# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM35/fasta_for_each_cluster/cluster_179.txt # target HMM database: merged_hmms/CBM35.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM35/CBM35_cluster_179.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: WNG14653.1|CBM35|GH65 [L=1445] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-53 165.1 12.1 2.1e-32 99.0 0.2 4.0 4 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 70.3 0.1 8.7e-24 1.7e-23 2 119 .] 159 290 .. 158 290 .. 0.88 2 ? -3.8 0.0 0.76 1.5 23 51 .. 419 447 .. 410 454 .. 0.76 3 ? 1.9 0.7 0.013 0.026 24 77 .. 1011 1059 .. 988 1076 .. 0.74 4 ! 99.0 0.2 1.1e-32 2.1e-32 2 119 .] 1318 1439 .. 1317 1439 .. 0.99 Alignments for each domain: == domain 1 score: 70.3 bits; conditional E-value: 8.7e-24 CBM35.hmm 2 eAedasltg.vsvntnhagysGsgfvdglqaagda.....vtfn.vdvpkaGsYelslrYang....tgstktlsvvvnGtkvsevtf 78 eAe+++l g ++ t+h+g sG fv g+ ++g +t++ dvp++G+ +l +rYan+ + t++lsv+v Gtk+++v + WNG14653.1|CBM35|GH65 159 EAESGELAGgATRATDHSGASGGAFVAGYGDQGHPvvgarMTLQvTDVPTTGTSTLWVRYANSdggdGVRTRSLSVWVGGTKQGTVAL 246 8********9999****************9988765555589995579**************954334467889999*********** PP CBM35.hmm 79 pstgnwdtwgtaagtvtLkaGkntitiks..dwGwi.nldslel 119 p t+ wd+w+ta+++v+L+aG+ t++++ G + n+dsl l WNG14653.1|CBM35|GH65 247 PPTDGWDSWSTATVQVPLSAGTDTVALSCeaGDGCMvNVDSLAL 290 ***************************9988555555***9975 PP == domain 2 score: -3.8 bits; conditional E-value: 0.76 CBM35.hmm 23 sgfvdglqaagdavtfnvdvpkaGsYels 51 + vdgl+++++a + + +v ++ +Y+++ WNG14653.1|CBM35|GH65 419 TALVDGLASSSAAQRASFEVRDGSTYTVT 447 56788888888887777888888888775 PP == domain 3 score: 1.9 bits; conditional E-value: 0.013 CBM35.hmm 24 gfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevt 77 g v +a da++ v++p++ +Y ++++ + + + ++ s+ vn+t+v ++ WNG14653.1|CBM35|GH65 1011 GTV---GTAADATSSVVTAPTTARY-VRYTAVS-GVTPEVASLEVNDTSVPDAP 1059 444...5778888999******999.4555555.799***********998665 PP == domain 4 score: 99.0 bits; conditional E-value: 1.1e-32 CBM35.hmm 2 eAedasltg.vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 eAeda l g + + t+h gy+Gs+f ++ +g+av f+v++ +aG+YelslrYangtgs+k l+++v + +++vt+pstg wdt WNG14653.1|CBM35|GH65 1318 EAEDAVLGGgACTATDHGGYTGSSFAACFDRKGAAVGFQVEAAQAGTYELSLRYANGTGSDKALTLTVGAAPAQQVTLPSTGVWDT 1403 9*******9999************************************************************************** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks...dwGwinldslel 119 wg +++ v L aG t+++ + d+G +n+dsl++ WNG14653.1|CBM35|GH65 1404 WGLQTVRVALPAGVTTVSYAYgpeDSGHVNIDSLTV 1439 **********************************97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1445 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 242.34 // Query: XDS51443.1|CBM35|GH65 [L=1247] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-15 43.0 0.7 2.3e-14 40.9 0.0 2.6 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.9 0.0 1.1e-14 2.3e-14 4 95 .. 112 211 .. 110 218 .. 0.86 2 ? -3.2 0.2 0.53 1.1 41 54 .. 401 414 .. 371 444 .. 0.53 Alignments for each domain: == domain 1 score: 40.9 bits; conditional E-value: 1.1e-14 CBM35.hmm 4 edasltg.vsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang...tgstktlsvvv.nGtkvsevtfpst..gn 83 ed+ l+g +s ++h gy+Gsgfv+g+ + +++ t++ v +aG Y+l +rYa+g +gs++ ++v v G+++ +t++ g+ XDS51443.1|CBM35|GH65 112 EDGLLSGgLSSGNDHGGYQGSGFVQGFGSGSAKATLTlSGVSEAGIYDLVVRYAAGdpgDGSSNARTVLVsAGDAQHRLTLEPIedGS 199 677888889999*************************6779**************98777788889999967888887777754459* PP CBM35.hmm 84 wdtwgtaagtvt 95 wdtw+ a++ v+ XDS51443.1|CBM35|GH65 200 WDTWKIATIAVS 211 ****99998886 PP == domain 2 score: -3.2 bits; conditional E-value: 0.53 CBM35.hmm 41 dvpkaGsYelslrY 54 +v+++ sY+++ XDS51443.1|CBM35|GH65 401 NVETGKSYSFTKFV 414 33333333333222 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1247 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 299.08 // Query: XDS50440.1|CBM35|GH65 [L=1373] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-20 59.3 0.1 3.2e-19 56.5 0.1 2.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.5 0.1 1.6e-19 3.2e-19 4 95 .. 146 245 .. 143 265 .. 