# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM35/fasta_for_each_cluster/cluster_180.txt # target HMM database: merged_hmms/CBM35.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM35/CBM35_cluster_180.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: XUZ78861.1|CBM35|GH97 [L=1280] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-11 29.5 0.2 5e-10 26.9 0.0 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.9 0.0 2.5e-10 5e-10 31 108 .. 672 761 .. 639 780 .. 0.76 2 ? -1.1 0.0 0.12 0.24 4 50 .. 976 1026 .. 975 1057 .. 0.58 Alignments for each domain: == domain 1 score: 26.9 bits; conditional E-value: 2.5e-10 CBM35.hmm 31 aagdavtfnvd.vpkaGsYelslrYangtgstktlsvvvnGtkvs........evtfpstgnwdtwgtaagtvtLkaGkntitiks.. 107 +g++vt+ v v++ G+Y+l lrYa+++ +++++ + G ++ +++ + t+ wd+w++ ++ v+L+aG+ i+++ XUZ78861.1|CBM35|GH97 672 PSGSSVTYVVRgVEEPGTYDLHLRYASAPEENAQRVIDAGGPRATlrvgdasrTIEPDFTAYWDDWRVFTTGVELDAGDTEIAVELdy 759 4678899998658**************99999999999999888899999988888888999********************998755 PP CBM35.hmm 108 .d 108 d XUZ78861.1|CBM35|GH97 760 eD 761 51 PP == domain 2 score: -1.1 bits; conditional E-value: 0.12 CBM35.hmm 4 edasltg...vsvntnhagysGsgfvdglqaagdavtfnvdv.pkaGsYel 50 e+a l++ + + +n ag+ G ++v+ + + + ++ nv p+a + ++ XUZ78861.1|CBM35|GH97 976 EEADLDEsfiAGTGSNDAGFVGGTNVEIVVDGEVETLANVRLpPNATDETV 1026 555555555555556666666666665555555555555544233334444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1280 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 260.41 // Query: QLK26471.2|CBM35|GH97 [L=1252] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-18 53.4 4.2 5.2e-17 49.4 0.5 3.2 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.4 0.1 0.14 0.29 28 70 .. 53 70 .. 27 87 .. 0.52 2 ! 49.4 0.5 2.6e-17 5.2e-17 2 119 .] 613 743 .. 612 743 .. 0.86 3 ! 3.5 0.0 0.0042 0.0083 32 67 .. 982 1018 .. 974 1027 .. 0.84 Alignments for each domain: == domain 1 score: -1.4 bits; conditional E-value: 0.14 CBM35.hmm 28 glqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnG 70 ++++g++vt+++dv++ G QLK26471.2|CBM35|GH97 53 TVSSPGGSVTLSIDVDD-------------------------G 70 33445555555555533.........................2 PP == domain 2 score: 49.4 bits; conditional E-value: 2.6e-17 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagda...vtfnvdvpkaGsYelslrYang.......tgstktlsvvvnGtkvsevtfp 79 +A +a+l+g ++++ a+ +G+ +v +++ d+ v+++ + +aG+Y++ lr an +g +++ ++ v+G+ ++++++p QLK26471.2|CBM35|GH97 613 QAQHAELDGFVTQSEWANAQGEAYVPFDATSADSgatVSWTLEGADAGEYDVHLRVANYeadnglaEGVDAMATLRVDGEPIEQLSIP 700 6999*********************655443333445******************877511122334557899*************** PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGkntitiks...dwGwinldslel 119 t+ wd w+ +a+ v+L+ G+ +++ d+G +nlds+++ QLK26471.2|CBM35|GH97 701 GTDYWDVWTATATAVSLESGDTELSLALtdeDTGGFNLDSITV 743 ************************9998899**********97 PP == domain 3 score: 3.5 bits; conditional E-value: 0.0042 CBM35.hmm 32 agdavtfnvdvpkaGsYelslrYang.tgstktlsvv 67 ++++ f ++++aG+Ye+++r +g + +++t++v+ QLK26471.2|CBM35|GH97 982 NEGTFAFGATIDEAGTYEVTVRTLEGePLASRTVTVT 1018 56667788999************99878888888775 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1252 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 277.94 // Query: UPM44237.1|CBM35|GH97 [L=1212] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-22 65.5 6.6 6.5e-22 65.2 2.0 3.4 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.7 0.0 0.088 0.18 89 111 .. 