. 0.96 3 ! 80.3 1.9 6.8e-27 1.4e-26 12 119 .] 338 449 .. 326 449 .. 0.95 4 ? -1.7 0.1 0.18 0.36 43 73 .. 530 558 .. 498 572 .. 0.64 Alignments for each domain: == domain 1 score: -3.4 bits; conditional E-value: 0.57 CBM35.hmm 37 tfnvdv 42 ++v+ WYH43297.1|CBM2|CBM35|CE12 63 NWQVQW 68 222322 PP == domain 2 score: 87.2 bits; conditional E-value: 5.1e-29 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaagt 93 ++++n+agy+Gsgf + +aag+ ++++v + ++GsY++++rYang+++++ +v+vnG+ + + f+st +w+tw ++a++ WYH43297.1|CBM2|CBM35|CE12 184 TIDSNNAGYTGSGFANTENAAGKGIEWAVAA-QGGSYQMQWRYANGSSANRPGDVFVNGALQTSSAFDSTRDWTTWaDSSAVS 265 6899*************************97.78******************************************8899*** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 ++L G nti++++ ++G n+dsl++ WYH43297.1|CBM2|CBM35|CE12 266 INLADGINTIRLQAssSEGLANIDSLSV 293 **************99*********986 PP == domain 3 score: 80.3 bits; conditional E-value: 6.8e-27 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvv.nGtkvs.evtfpstgnwdtwgtaag 92 svn+n ag++G gf + +a + +v ++vd+ +aG Y+l lr+ang+g++++ ++v G++vs ++tf +tg+w+tw+t WYH43297.1|CBM2|CBM35|CE12 338 SVNSNEAGFTGGGFANTTNAVNTSVDWAVDAATAGYYDLALRFANGSGAARSGVLTVtSGASVSyDITFATTGAWSTWATEIL 420 69******************************************************978999999****************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 + L+aG+n it+++ d+G n+d+l+l WYH43297.1|CBM2|CBM35|CE12 421 PIFLNAGENLITLTAtgDSGLANIDYLSL 449 **************************986 PP == domain 4 score: -1.7 bits; conditional E-value: 0.18 CBM35.hmm 43 pkaGsYelslrYangtgstktlsvvvnGtkv 73 ++G+Y l l++ + + s++t + v++G + WYH43297.1|CBM2|CBM35|CE12 530 ASTGDYLL-LQFGT-NDSHRTATYVIDGVTI 558 45666644.44444.4677888888887665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (688 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 122.83 // Query: BCD99654.1|CBM35|CE12 [L=529] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-27 81.4 4.1 4.8e-26 78.5 0.2 3.2 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 78.5 0.2 2.4e-26 4.8e-26 12 119 .] 98 207 .. 91 207 .. 0.97 2 ? 0.2 0.1 0.045 0.091 11 56 .. 240 285 .. 234 304 .. 0.64 3 ? 1.6 0.0 0.017 0.034 45 88 .. 373 414 .. 368 420 .. 0.72 Alignments for each domain: == domain 1 score: 78.5 bits; conditional E-value: 2.4e-26 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaG 99 v+++h g+ G g+ + ++ g+av ++v v + G+++++lrYa g+++++ +++vnG++ +++++pst++wd+w+++++++ L G BCD99654.1|CBM35|CE12 98 IVEADHDGFVGAGYANANNEIGAAVVWHVRVLTPGQHTFTLRYAYGGAGARDGEISVNGQAMETLSLPSTQAWDNWQEQTINLDLAYG 185 4899************************************************************************************ PP CBM35.hmm 100 kntitiks..dwGwinldslel 119 nti++ + G n+dsl++ BCD99654.1|CBM35|CE12 186 GNTIRYAAtgAGGLANIDSLTI 207 ********9999999****986 PP == domain 2 score: 0.2 bits; conditional E-value: 0.045 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYan 56 +++++ +++ sG+ + g ++g+ ++n + ++aG+Y ++l+ BCD99654.1|CBM35|CE12 240 ATFDAGASEVSGYDWDFGDGSQGSGESVNHTFNDAGEYIVTLTVTD 285 5566666666666555444455555556666679999999888665 PP == domain 3 score: 1.6 bits; conditional E-value: 0.017 CBM35.hmm 45 aGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.g 88 aG+Y l n ++++ + +nG+++ + ++ ++++tw + BCD99654.1|CBM35|CE12 373 AGDYLLVQFGTN--DGHRSATYQINGQQIPYY-LDPATSFKTWlQ 414 677766544444..799**********99855.555558999843 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (529 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 226.87 // Query: BCE00372.1|CBM35 [L=996] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-27 82.4 18.5 1.2e-26 80.5 0.5 5.7 8 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.0 0.16 0.31 81 111 .. 76 106 .. 64 108 .. 0.74 2 ! 3.4 0.0 0.0046 0.0093 49 90 .. 138 178 .. 118 186 .. 0.78 3 ? -2.2 0.1 0.26 0.52 46 70 .. 266 290 .. 254 315 .. 0.61 4 ? -1.2 0.1 0.12 0.24 55 74 .. 377 396 .. 343 421 .. 0.62 5 ? -1.0 0.2 0.11 0.21 61 79 .. 383 401 .. 362 457 .. 0.55 6 ? 1.8 0.5 0.015 0.03 44 111 .. 431 496 .. 395 508 .. 0.77 7 ! 7.0 0.3 0.00037 0.00073 12 118 .. 475 586 .. 467 587 .. 0.74 8 ! 80.5 0.5 5.8e-27 1.2e-26 12 117 .. 615 722 .. 608 724 .. 0.96 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.16 CBM35.hmm 81 tgnwdtwgtaagtvtLkaGkntitiksdwGw 111 +++ +t +t+ + + G++ +++k + G BCE00372.1|CBM35 76 NASTKTTQTSSLVYEFSPGEHIVSLKVSDGS 106 3344555888999999999999999998875 PP == domain 2 score: 3.4 bits; conditional E-value: 0.0046 CBM35.hmm 49 elslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgta 90 el++ ++ ++g++ t++ +vn+++v+++ + ++++ g++ BCE00372.1|CBM35 138 ELEIEFSDSDGDQVTVEWFVNDQSVGTAPAFNH-DFSQAGDY 178 7899999999***************98776665.45555555 PP == domain 3 score: -2.2 bits; conditional E-value: 0.26 CBM35.hmm 46 GsYelslrYangtgstktlsvvvnG 70 G++e++l+ ++++ s+++++ +vn BCE00372.1|CBM35 266 GNHEVKLTVMHQSVSSQVKTQSVNI 290 5666666666654444444444442 PP == domain 4 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 55 angtgstktlsvvvnGtkvs 74 +++++ t++ ++ +nGt+vs BCE00372.1|CBM35 377 SQNNAPTANFTFEINGTEVS 