36 58 .. 23 64 .. 0.70 2 ! 65.2 2.0 3.2e-22 6.5e-22 2 119 .] 593 723 .. 592 723 .. 0.87 3 ? -1.1 0.1 0.11 0.22 40 57 .. 952 969 .. 919 980 .. 0.69 Alignments for each domain: == domain 1 score: -0.7 bits; conditional E-value: 0.088 CBM35.hmm 89 taagtvtLkaGkntitiksdwGw 111 ++++tvt G+ t+ti++++G UPM44237.1|CBM35|GH97 36 STTQTVTSPDGNITVTIDASEGG 58 46777777788888888877665 PP == domain 2 score: 65.2 bits; conditional E-value: 3.2e-22 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfv..dglqaagdavtfnvdv.pkaGsYelslrYang.......tgstktlsvvvnGtkvsevtfp 79 +Ae + +g s+ + a+ +G+ +v d ++g++++++v++ + aG+Yel lrYa++ +++t +v+vnG+ ++++p UPM44237.1|CBM35|GH97 593 QAEYGDRQGFSTAARWANAQGEAYVpiDPNVSSGSTISWTVTAvDRAGDYELHLRYASDaennavpADTDRTATVMVNGSTTTTISVP 680 6899999999999999999****9844566799999****886599**********9864222233356799**************** PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGkntitiks...dwGwinldslel 119 st+ wd w+t+ +tv+L+ G+n it+ d+G +nld++ + UPM44237.1|CBM35|GH97 681 STDYWDVWETVSTTVSLESGDNEITLLVadeDTGGFNLDAIAV 723 **************************99999*********976 PP == domain 3 score: -1.1 bits; conditional E-value: 0.11 CBM35.hmm 40 vdvpkaGsYelslrYang 57 ++++ G+Y++++r a g UPM44237.1|CBM35|GH97 952 YTIDTPGTYDVTVRTADG 969 566677888888888875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1212 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 299.10 // Query: UVE52246.1|CBM35|GH97 [L=1256] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-21 63.7 2.4 1.8e-21 63.7 2.4 4.1 5 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.1 0.18 0.35 25 67 .. 52 79 .. 26 95 .. 0.59 2 ? -2.9 0.0 0.42 0.84 65 89 .. 104 128 .. 96 150 .. 0.81 3 ? -2.1 0.0 0.23 0.45 57 86 .. 294 324 .. 257 330 .. 0.62 4 ! 63.7 2.4 9.2e-22 1.8e-21 2 119 .] 609 739 .. 608 739 .. 0.86 5 ? 0.5 0.3 0.037 0.074 31 65 .. 989 1020 .. 948 1033 .. 0.51 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.18 CBM35.hmm 25 fvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvv 67 v+ ++++++avt++ d a+ +t t v+ UVE52246.1|CBM35|GH97 52 LVQTVSSPDGAVTVEFD------------VAS---GTPTYAVS 79 34444444444444444............444...23333444 PP == domain 2 score: -2.9 bits; conditional E-value: 0.42 CBM35.hmm 65 svvvnGtkvsevtfpstgnwdtwgt 89 +++v Gt++++v+ t wd++ + UVE52246.1|CBM35|GH97 104 DLTVTGTERQTVDTRWTPVWDQYDE 128 6899999999999999999999644 PP == domain 3 score: -2.1 bits; conditional E-value: 0.23 CBM35.hmm 57 gtgstktlsvvvn.Gtkvsevtfpstgnwdt 86 ++g+ + ++vvn ++ +++++fp ++w + UVE52246.1|CBM35|GH97 294 SPGDLVESNLVVNlNEPHDSANFPHGTDWIE 324 3444455556665334455677777777765 PP == domain 4 score: 63.7 bits; conditional E-value: 9.2e-22 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvd...glqaagdavtfnv.dvpkaGsYelslrYang.......tgstktlsvvvnGtkvsevtf 78 +Aeda +g ++ ++ ag sG ++v + ++g++++++v dv +aG+Y+l lrYa++ +g+ +t +v v Gt+ ++vtf UVE52246.1|CBM35|GH97 609 QAEDADRDGFTTAAKWAGASGGTYVPvdpNTVDSGASLSWTVeDVATAGEYDLHLRYASDatknavpEGTPQTATVRVGGTA-QQVTF 695 79**********************9522355688999****8469************9864222233456788999999998.56*** PP CBM35.hmm 79 pstgnwdtwgtaagtvtLkaGkntitiks...dwGwinldslel 119 pst+ wd+w+t+ + v+L+aG+n +t++ d+G +nlds+ + UVE52246.1|CBM35|GH97 696 PSTTYWDEWSTVSVRVSLSAGSNEVTVTLgddDTGGFNLDSVAV 739 **************************999999********9875 PP == domain 5 score: 0.5 bits; conditional E-value: 0.037 CBM35.hmm 31 aagdavtfnvdvpkaGsYelslrYangtgstktls 65 +++d++++++d + G+Y++ +r g ++ +t + UVE52246.1|CBM35|GH97 989 DQEDTLSYTID--TPGTYDVAVRTTDG-QTLATET 1020 22333333333..34555555555553.3333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1256 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 280.37 // Query: USZ77990.1|CBM35|GH97 [L=1222] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-17 49.3 0.0 3.1e-14 40.4 0.1 3.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.4 0.1 1.6e-14 3.1e-14 2 110 .. 670 793 .. 669 810 .. 0.76 2 ! 5.5 0.0 0.0011 0.0021 58 107 .. 1007 1056 .. 986 1062 .. 0.76 Alignments for each domain: == domain 1 score: 40.4 bits; conditional E-value: 1.6e-14 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglq...aagdavtfn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvs........evt 77 +A+++ l + + n ++ G+ +v +g++ +++ dvp++G+Y+l lrYa+++ +++++ + G ++ +++ USZ77990.1|CBM35|GH97 670 QAASGDLGAFVTADNWRNAFGTNYVAVDPnrvPSGSSASWAvTDVPADGTYDLHLRYASAPNENSQRVIDAGGPRATlrvngetrTLE 757 6788888887788888888888888533211257899****557***************98777776665555555566666655788 PP CBM35.hmm 78 fpstgnwdtwgtaagtvtLkaGkntitiks...dwG 110 p t+ wd+w++ +++v+L+aG+nt++++ d+G USZ77990.1|CBM35|GH97 758 PPFTEYWDDWRVFTTSVELTAGDNTVAVELhydDSG 793 899999********************9987777444 PP == domain 2 score: 5.5 bits; conditional E-value: 0.0011 CBM35.hmm 58 tgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitiks 107 + + l v+v+G++v ++++ ++ + +++ +L+aG++ i++++ USZ77990.1|CBM35|GH97 1007 VVGGERLGVFVDGEEVASAFVRLAPGEGEATAQVELPYLSAGDHEIRVGR 1056 456677889********999999977777678888889*********987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1222 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 319.68 // Query: XRI27812.1|CBM35|GH97 [L=1294] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-16 46.6 0.1 1.7e-15 44.5 0.1 2.2 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.5 0.1 8.4e-16 1.7e-15 2 108 .. 642 765 .. 641 782 .. 0.79 2 ? -2.4 0.0 0.29 0.58 60 87 .. 1009 1038 .. 1004 1047 .. 0.82 Alignments for each domain: == domain 1 score: 44.5 bits; conditional E-value: 8.4e-16 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvd...glqaagdavtfnv.dvpkaGsYelslrYangtgstktlsvvvnGtkvs.........ev 76 +A+ ++++g+ ++ ++++ G+ fv + + +g++v+f+v dvp+aG+Y+l lrYa+ +++++t +v+ Gt + ++ XRI27812.1|CBM35|GH97 642 QAAAGEIDGLVTDDSYRDAFGTNFVAvdpNRAPSGSSVSFTVeDVPSAGTYDLHLRYAS-DAEENTGRVIDAGTPRAtlrvnderrTI 728 7999********************9622234467889****8469**************.6777777776666666666666666677 PP CBM35.hmm 77 tfpstgnwdtwgtaagtvtLkaGkntitiks.....d 108 + + t+ wd+w++ +++v+L+aG+n ++i+ d XRI27812.1|CBM35|GH97 729 EPDFTDYWDDWQVFTTEVELDAGDNEVAIELeyaqgD 765 7788889********************9987665552 PP == domain 2 score: -2.4 bits; conditional E-value: 0.29 CBM35.hmm 60 stktlsvvvnGtkvs..evtfpstgnwdtw 87 ++ t++v+++G+ vs +v +p +++ +t+ XRI27812.1|CBM35|GH97 1009 GATTVEVILDGEVVSrdTVRLPPNATDETV 1038 56789999*****99999999999877764 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1294 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 330.94 // Query: VTT86854.1|CBM35|GH97 [L=1344] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-14 41.0 0.0 7.7e-14 39.1 0.0 2.2 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.1 0.0 3.9e-14 7.7e-14 5 108 .. 