396 33345555666666666655 PP == domain 5 score: -1.0 bits; conditional E-value: 0.11 CBM35.hmm 61 tktlsvvvnGtkvsevtfp 79 t++ ++ +nGt+vs v+ BCE00372.1|CBM35 383 TANFTFEINGTEVSFVNTS 401 4444444444444422222 PP == domain 6 score: 1.8 bits; conditional E-value: 0.015 CBM35.hmm 44 kaGsYelslrYang.tgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitiksdwGw 111 + G Ye++l+ + + t+++++ v ++f+ + +t++ ++++v+L G+ + + + G+ BCE00372.1|CBM35 431 APGPYEVELTVTDNeHTVFTTKTITIQEVMVPITSFKVEA--ETFSNTDMDVQLVDGDTVVGYFN-GGN 496 5688999999887735556788999999999999999983..44456999*******99998875.444 PP == domain 7 score: 7.0 bits; conditional E-value: 0.00037 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYangtgstktlsvvv...nGtkvsevtfpstgnwdtwgtaagtvtLka.G 99 +++ + + +G+++v+++ + g+++ ++ v+ ++ ++ ++Ya+ + +++ ++ + nG ++ + tg+w+ + ++ ++ +a G BCE00372.1|CBM35 475 NTDMDVQLVDGDTVVGYF-NGGNYLLYEsVN--LTDIKSIHINYAT-PLENAFIEIRMdelNGPLLALLKADVTGEWSVYVDKSADLLINAtG 563 45667778899****999.444454444355..57899********.899999999984446666669999999*****77777777777659 PP CBM35.hmm 100 knt...itiksdwGwi.nldsle 118 ++ i i++ +G++ nld+le BCE00372.1|CBM35 564 NHDvyvIGIQDAEGYVaNLDYLE 586 996222566669***99***996 PP == domain 8 score: 80.5 bits; conditional E-value: 5.8e-27 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntit 104 sv+ +h gy+Gsgf++ ++ g++v ++++v++aG Yel +r+ang++ +++ ++vn + + vt++ t++w+ w+ ++v L+aG+n it BCE00372.1|CBM35 615 SVDLDHDGYTGSGFINVDNELGASVVWHINVTQAGVYELDTRFANGGTVARSGLLSVNEKGEQLVTLEPTSSWSVWSNEGIKVALEAGENIIT 707 6899***************************************************************************************** PP CBM35.hmm 105 iks..dwGwinldsl 117 +ks +G n+d+l BCE00372.1|CBM35 708 FKSnsAEGLANIDKL 722 ***9999******98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (996 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 74.32 // Query: XOU83752.1|CBM2|CBM35|PL10_1 [L=700] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-30 90.8 3.2 7.8e-30 90.8 3.2 2.7 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 1.6 0.11 0.22 46 78 .. 82 116 .. 46 143 .. 0.59 2 ? -0.7 1.0 0.088 0.18 11 65 .. 104 157 .. 90 184 .. 0.66 3 ! 90.8 3.2 3.9e-30 7.8e-30 12 119 .] 221 330 .. 213 330 .. 0.96 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.11 CBM35.hmm 46 GsYelslrYang..tgstktlsvvvnGtkvsevtf 78 + +l l+Y ++ +++ + sv+ nG+ v+ +++ XOU83752.1|CBM2|CBM35|PL10_1 82 SNWALALNYDQAaaITNSWNASVSANGNVVNATNI 116 34555566655533555666677777777765544 PP == domain 2 score: -0.7 bits; conditional E-value: 0.088 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktls 65 vs+n n + + g+ ++l aag++++f + + +G+ +l ++ +g++s+++ s XOU83752.1|CBM2|CBM35|PL10_1 104 VSANGNVVNATNIGWNGNL-AAGQSTSFGLQGTYTGNFSLPVCVGQGQSSSSSSS 157 4445555555555655555.77888888888888888888888888755555544 PP == domain 3 score: 90.8 bits; conditional E-value: 3.9e-30 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaag 92 s+++n++g++Gsgf + +a+g++v ++v vp +G+Y l++rYang+g+++ + vnG+++++ +fp+tg+w++w+ta XOU83752.1|CBM2|CBM35|PL10_1 221 SIDSNNSGFTGSGFANTDNATGKSVDWSVSVPYSGNYLLEWRYANGSGNNRAGAIEVNGNARGNQSFPTTGAWTSWTTASA 301 6899***************************************************************************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 +v+L+aG+n i++ + +G n+dsl++ XOU83752.1|CBM2|CBM35|PL10_1 302 NVSLDAGTNLISLVAstGEGLGNIDSLTV 330 ***************8888888****997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (700 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 109.31 // Query: WOX07061.1|CBM35|PL1_11|PL1_5 [L=1238] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-27 83.5 1.7 1.4e-27 83.5 1.7 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.12 0.24 44 86 .. 451 492 .. 426 498 .. 0.67 2 ! 83.5 1.7 7.1e-28 1.4e-27 11 119 .] 584 693 .. 574 693 .. 0.93 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.12 CBM35.hmm 44 kaGsYelslrYangtgstktlsvvv..nGtkvsevtfpstgnwdt 86 +a ++s+++++ +t+ ++v++ nG+ v++ + ++++ ++ WOX07061.1|CBM35|PL1_11|PL1_5 451 SASGERISIKWSS---ATSFNTVIIreNGNVVQNWRLVNNDTGEE 492 4445578999999...35555555555999999999988877665 PP == domain 2 score: 83.5 bits; conditional E-value: 7.1e-28 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgta 90 +++t+h+gy+G g+ + +a+g v ++v vp+aG Y+l++rYan +++++ +v vnG+++ ++ + ++g w++++t WOX07061.1|CBM35|PL1_11|PL1_5 584 GALETEHSGYTGFGYANTENASGTGVDWSVVVPAAGVYTLEFRYAN-GSGDRPADVLVNGASATSIAMGESGGWTSYTTG 662 4589******************************************.6******************************** PP CBM35.hmm 91 agtvtLkaGkntitiks..dwGwinldslel 119 ++vtL+aG+n i++++ +G n+dsl++ WOX07061.1|CBM35|PL1_11|PL1_5 663 SVSVTLSAGYNEIRLQAtsGNGLANIDSLSV 693 *****************9999999****986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1238 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 326.85 // Query: WYH43298.1|CBM2|CBM35|CE12 [L=680] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-48 150.5 14.6 2.1e-27 82.9 3.3 3.3 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.9 0.2 0.097 0.19 37 60 .. 39 62 .. 12 89 .. 0.65 2 ! 74.3 0.2 5e-25 1e-24 12 119 .] 152 261 .. 142 261 .. 0.95 3 ! 82.9 3.3 1.1e-27 2.1e-27 11 119 .] 313 425 .. 303 425 .. 0.95 Alignments for each domain: == domain 1 score: -0.9 bits; conditional E-value: 0.097 CBM35.hmm 37 tfnvdvpkaGsYelslrYangtgs 60 ++v+ +++Gs +++ + + ++ WYH43298.1|CBM2|CBM35|CE12 39 DWQVKWQQNGSSTVTSIWNATYSG 62 466777888888887777774333 PP == domain 2 score: 74.3 bits; conditional E-value: 5e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaagt 93 s+++n++g+ G gf + +a g+ ++++v ++G+Y+l++rYang+++++ +v++nG+ + +++fp+t++w+ w ++ + WYH43298.1|CBM2|CBM35|CE12 152 SIDNNNPGFGGAGFANTDNALGSGIEWAVA-SAGGNYDLQWRYANGSTANRPGKVFINGSHQADLDFPTTSEWTIWnNSMLVP 233 689**************************8.599******************************************888889* PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 v+L+ G n +++++ +G n+d+l++ WYH43298.1|CBM2|CBM35|CE12 234 VSLESGINIVRLEAieTTGLANIDALSV 261 ************************9986 PP == domain 3 score: 82.9 bits; conditional E-value: 1.1e-27 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs..evtfpstgnwdtwgtaa 91 ++++n+ g++G+gf + ++ g+av+++v+v +aG+Y+l lrYang+gs++ + vn+++++ +++++ tg+w+ w + WYH43298.1|CBM2|CBM35|CE12 313 GTIDNNNDGFTGDGFANTGNNLGSAVSWSVQVATAGTYQLALRYANGGGSARPGVLAVNDSSSGtyDINLTDTGSWNIWDIET 395 4699************************************************************778888999********** PP CBM35.hmm 92 gtvtLkaGkntitiks..dwGwinldslel 119 +v L++G+nt+++++ ++G n+d+le+ WYH43298.1|CBM2|CBM35|CE12 396 LSVFLNEGTNTLRLTAtsESGLANIDYLEV 425 ***************9999*********97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (680 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 111.31 // Query: BCE03174.1|CBM35|PL1_5 [L=578] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.9 1.0 1.1e-14 41.9 1.0 3.2 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 41.9 1.0 5.3e-15 1.1e-14 10 119 .] 82 191 .. 77 191 .. 0.84 2 ? -2.3 0.3 0.27 0.54 66 85 .. 218 237 .. 208 257 .. 0.56 3 ? -1.8 0.0 0.19 0.38 96 111 .. 401 421 .. 365 424 .. 0.68 4 ? -0.4 0.1 0.071 0.14 86 107 .. 521 542 .. 499 561 .. 0.64 Alignments for each domain: == domain 1 score: 41.9 bits; conditional E-value: 5.3e-15 CBM35.hmm 10 gvsvntnhagysGsgfvdglqaagdavtfnvdv.pkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvt 95 ++++++ hag++Gsg + +a g+ + +n + +++ + +l++rYan+ g+t +++ v G + ++fp tg+w +w + +++v+ BCE03174.1|CBM35|PL1_5 82 NIEIESFHAGFEGSGALNATNAVGSGIGWNFYSsKADSEATLTIRYANN-GGT-SRTAVATGVS-HIIEFPDTGAWVNWVEIEVSVS 165 5788999***********************65516667889*******6.333.3344444544.569******************* PP CBM35.hmm 96 LkaGkntitiks..dwGwinldslel 119 +G++++++ s +G n+d+++l BCE03174.1|CBM35|PL1_5 166 IVEGTQQFELISdnINGLSNIDYITL 191 **********998778********97 PP == domain 2 score: -2.3 bits; conditional E-value: 0.27 CBM35.hmm 66 vvvnGtkvsevtfpstgnwd 85 v++t+ ++ t +st++ + BCE03174.1|CBM35|PL1_5 218 TEVDNTDTQTSTQTSTDTNT 237 34555555555555553222 PP == domain 3 score: -1.8 bits; conditional E-value: 0.19 CBM35.hmm 96 LkaGkntitiks.....dwGw 111 k G++ it+++ +wG+ BCE03174.1|CBM35|PL1_5 401 SKSGAHHITVSYnyfhdSWGA 421 478899998888777777776 PP == domain 4 score: -0.4 bits; conditional E-value: 0.071 CBM35.hmm 86 twgtaagtvtLkaGkntitiks 107 tw+ + L+ G n +t ++ BCE03174.1|CBM35|PL1_5 521 TWSNETDAQRLNGGPNVVTTGN 542 4444666667777777777655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (578 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 228.54 // Query: WYH51488.1|CBM2|CBM35|CE12 [L=680] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-47 147.1 11.8 2.7e-26 79.4 2.1 3.0 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.2 0.33 0.66 38 56 .. 40 58 .. 22 75 .. 0.58 2 ! 73.8 0.2 7e-25 1.4e-24 12 119 .] 152 261 .. 142 261 .. 0.94 3 ! 79.4 2.1 1.3e-26 2.7e-26 12 119 .] 314 425 .. 304 425 .. 0.95 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.33 CBM35.hmm 38 fnvdvpkaGsYelslrYan 56 ++v+ +++Gs +++ + + WYH51488.1|CBM2|CBM35|CE12 40 WQVKWQQNGSSTVTSLWNA 58 4455555555555554444 PP == domain 2 score: 73.8 bits; conditional E-value: 7e-25 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaagt 93 s+++n+ g+sG+gf + +a g+ ++++v + +G+Y+l++rYang+ +++ ++++nG ++ +++fp+t++w+ w + + WYH51488.1|CBM2|CBM35|CE12 152 SIDNNNLGFSGDGFANTDNAVGSGIEWAVAA-VGGNYDLQWRYANGSIANRPGKIFINGVNQADLDFPATSEWTIWnDSMLVP 233 689**************************97.89******************************************5556689 PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 v+L+ G n +++++ +G n+d+l++ WYH51488.1|CBM2|CBM35|CE12 234 VNLESGINIVRLEAieTTGLANIDALSV 261 ************************9986 PP == domain 3 score: 79.4 bits; conditional E-value: 1.3e-26 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs..evtfpstgnwdtwgtaag 92 ++++n+ g++G+gf + ++ g+av ++v+v +aG+Y l lrYang+gs++ + vn+++++ ++++ tg+w+tw+ + WYH51488.1|CBM2|CBM35|CE12 314 TIDNNNDGFTGDGFANTGNNLGSAVNWSVQVGTAGTYLLALRYANGGGSARPGVLAVNDSSSGtyDINLIDTGSWNTWAIETL 396 699************************************************************77778889************ PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 v L++G+nt+++++ ++G n+d+le+ WYH51488.1|CBM2|CBM35|CE12 397 PVFLDEGTNTLRLTAtsESGLANIDYLEV 425 **************9999*********97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (680 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 191.35 // Query: XBL14576.1|CBM35|CBM60|PL1 [L=919] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-25 77.0 8.7 1.4e-25 77.0 8.7 5.5 7 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.3 0.0 0.56 1.1 99 115 .. 