693 810 .. 689 830 .. 0.72 Alignments for each domain: == domain 1 score: 39.1 bits; conditional E-value: 3.9e-14 CBM35.hmm 5 dasltgvsvntnhagysGsgfvd...glqaagdavtfnv.dvpkaGsYelslrYangtgstktlsvvvnGtkvs........evtfps 80 + +g+ ++ + ++ G+ fv + + +g++v f+v dvp+aG+Y+l lrYa++ +++ + + G ++ +++ p VTT86854.1|CBM35|GH97 693 AGDRDGLVTDDSWRNAFGTNFVAvdpNRAPSGSSVAFTVeDVPSAGTYDLHLRYASDAEENAGRVIDAGGPRATlrvndearTIEPPF 780 5556666666666677777776422233457899****8469**************755555444444444444666676668999** PP CBM35.hmm 81 tgnwdtwgtaagtvtLkaGkntitiks..d 108 t+ wd+w++ +++v+L aG+n ++i+ d VTT86854.1|CBM35|GH97 781 TDYWDDWQVFTTEVELAAGDNEVAIELdyD 810 ***********************9987662 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1344 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 331.29 // Query: XRI19393.1|CBM35|GH97 [L=1228] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-20 60.9 2.7 4.1e-20 59.4 1.2 2.7 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.4 1.2 2.1e-20 4.1e-20 2 119 .] 604 734 .. 603 734 .. 0.87 2 ? -1.7 0.0 0.17 0.35 42 51 .. 970 979 .. 932 996 .. 0.50 Alignments for each domain: == domain 1 score: 59.4 bits; conditional E-value: 2.1e-20 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvd...glqaagdavtfnvdvpkaGsYelslrYang.......tgstktlsvvvnGtkvsevtfp 79 +Ae + ++g s+ + +g +G+++v + +++g++v ++v+ ++G+Y+l lrYa++ +++t +v vnG+++ +vtfp XRI19393.1|CBM35|GH97 604 QAEWGDVDGFSTGARWPGAQGEQYVAidpNGASPGASVAWTVEGASEGEYDLHLRYASDaennavpADTDRTATVLVNGSEAAQVTFP 691 699999*******************633345577888*******************9864222233356799**************** PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGkntitiks...dwGwinldslel 119 t+ w++w + +tv+L+ G +++ d+G +nlds+ + XRI19393.1|CBM35|GH97 692 PTAYWNDWDAVSTTVSLSGGGDEVAVAFtdaDTGGVNLDSVAV 734 ***********************99999999********9875 PP == domain 2 score: -1.7 bits; conditional E-value: 0.17 CBM35.hmm 42 vpkaGsYels 51 +++aG+Ye++ XRI19393.1|CBM35|GH97 970 IDEAGEYEVT 979 2233333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1228 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 340.16 // Query: XQE17217.1|CBM35|GH97 [L=1244] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-17 51.0 0.8 1.7e-17 51.0 0.8 3.3 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.1 0.26 0.52 28 42 .. 52 66 .. 28 75 .. 0.50 2 ! 51.0 0.8 8.4e-18 1.7e-17 2 118 .. 604 733 .. 603 734 .. 0.88 3 ? -0.5 0.0 0.075 0.15 65 86 .. 956 979 .. 950 1012 .. 0.52 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.26 CBM35.hmm 28 glqaagdavtfnvdv 42 ++++++avt++vdv XQE17217.1|CBM35|GH97 52 TVSSPDGAVTLTVDV 66 223333444444444 PP == domain 2 score: 51.0 bits; conditional E-value: 8.4e-18 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvd...glqaagdavtfnvdvpkaGsYelslrYang.......tgstktlsvvvnGtkvsevtfp 79 +Ae + ++g s+ + a+ +G+++v + +a+g++v+++v+ +G+Y++ +rYa++ +++t +v v+G++++++tfp XQE17217.1|CBM35|GH97 604 QAEWGDIEGFSTAARWANAQGEQYVAidpNSAAPGATVSWTVEDAGEGEYDVHFRYASDaeenavgADTDRTATVLVDGSEAGHLTFP 691 