197 213 .. 195 214 .. 0.82 2 ? -4.2 1.1 1 2 16 57 .. 229 275 .. 224 289 .. 0.57 3 ? -2.1 2.3 0.24 0.48 32 86 .. 358 412 .. 348 424 .. 0.71 4 ? -1.1 0.1 0.11 0.23 19 47 .. 520 548 .. 505 570 .. 0.71 5 ? 0.3 0.2 0.044 0.088 49 84 .. 574 610 .. 537 623 .. 0.69 6 ? 1.6 0.1 0.016 0.033 38 81 .. 635 678 .. 612 691 .. 0.75 7 ! 77.0 8.7 6.9e-26 1.4e-25 11 118 .. 698 809 .. 687 810 .. 0.94 Alignments for each domain: == domain 1 score: -3.3 bits; conditional E-value: 0.56 CBM35.hmm 99 GkntitiksdwGwinld 115 G+n++t+ ++w + ++d XBL14576.1|CBM35|CBM60|PL1 197 GNNKVTYHHNWFAEKVD 213 99*****9999776666 PP == domain 2 score: -4.2 bits; conditional E-value: 1 CBM35.hmm 16 nhagysGsgfvdglqaagdavt....fn.vdvpkaGsYelslrYang 57 n+ G+g+ g+ + g+a+ f+ v+ p++ +Y++ + ++ XBL14576.1|CBM35|CBM60|PL1 229 NYYTAAGNGYCIGVGSYGAALIqnnyFKnVNNPHQFMYDVYCHINAN 275 55566677777666666666331111223777777777776665443 PP == domain 3 score: -2.1 bits; conditional E-value: 0.24 CBM35.hmm 32 agdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 ++ +++ nv+ +a + ++++ n + ++ + vv G ++++t+++t++ + XBL14576.1|CBM35|CBM60|PL1 358 SNTSLSANVTPSNATNKMVNWTSTNPSVASINSAGVVTGVTIGSTTITATTQDGG 412 5667777888888888888888888777777777888888888888887755444 PP == domain 4 score: -1.1 bits; conditional E-value: 0.11 CBM35.hmm 19 gysGsgfvdglqaagdavtfnvdvpkaGs 47 + + +g++++ +++ +t++ +++++G+ XBL14576.1|CBM35|CBM60|PL1 520 NLDCNGYIEYTVSSNPGITYALTATTNGQ 548 44556777777777777777777777765 PP == domain 5 score: 0.3 bits; conditional E-value: 0.044 CBM35.hmm 49 elslrYang.tgstktlsvvvnGtkvsevtfpstgnw 84 + +++ + +gs++ l+v++n +k +++f++ ++ XBL14576.1|CBM35|CBM60|PL1 574 WMFSSWSGDaSGSSNPLTVTMNSDKTITANFTQLPSF 610 455556655578999999****999999999988766 PP == domain 6 score: 1.6 bits; conditional E-value: 0.016 CBM35.hmm 38 fnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst 81 +n +++ a Y++ ++gs++ l+++++G+k+ +++f + XBL14576.1|CBM35|CBM60|PL1 635 VNLTATPASGYQFDNWSGDASGSSNPLTITMDGNKAVTANFSEV 678 44555556667777666666899999*********999999775 PP == domain 7 score: 77.0 bits; conditional E-value: 6.9e-26 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfpstgnwdtw.gtaa 91 +v++n+ g++Gsgf + +a+g+ +t++v+v +aG Y++ +rYang+++++t +v+ nG +v +v++p+tg+w+tw +t+a XBL14576.1|CBM35|CBM60|PL1 698 GTVDSNNGGFTGSGFANTDNANGKGITWSVNVAAAGIYSMVWRYANGGSTNRTAQVMANGVSVVsSVSMPATGSWTTWtETSA 780 4699********************************************************99876*************999** PP CBM35.hmm 92 gtvtLkaGkntitiks..dwGwinldsle 118 ++v+L+aG+ +++++ ++G n+d+++ XBL14576.1|CBM35|CBM60|PL1 781 VNVSLTAGTTLLRLQAtnSSGLANIDYVN 809 ****************99********986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (919 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 53.37 // Query: BFW49140.1|CBM35|PL1_2 [L=1058] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-21 62.3 0.7 5e-21 62.3 0.7 2.9 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.7 0.1 0.36 0.72 31 70 .. 41 80 .. 28 94 .. 0.76 2 ? -0.8 0.2 0.096 0.19 44 84 .. 606 648 .. 603 659 .. 0.69 3 ! 62.3 0.7 2.5e-21 5e-21 2 119 .] 691 809 .. 690 809 .. 0.93 Alignments for each domain: == domain 1 score: -2.7 bits; conditional E-value: 0.36 CBM35.hmm 31 aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnG 70 + g+ v + + +++G +l++ +n+++s +t + v G BFW49140.1|CBM35|PL1_2 41 GRGGDVYIVTNLNSSGAGSLNYGVQNAPASGRTIVFAVSG 80 5677777777888888888999999988888887777665 PP == domain 2 score: -0.8 bits; conditional E-value: 0.096 CBM35.hmm 44 kaGsYelslrYang..tgstktlsvvvnGtkvsevtfpstgnw 84 ++G+ ++sl++ ++ gs+++++ +v G+ +++ p+ ++ BFW49140.1|CBM35|PL1_2 606 STGNSQISLSWTAAsgAGSYRVKRATVSGGPYATISSPTGITY 648 5666666666655444888999999999998888887776554 PP == domain 3 score: 62.3 bits; conditional E-value: 2.5e-21 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw 87 +Ae++ ++g ++++n+ag++G+gf + aag++++f+ + ++G +l +r+a + +++t ++vvnG ++s +tfp+t++w+tw BFW49140.1|CBM35|PL1_2 691 QAESGAISGGTFDSNNAGFNGTGFANLALAAGSYLQFTnLNGGSGGPATLVIRFAL-GNTARTGNLVVNGVSQS-ITFPTTTTWTTW 775 7*************************999********99*****************.6************9966.************ PP CBM35.hmm 88 gtaagtvtLkaGk.ntitiks.dwGwinldslel 119 t +v+L+aG+ nt++++s n+d+l++ BFW49140.1|CBM35|PL1_2 776 ITLSLSVPLNAGStNTLRFEStGADLANIDELTI 809 ************659*****84444569999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1058 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 287.66 // Query: WYH51489.1|CBM2|CBM35|CE12 [L=688] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-51 158.8 21.9 2.7e-29 89.0 2.0 3.5 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.3 0.2 0.56 1.1 37 42 .. 63 68 .. 40 88 .. 0.53 2 ! 89.0 2.0 1.4e-29 2.7e-29 12 119 .] 184 293 .. 174 293 .. 0.96 3 ! 81.8 3.6 2.4e-27 4.8e-27 12 119 .] 338 449 .. 324 449 .. 0.95 4 ? -1.7 0.1 0.18 0.35 44 72 .. 531 557 .. 496 571 .. 0.62 Alignments for each domain: == domain 1 score: -3.3 bits; conditional E-value: 0.56 CBM35.hmm 37 tfnvdv 42 ++v+ WYH51489.1|CBM2|CBM35|CE12 63 NWQVQW 68 222333 PP == domain 2 score: 89.0 bits; conditional E-value: 1.4e-29 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaagt 93 ++++n+agy+Gsgf + +aag+ v+++v + ++GsY++++rYang+++++ +v+vnG+ + + f stg+w+tw ++a++ WYH51489.1|CBM2|CBM35|CE12 184 TIDSNNAGYTGSGFANTENAAGKGVEWSVAA-QGGSYQMQWRYANGSSADRPGDVFVNGALQTNSAFGSTGDWTTWaDSSAVS 265 6899*************************97.78******************************************8899*** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 ++L aG nti++++ ++G n+dsl++ WYH51489.1|CBM2|CBM35|CE12 266 INLAAGINTIRLQAssSEGLANIDSLRV 293 **************99*********986 PP == domain 3 score: 81.8 bits; conditional E-value: 2.4e-27 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvv.nGtkvs.evtfpstgnwdtwgtaag 92 svn+n ag++G gf + +a + +v ++vdv++aG Y+l+lr+ang+g+++ ++v G++vs ++tf +t++w+tw+t + WYH51489.1|CBM2|CBM35|CE12 338 SVNNNEAGFTGGGFANTTNAVNTSVNWAVDVTTAGYYDLTLRFANGSGAARPGVLTVtSGASVSyDITFATTSAWSTWATEIM 420 79*******************************************************78999999****************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 + L+aG+n it+++ d+G n+d+l+l WYH51489.1|CBM2|CBM35|CE12 421 PIFLNAGENVITLTAtgDSGLANIDYLSL 449 **************************986 PP == domain 4 score: -1.7 bits; conditional E-value: 0.18 CBM35.hmm 44 kaGsYelslrYangtgstktlsvvvnGtk 72 ++G+Y l l++ + + s++t + v++G WYH51489.1|CBM2|CBM35|CE12 531 STGDYLL-LQFGT-NDSHRTATYVIDGVT 557 4566644.34444.357777777777765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (688 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 184.21 // Query: XOU86449.1|CBM2|CBM35|PL1_2 [L=769] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-26 80.1 2.6 1.5e-26 80.1 2.6 3.4 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.0 0.2 0.051 0.1 15 60 .. 39 85 .. 29 121 .. 0.71 2 ! 80.1 2.6 7.7e-27 1.5e-26 12 119 .] 194 302 .. 186 302 .. 0.96 3 ? -3.2 0.1 0.53 1.1 13 30 .. 539 556 .. 534 567 .. 0.72 Alignments for each domain: == domain 1 score: 0.0 bits; conditional E-value: 0.051 CBM35.hmm 15 tnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgs 60 tn++g +g+v + +++ + ++v+ + aG+ ++s ++ ++ ++ XOU86449.1|CBM2|CBM35|PL1_2 39 TNQWGSAFTGNVRITNsGNTPTNDWAVNWQYAGDNRISNSWGAQLSG 85 56666666666643331333346788999999999888888776444 PP == domain 2 score: 80.1 bits; conditional E-value: 7.7e-27 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagt 93 s+++n+ g++G+gf + + +g+++ ++v+v+ +G Y+l++rYang+g+++t sv+ nG++ se++fp+tg+wd+w +t XOU86449.1|CBM2|CBM35|PL1_2 194 SIDSNNGGFTGTGFANTDNVNGSQINWKVNVDFDGYYALEWRYANGSGTARTASVSANGAQ-SEISFPTTGSWDSWLLDSTT 274 6899******************************************************987.88****************** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 + LkaG n + +++ ++G n+dsl++ XOU86449.1|CBM2|CBM35|PL1_2 275 LFLKAGVNDVILSAntSSGLANIDSLTV 302 ************9999**********97 PP == domain 3 score: -3.2 bits; conditional E-value: 0.53 CBM35.hmm 13 vntnhagysGsgfvdglq 30 v n + sGsg+ d+ + XOU86449.1|CBM2|CBM35|PL1_2 539 VARNVRFASGSGYTDYRN 556 566777778888877654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (769 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 207.86 // Query: XOU78264.1|CBM2|CBM35|PL1_2 [L=769] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-26 80.1 2.6 1.5e-26 80.1 2.6 3.4 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.0 0.2 0.051 0.1 15 60 .. 39 85 .. 29 121 .. 0.71 2 ! 80.1 2.6 7.7e-27 1.5e-26 12 119 .] 194 302 .. 186 302 .. 0.96 3 ? -3.2 0.1 0.53 1.1 13 30 .. 539 556 .. 534 567 .. 0.72 Alignments for each domain: == domain 1 score: 0.0 bits; conditional E-value: 0.051 CBM35.hmm 15 tnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgs 60 tn++g +g+v + +++ + ++v+ + aG+ ++s ++ ++ ++ XOU78264.1|CBM2|CBM35|PL1_2 39 TNQWGSAFTGNVRITNsGNTPTNDWAVNWQYAGDNRISNSWGAQLSG 85 56666666666643331333346788999999999888888776444 PP == domain 2 score: 80.1 bits; conditional E-value: 7.7e-27 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagt 93 s+++n+ g++G+gf + + +g+++ ++v+v+ +G Y+l++rYang+g+++t sv+ nG++ se++fp+tg+wd+w +t XOU78264.1|CBM2|CBM35|PL1_2 194 SIDSNNGGFTGTGFANTDNVNGSQINWKVNVDFDGYYALEWRYANGSGTARTASVSANGAQ-SEISFPTTGSWDSWLLDSTT 274 6899******************************************************987.88****************** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 + LkaG n + +++ ++G n+dsl++ XOU78264.1|CBM2|CBM35|PL1_2 275 LFLKAGVNDVILSAntSSGLANIDSLTV 302 ************9999**********97 PP == domain 3 score: -3.2 bits; conditional E-value: 0.53 CBM35.hmm 13 vntnhagysGsgfvdglq 30 v n + sGsg+ d+ + XOU78264.1|CBM2|CBM35|PL1_2 539 VARNVRFASGSGYTDYRN 556 566777778888877654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (769 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 292.64 // Query: WGP00199.1|CBM2|CBM35|PL1_2 [L=769] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-26 80.1 2.6 1.5e-26 80.1 2.6 3.4 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.0 0.2 0.051 0.1 15 60 .. 