6999*********************644456688899*******************986422222245789***************** PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGkntitiks...dwGwinldsle 118 t+ wd w+++ +tv+L+ + i+++ d+G +nld++ XQE17217.1|CBM35|GH97 692 PTEYWDVWESVSTTVSLSGDEDEIALSLtseDTGGFNLDAVA 733 ************************9998899********986 PP == domain 3 score: -0.5 bits; conditional E-value: 0.075 CBM35.hmm 65 svvvnGtkvs..evtfpstgnwdt 86 ++ v+G+ v +v fp +++ t XQE17217.1|CBM35|GH97 956 TLRVDGETVRtaNVRFPPNTSDAT 979 555555555544444444433222 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1244 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 296.37 // Query: XJZ20106.1|CBM35|GH97 [L=1256] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-20 60.7 0.9 1.6e-20 60.7 0.9 3.4 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.13 0.26 25 52 .. 52 80 .. 41 114 .. 0.71 2 ! 60.7 0.9 8e-21 1.6e-20 2 119 .] 609 739 .. 609 739 .. 0.84 3 ? -0.2 0.1 0.059 0.12 35 56 .. 993 1012 .. 952 1031 .. 0.56 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.13 CBM35.hmm 25 fvdglqaagdavtfnvdvpk.aGsYelsl 52 v+ ++++++avt++ dv + + +Y+ls+ XJZ20106.1|CBM35|GH97 52 LVQTVSSPSGAVTVAFDVSSgTPTYTLSY 80 56667777777777777744123444443 PP == domain 2 score: 60.7 bits; conditional E-value: 8e-21 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvd...glqaagdavtfnvd.vpkaGsYelslrYang......tgstktlsvvvnGtkvsevtfp 79 +Aeda+ + s+ ++ ag sG ++v + ++g++++++v+ vp++G+Y+l lrYa++ + +t + v+ G++ ++vtfp XJZ20106.1|CBM35|GH97 609 QAEDAERDSFSTAAKWAGASGGKYVPvdpNTVDSGASLSWTVEsVPTTGEYDLHLRYASDatknavPEGTPRTATVLAGEETQQVTFP 696 69**********************9522355688999****9736*************974211222233445556699999****** PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGkntitiks...dwGwinldslel 119 t+ wd+w t+ ++v+L+ G+n +t++ d+G +nlds+ + XJZ20106.1|CBM35|GH97 697 PTAYWDEWDTVSVSVSLSTGTNEVTVTLgddDTGGFNLDSVAV 739 *************************999999********9875 PP == domain 3 score: -0.2 bits; conditional E-value: 0.059 CBM35.hmm 35 avtfnvdvpkaGsYelslrYan 56 ++++ ++++ G+Y++ +r XJZ20106.1|CBM35|GH97 993 TLSY--TIDTPGTYDVAVRTTD 1012 2222..3334455555555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1256 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 192.13 // Query: XRI31169.1|CBM35|GH97 [L=1290] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-16 46.8 0.2 1.7e-15 44.5 0.1 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.5 0.1 8.6e-16 1.7e-15 2 108 .. 659 779 .. 658 799 .. 0.74 2 ? -2.8 0.0 0.38 0.76 62 86 .. 1005 1031 .. 1001 1035 .. 0.78 Alignments for each domain: == domain 1 score: 44.5 bits; conditional E-value: 8.6e-16 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvd...glqaagdavtfnv.dvpkaGsYelslrYang.........tgstktlsvvvnGtkvsev 76 +A+ ++l+g+ ++ + ++ G+ fv + + +g++v+f+v dvp+aG+Y+l lrYa++ +++t ++ vnG++ ++ XRI31169.1|CBM35|GH97 659 QAAAGELNGLVTDDSWRDAFGTNFVAvdpNRAPSGSSVSFTVeDVPSAGTYDLHLRYASDaeenagrviDAGTPRATLRVNGDRE-TI 745 79999****99*************9622234467889****8469*************953211111122345566777887774.56 PP CBM35.hmm 77 tfpstgnwdtwgtaagtvtLkaGkntitiks..d 108 + + t+ wd+w++ +++v+L+aG+n i+i+ XRI31169.1|CBM35|GH97 746 EPDFTEYWDDWQVFTTEVELDAGDNEIAIELdyA 779 6666677*********************997551 PP == domain 2 score: -2.8 bits; conditional E-value: 0.38 CBM35.hmm 62 ktlsvvvnGtkvs..evtfpstgnwdt 86 t+++vv+G+ +v +p +++ +t XRI31169.1|CBM35|GH97 1005 TTVEIVVDGEVEAlgNVRLPPNATDET 1031 57899***9987666999999877666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1290 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 331.24 // Query: XWY80742.1|CBM35|GH97 [L=1282] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-14 41.3 0.1 1.3e-13 38.4 0.0 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.4 0.0 6.7e-14 1.3e-13 3 108 .. 