39 85 .. 29 121 .. 0.71 2 ! 80.1 2.6 7.7e-27 1.5e-26 12 119 .] 194 302 .. 186 302 .. 0.96 3 ? -3.2 0.1 0.53 1.1 13 30 .. 539 556 .. 534 567 .. 0.72 Alignments for each domain: == domain 1 score: 0.0 bits; conditional E-value: 0.051 CBM35.hmm 15 tnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgs 60 tn++g +g+v + +++ + ++v+ + aG+ ++s ++ ++ ++ WGP00199.1|CBM2|CBM35|PL1_2 39 TNQWGSAFTGNVRITNsGNTPTNDWAVNWQYAGDNRISNSWGAQLSG 85 56666666666643331333346788999999999888888776444 PP == domain 2 score: 80.1 bits; conditional E-value: 7.7e-27 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagt 93 s+++n+ g++G+gf + + +g+++ ++v+v+ +G Y+l++rYang+g+++t sv+ nG++ se++fp+tg+wd+w +t WGP00199.1|CBM2|CBM35|PL1_2 194 SIDSNNGGFTGTGFANTDNVNGSQINWKVNVDFDGYYALEWRYANGSGTARTASVSANGAQ-SEISFPTTGSWDSWLLDSTT 274 6899******************************************************987.88****************** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 + LkaG n + +++ ++G n+dsl++ WGP00199.1|CBM2|CBM35|PL1_2 275 LFLKAGVNDVILSAntSSGLANIDSLTV 302 ************9999**********97 PP == domain 3 score: -3.2 bits; conditional E-value: 0.53 CBM35.hmm 13 vntnhagysGsgfvdglq 30 v n + sGsg+ d+ + WGP00199.1|CBM2|CBM35|PL1_2 539 VARNVRFASGSGYTDYRN 556 566777778888877654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (769 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 279.89 // Query: XOU83865.1|CBM35|PL1_5 [L=772] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-27 82.2 3.3 3.5e-27 82.2 3.3 2.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.7 0.24 0.48 25 25 .. 503 503 .. 432 570 .. 0.63 2 ! 82.2 3.3 1.7e-27 3.5e-27 11 119 .] 651 761 .. 640 761 .. 0.94 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.24 CBM35.hmm 25 f 25 XOU83865.1|CBM35|PL1_5 503 T 503 1 PP == domain 2 score: 82.2 bits; conditional E-value: 1.7e-27 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gtaagtvtL 96 sv++n+agy+G+gfv+ +a+g+a ++ ++p+aG+Y+l++rYan ++s++ +v vn +++++ +f stg+w++w ++++ +++ XOU83865.1|CBM35|PL1_5 651 GSVDSNNAGYTGDGFVNTDNASGNAAVYAFNAPSAGMYTLQVRYAN-GSSARPGDVLVNAGNIGTFDFSSTGSWTSWaNSNELSAYF 736 469*******************************************.6*****************************99******** PP CBM35.hmm 97 kaGkntitiks..dwGwinldslel 119 +aG+nt++i++ + G nlds+++ XOU83865.1|CBM35|PL1_5 737 SAGNNTVRIQAtnSGGLPNLDSVSV 761 ************778888***9876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (772 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 134.31 // Query: UUA73578.1|CBM2|CBM35|PL10_1 [L=667] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-28 84.2 2.8 8.1e-28 84.2 2.8 3.2 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.4 0.082 0.16 8 39 .. 36 70 .. 31 115 .. 0.67 2 ! 84.2 2.8 4.1e-28 8.1e-28 6 119 .] 190 307 .. 186 307 .. 0.95 3 ? -1.1 0.0 0.11 0.23 31 57 .. 495 521 .. 491 525 .. 0.86 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.082 CBM35.hmm 8 ltgvsvntnhagysGsgfvdglqaagda...vtfn 39 t + +n+ +g++G+ v++ +a++++ v+++ UUA73578.1|CBM2|CBM35|PL10_1 36 CTYTVTNNWGSGFTGEIKVTNDTAQTANnwsVSWQ 70 55566777777888888886655444433334444 PP == domain 2 score: 84.2 bits; conditional E-value: 4.1e-28 CBM35.hmm 6 asltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs..evtfpstgnw 84 ++g+++++++agysG+g+ + + +g+a++++v+++++ +++l++r+ang++++++ s+ +nG++++ ++++p tg w UUA73578.1|CBM2|CBM35|PL10_1 190 CRVDGIATESTNAGYSGNGYTNSNNVQGAAIEWAVNATSSSRHTLTFRFANGGTANRNGSLLINGGSNGnyTLQLPPTGGW 270 5678899**************************************************************7778899***** PP CBM35.hmm 85 dtwgtaagtvtLkaGkntitiks..dwGwinldslel 119 ++w+ta +++ L +G+n +++ks G n+dsl++ UUA73578.1|CBM2|CBM35|PL10_1 271 TNWQTASIEIDLVQGNNLLKLKSltADGLANIDSLTV 307 *************************9*********97 PP == domain 3 score: -1.1 bits; conditional E-value: 0.11 CBM35.hmm 31 aagdavtfnvdvpkaGsYelslrYang 57 ++gd+ +f+ v+k+ +Y l+ +++++ UUA73578.1|CBM2|CBM35|PL10_1 495 SDGDRARFKTAVTKGTEYILKAQWKQN 521 57899999************9999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (667 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 265.52 // Query: BCD98753.1|CBM35|PL10_1 [L=552] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-24 73.2 0.8 2.1e-24 73.2 0.8 2.3 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.2 0.8 1.1e-24 2.1e-24 5 119 .] 86 204 .. 81 204 .. 0.96 2 ? -1.8 0.1 0.19 0.39 42 58 .. 322 338 .. 309 360 .. 0.73 Alignments for each domain: == domain 1 score: 73.2 bits; conditional E-value: 1.1e-24 CBM35.hmm 5 dasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvs..evtfpstgnwdtwg 88 s++g++v+t++ gy+G g+ + + +g+++ ++ ++++++ +l++r+ang+ +++ ++ +n ++++ + fp+t++w++w+ BCD98753.1|CBM35|PL10_1 86 FCSIDGLAVETDNDGYTGLGYANTDNYSGAKIVWQLAAQTSDTFTLEIRFANGGDEARPAQLNINEGSNGsyMLAFPTTNAWTQWE 171 568999**************************************************************9977789*********** PP CBM35.hmm 89 taagtvtLkaGkntitiks..dwGwinldslel 119 t +tv L +G nt+++ s d+G n+d++++ BCD98753.1|CBM35|PL10_1 172 TESITVDLVQGLNTLELVSrnDSGLGNIDAIKI 204 *******************99*********986 PP == domain 2 score: -1.8 bits; conditional E-value: 0.19 CBM35.hmm 42 vpkaGsYelslrYangt 58 v ka +Y+l +Ya+g+ BCD98753.1|CBM35|PL10_1 322 VRKALDYTLDAQYASGG 338 56777899999999853 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (552 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 91.71 // Query: WGO99605.1|CBM35|PL10_1 [L=572] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-27 80.9 4.2 2.6e-26 79.4 4.2 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.4 4.2 1.3e-26 2.6e-26 11 119 .] 94 201 .. 83 201 .. 0.90 Alignments for each domain: == domain 1 score: 79.4 bits; conditional E-value: 1.3e-26 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtL 96 ++ +nh gysG+gfvd +a+g+++t++vdv ++G+Y++s+r+an +++++ +++ n + + ++ f +tg+w tw++ + tv+L WGO99605.1|CBM35|PL10_1 94 GEIVNNHEGYSGTGFVDTANAEGASITWKVDV-DGGNYDVSVRFAN-GSTARGATLSSN-EINTTYGFATTGDWATWADETHTVSL 176 567899*************************9.67***********.699999999999.66689********************* PP CBM35.hmm 97 kaGkntitiks..dwGwinldslel 119 aG+nti++++ G n+d++++ WGO99605.1|CBM35|PL10_1 177 AAGENTIQLSAltAGGLPNVDAITI 201 ************888999****986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (572 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 275.76 // Query: XOU79662.1|CBM2|CBM35|PL10_1 [L=700] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-30 90.8 3.2 7.8e-30 90.8 3.2 2.7 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 1.6 0.11 0.22 46 78 .. 82 116 .. 46 143 .. 0.59 2 ? -0.7 1.0 0.088 0.18 11 65 .. 104 157 .. 90 184 .. 0.66 3 ! 90.8 3.2 3.9e-30 7.8e-30 12 119 .] 221 330 .. 213 330 .. 0.96 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.11 CBM35.hmm 46 GsYelslrYang..tgstktlsvvvnGtkvsevtf 78 + +l l+Y ++ +++ + sv+ nG+ v+ +++ XOU79662.1|CBM2|CBM35|PL10_1 82 SNWALALNYDQAaaITNSWNASVSANGNVVNATNI 116 34555566655533555666677777777765544 PP == domain 2 score: -0.7 bits; conditional E-value: 0.088 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktls 65 vs+n n + + g+ ++l aag++++f + + +G+ +l ++ +g++s+++ s XOU79662.1|CBM2|CBM35|PL10_1 104 VSANGNVVNATNIGWNGNL-AAGQSTSFGLQGTYTGNFSLPVCVGQGQSSSSSSS 157 4445555555555655555.77888888888888888888888888755555544 PP == domain 3 score: 90.8 bits; conditional E-value: 3.9e-30 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaag 92 s+++n++g++Gsgf + +a+g++v ++v vp +G+Y l++rYang+g+++ + vnG+++++ +fp+tg+w++w+ta XOU79662.1|CBM2|CBM35|PL10_1 221 SIDSNNSGFTGSGFANTDNATGKSVDWSVSVPYSGNYLLEWRYANGSGNNRAGAIEVNGNARGNQSFPTTGAWTSWTTASA 301 6899***************************************************************************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 +v+L+aG+n i++ + +G n+dsl++ XOU79662.1|CBM2|CBM35|PL10_1 302 NVSLDAGTNLISLVAstGEGLGNIDSLTV 330 ***************8888888****997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (700 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.82 // Query: WYH55569.1|CBM35|CBM5|PL1_11|PL1_5 [L=1262] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-24 71.1 4.8 4.2e-23 69.0 4.8 2.2 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.0 4.8 2.1e-23 4.2e-23 12 119 .] 652 760 .. 645 760 .. 0.96 Alignments for each domain: == domain 1 score: 69.0 bits; conditional E-value: 2.1e-23 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 +v++n+ g++Gsgf + +a+g + ++++ ++GsY+l++rYang+ ++++ ++vnG +vs+ +f tg+w++ WYH55569.1|CBM35|CBM5|PL1_11|PL1_5 652 TVDSNNGGFTGSGFANTDNANGTGIDWTITG-DSGSYTLRWRYANGSDANRSAILSVNGVAVSTEDFVGTGSWTS 725 699***************************5.77***************************************** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dwGwinldslel 119 w+t+ ++++L G++ i++++ ++G n+d++e+ WYH55569.1|CBM35|CBM5|PL1_11|PL1_5 726 WATTSVQLNLGGGYKEIRLQAnqSSGLANIDYVEI 760 *********************99*********986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1262 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 414.12 // Query: XOU82353.1|CBM2|CBM35|PL1_2 [L=769] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-26 80.1 2.6 1.5e-26 80.1 2.6 3.4 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.0 0.2 0.051 0.1 15 60 .. 39 85 .. 29 121 .. 0.71 2 ! 80.1 2.6 7.7e-27 1.5e-26 12 119 .] 194 302 .. 186 302 .. 0.96 3 ? -3.2 0.1 0.53 1.1 13 30 .. 539 556 .. 534 567 .. 