647 769 .. 645 786 .. 0.71 2 ? -1.0 0.0 0.11 0.22 62 86 .. 1001 1027 .. 996 1035 .. 0.84 Alignments for each domain: == domain 1 score: 38.4 bits; conditional E-value: 6.7e-14 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvd...glqaagdavtfnv.dvpkaGsYelslrYangtgstktlsvvvnGtkvs.........evt 77 A+ + +g+ ++ + ++ G+ fv + + +g++v+++v dvp+aGsYel lrYa++ ++++ +v+ G+ + +++ XWY80742.1|CBM35|GH97 647 AAAGDRDGLVTDDSWRDAFGTNFVAvdpNRAPSGSSVSYAVeDVPSAGSYELHLRYASD-AEENAGRVIDAGNPRAtlrvndetrTIE 733 666667777777777777777777522233457889****8469*************95.4444444433333333455555555899 PP CBM35.hmm 78 fpstgnwdtwgtaagtvtLkaGkntitiks.....d 108 p t+ wd+w++ +++v+L+aG+n ++i+ d XWY80742.1|CBM35|GH97 734 PPFTDYWDDWQVFTTEVELDAGDNEVAIELdyeadD 769 999***********************9997556663 PP == domain 2 score: -1.0 bits; conditional E-value: 0.11 CBM35.hmm 62 ktlsvvvnGtkvs..evtfpstgnwdt 86 t++vvv+G+ v +v +p +++ +t XWY80742.1|CBM35|GH97 1001 TTVEVVVDGETVAldNVRLPPNATDET 1027 5899******99999999999987776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1282 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 344.82 // Query: QLG48321.2|CBM35|GH97 [L=1260] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-17 50.9 1.9 6.5e-16 45.9 0.2 3.2 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.4 0.1 0.28 0.56 25 51 .. 50 77 .. 36 86 .. 0.74 2 ! 45.9 0.2 3.2e-16 6.5e-16 2 119 .] 613 743 .. 612 743 .. 0.86 3 ! 2.8 0.0 0.0072 0.014 32 68 .. 990 1025 .. 973 1039 .. 0.77 Alignments for each domain: == domain 1 score: -2.4 bits; conditional E-value: 0.28 CBM35.hmm 25 fvdglqaagdavtfnvdvpk.aGsYels 51 v+ +++++++v ++vdv++ + +Y+++ QLG48321.2|CBM35|GH97 50 AVQTVSSPDGSVAVAVDVTDgTPTYSVT 77 6778888889999999985413455555 PP == domain 2 score: 45.9 bits; conditional E-value: 3.2e-16 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagda....vtfnvdvpkaGsYelslrYang.......tgstktlsvvvnGtkvsevtf 78 +A +a+l+g++ ++ a+ +G+ +v +++++d+ t++ d ++G+Y++ +r an +g ++t ++ ++G+ v+++++ QLG48321.2|CBM35|GH97 613 QAQHAELSGLERRSKWANSQGEAYVP-FAGDSDEsspaATWTLDTVDTGEYDVHIRIANYetdngldDGVDATATLQIDGNPVEQLSI 699 6999*********************5.44444444666******************77752112233455799*************** PP CBM35.hmm 79 pstgnwdtwgtaagtvtLkaGkntitiks...dwGwinldslel 119 p t+ wd w+++ +tv+L+ G+ + ++ d+G +nld++ l QLG48321.2|CBM35|GH97 700 PGTEYWDVWTETSTTVSLECGDADLGLTLtdgDTGGFNLDAIAL 743 *************************999999*********9975 PP == domain 3 score: 2.8 bits; conditional E-value: 0.0072 CBM35.hmm 32 agdavtfnvdvpkaGsYelslrYangtgstktlsvvv 68 ++++ f+ ++++ G+Y++++r + + + +t++v+v QLG48321.2|CBM35|GH97 990 SDQSFAFRSTIDAPGTYDVTVRTLA-EETLATRTVTV 1025 3445778889999*********999.67777777776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1260 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 304.41 // [ok]