0.72 Alignments for each domain: == domain 1 score: 0.0 bits; conditional E-value: 0.051 CBM35.hmm 15 tnhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrYangtgs 60 tn++g +g+v + +++ + ++v+ + aG+ ++s ++ ++ ++ XOU82353.1|CBM2|CBM35|PL1_2 39 TNQWGSAFTGNVRITNsGNTPTNDWAVNWQYAGDNRISNSWGAQLSG 85 56666666666643331333346788999999999888888776444 PP == domain 2 score: 80.1 bits; conditional E-value: 7.7e-27 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagt 93 s+++n+ g++G+gf + + +g+++ ++v+v+ +G Y+l++rYang+g+++t sv+ nG++ se++fp+tg+wd+w +t XOU82353.1|CBM2|CBM35|PL1_2 194 SIDSNNGGFTGTGFANTDNVNGSQINWKVNVDFDGYYALEWRYANGSGTARTASVSANGAQ-SEISFPTTGSWDSWLLDSTT 274 6899******************************************************987.88****************** PP CBM35.hmm 94 vtLkaGkntitiks..dwGwinldslel 119 + LkaG n + +++ ++G n+dsl++ XOU82353.1|CBM2|CBM35|PL1_2 275 LFLKAGVNDVILSAntSSGLANIDSLTV 302 ************9999**********97 PP == domain 3 score: -3.2 bits; conditional E-value: 0.53 CBM35.hmm 13 vntnhagysGsgfvdglq 30 v n + sGsg+ d+ + XOU82353.1|CBM2|CBM35|PL1_2 539 VARNVRFASGSGYTDYRN 556 566777778888877654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (769 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 290.43 // Query: XTP29386.1|CBM35|PL1_11|PL1_5 [L=1321] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-25 75.1 7.9 1.4e-24 73.8 2.9 2.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 2.6 0.2 0.0084 0.017 11 66 .. 536 588 .. 525 604 .. 0.76 2 ! 73.8 2.9 6.8e-25 1.4e-24 11 119 .] 666 775 .. 656 775 .. 0.93 Alignments for each domain: == domain 1 score: 2.6 bits; conditional E-value: 0.0084 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsv 66 +s ++++ s+s+ +g +++g++vt+nv v ++ + +l+++ +n + +++++ XTP29386.1|CBM35|PL1_11|PL1_5 536 SSGGSSSSSSSSSSSSGGSSSSGGSVTLNVAV-SGSDANLNWNISN--IDVRNQEI 588 44556667777788888999***********9.5577788888888..45555555 PP == domain 2 score: 73.8 bits; conditional E-value: 6.8e-25 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.gt 89 + ++++h+gy+Gsg+ + +++g v ++v vp+aG+Y+ls+rYan +gs++ +v vn +++ ++ + tg+w+++ + XTP29386.1|CBM35|PL1_11|PL1_5 666 A-LESEHSGYTGSGYANTDNESGMGVDWSVVVPQAGNYTLSWRYAN-GGSDRPAEVLVNQGSQASLGMSGTGAWGNYaDS 743 4.799*****************************************.7****************************9788 PP CBM35.hmm 90 aagtvtLkaGkntitiks..dwGwinldslel 119 +tv L+aG+n i++++ +G n+ds+++ XTP29386.1|CBM35|PL1_11|PL1_5 744 GSVTVWLNAGYNEIRLQAtgGSGLANIDSVSV 775 89****************999999****9876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1321 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 337.75 // Query: XOU75568.1|CBM2|CBM35|PL10_1 [L=700] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-30 90.8 3.2 7.8e-30 90.8 3.2 2.7 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 1.6 0.11 0.22 46 78 .. 82 116 .. 46 143 .. 0.59 2 ? -0.7 1.0 0.088 0.18 11 65 .. 104 157 .. 90 184 .. 0.66 3 ! 90.8 3.2 3.9e-30 7.8e-30 12 119 .] 221 330 .. 213 330 .. 0.96 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.11 CBM35.hmm 46 GsYelslrYang..tgstktlsvvvnGtkvsevtf 78 + +l l+Y ++ +++ + sv+ nG+ v+ +++ XOU75568.1|CBM2|CBM35|PL10_1 82 SNWALALNYDQAaaITNSWNASVSANGNVVNATNI 116 34555566655533555666677777777765544 PP == domain 2 score: -0.7 bits; conditional E-value: 0.088 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktls 65 vs+n n + + g+ ++l aag++++f + + +G+ +l ++ +g++s+++ s XOU75568.1|CBM2|CBM35|PL10_1 104 VSANGNVVNATNIGWNGNL-AAGQSTSFGLQGTYTGNFSLPVCVGQGQSSSSSSS 157 4445555555555655555.77888888888888888888888888755555544 PP == domain 3 score: 90.8 bits; conditional E-value: 3.9e-30 CBM35.hmm 12 svntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaag 92 s+++n++g++Gsgf + +a+g++v ++v vp +G+Y l++rYang+g+++ + vnG+++++ +fp+tg+w++w+ta XOU75568.1|CBM2|CBM35|PL10_1 221 SIDSNNSGFTGSGFANTDNATGKSVDWSVSVPYSGNYLLEWRYANGSGNNRAGAIEVNGNARGNQSFPTTGAWTSWTTASA 301 6899***************************************************************************** PP CBM35.hmm 93 tvtLkaGkntitiks..dwGwinldslel 119 +v+L+aG+n i++ + +G n+dsl++ XOU75568.1|CBM2|CBM35|PL10_1 302 NVSLDAGTNLISLVAstGEGLGNIDSLTV 330 ***************8888888****997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (700 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 117.65 // Query: 63765|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM35 [L=308] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-21 63.5 2.7 4.3e-21 62.5 2.7 1.5 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.5 2.7 2.2e-21 4.3e-21 4 117 .. 188 304 .. 185 306 .. 0.87 Alignments for each domain: == domain 1 score: 62.5 bits; conditional E-value: 2.2e-21 CBM35.hmm 4 edasltg.vsvntnhagysGsgfvdglqaagda....vtfnvdvpkaGsYe 49 e+++ g +s+ t+++ ysGsg+++ +++ d v +v+++kaG+Y+ 63765|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM35 188 EKGTRYGyASIGTSTKYYSGSGYIKFKKSSHDGqrtrVDAYVNMKKAGRYN 238 67777778899*************76655444456669999********** PP CBM35.hmm 50 lslrYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaagtvtLkaG 99 l++++ n + s+ ++++vvn+++ s ++f++t ++w + ++ +++ kaG 63765|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM35 239 LKIKFNNPNNSKHKNRLVVNNNEYS-IKFDKTgSSWAK--VKLYDIPFKAG 286 *******99999999****988865.99*999888999..9********** PP CBM35.hmm 100 kntitiksdwGwinldsl 117 kn ++i++ G++n+d++ 63765|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM35 287 KNLVEIRATDGYMNFDYV 304 ****************97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (308 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 199.47 // [ok]