0.86 Alignments for each domain: == domain 1 score: 56.5 bits; conditional E-value: 1.6e-19 CBM35.hmm 4 edasltg.vsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang...tgstktlsvvv.nGtkvsevtfpst..gn 83 eda+l+g +sv t+h gy+Gsgfv+g+ +++++ f+ vp+aG+Y++ +rYa+g + +t+ ++v++ G++ ++++++ t gn XDS50440.1|CBM35|GH65 146 EDAKLSGgLSVATDHGGYQGSGFVQGFGSDSARAVFTvPRVPSAGTYDMVFRYAAGnpgDNTTNPRKVSItAGSSTQTISMTPTedGN 233 99****99*****************************5589**************98555566667888867888887777766679* PP CBM35.hmm 84 wdtwgtaagtvt 95 wdtw+ta ++v XDS50440.1|CBM35|GH65 234 WDTWSTARVSVD 245 ******999886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1373 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 326.50 // Query: WIX84114.1|CBM35|GH65 [L=890] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-16 48.4 0.1 3e-16 46.9 0.1 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.9 0.1 1.5e-16 3e-16 41 119 .] 156 236 .. 112 236 .. 0.79 Alignments for each domain: == domain 1 score: 46.9 bits; conditional E-value: 1.5e-16 CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitiks...dwGwinldslel 119 aG +l +rY ng+gs +t + vnGt + ++++ps ++wd+w+++++ vtL+aG+nt++++ d+ +n+d+l l WIX84114.1|CBM35|GH65 156 RNAPAGPATLAVRYGNGSGSPQTIHIGVNGTLR-QLSVPSLASWDDWAVVTVPVTLNAGANTLEVTVtegDTARVNIDYLAL 236 445568899*********************985.5*******************************977888888***9975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (890 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 316.19 // Query: XDS49216.1|CBM35|GH65 [L=1373] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-20 59.3 0.1 3.2e-19 56.5 0.1 2.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.5 0.1 1.6e-19 3.2e-19 4 95 .. 146 245 .. 143 265 .. 0.86 Alignments for each domain: == domain 1 score: 56.5 bits; conditional E-value: 1.6e-19 CBM35.hmm 4 edasltg.vsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang...tgstktlsvvv.nGtkvsevtfpst..gn 83 eda+l+g +sv t+h gy+Gsgfv+g+ +++++ f+ vp+aG+Y++ +rYa+g + +t+ ++v++ G++ ++++++ t gn XDS49216.1|CBM35|GH65 146 EDAKLSGgLSVATDHGGYQGSGFVQGFGSDSARAVFTvPRVPSAGTYDMVFRYAAGnpgDNTTNPRKVSItAGSSTQTISMTPTedGN 233 99****99*****************************5589**************98555566667888867888887777766679* PP CBM35.hmm 84 wdtwgtaagtvt 95 wdtw+ta ++v XDS49216.1|CBM35|GH65 234 WDTWSTARVSVD 245 ******999886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1373 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 364.24 // Query: WLQ37642.1|CBM32|CBM35|GH65 [L=1150] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-30 92.7 0.8 6.9e-29 87.7 0.1 3.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 2.1 0.1 0.011 0.023 38 81 .. 493 536 .. 486 573 .. 0.85 2 ! 87.7 0.1 3.5e-29 6.9e-29 2 116 .. 1018 1144 .. 1017 1147 .. 0.91 Alignments for each domain: == domain 1 score: 2.1 bits; conditional E-value: 0.011 CBM35.hmm 38 fnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst 81 +v+++++G+Y+++ ++++s+ +v+ n +++ ++++ + WLQ37642.1|CBM32|CBM35|GH65 493 SRVTANDDGNYSVRNVAGSDEYSHGDDNVSTNAGAATTLKIATE 536 579************99999*********999999888777665 PP == domain 2 score: 87.7 bits; conditional E-value: 3.5e-29 CBM35.hmm 2 eAedasltg.vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYang........tgstktlsvvvnGtk 72 eAe+a l g + vntnh+gy+G gfvdgl ++g+ t + d+p+aGsY+l++rYan+ + +t+t+++ v G+ WLQ37642.1|CBM32|CBM35|GH65 1018 EAEKAALVGsAGVNTNHKGYTGAGFVDGLLSTGAGFTTQFDAPTAGSYTLTIRYANSlggadapyEEKTRTMTLAVPGAP 1097 8********999*******************************************96543333233468899999***** PP CBM35.hmm 73 vsevtfpstgnwdtwgtaagtvtLkaGkntitiks...dwGwinlds 116 +v+fp t++wdtw+ta++tv+L +G ++ + d G++n+d+ WLQ37642.1|CBM32|CBM35|GH65 1098 PATVSFPVTADWDTWSTAEVTVNLPKGLSSVGLICagqDDGAVNIDA 1144 ********************************988888*******97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1150 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 291.25 // Query: XDS46919.1|CBM35|GH65 [L=1247] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-15 43.0 0.7 2.3e-14 40.9 0.0 2.6 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.9 0.0 1.1e-14 2.3e-14 4 95 .. 112 211 .. 110 218 .. 0.86 2 ? -3.2 0.2 0.53 1.1 41 54 .. 401 414 .. 371 444 .. 0.53 Alignments for each domain: == domain 1 score: 40.9 bits; conditional E-value: 1.1e-14 CBM35.hmm 4 edasltg.vsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang...tgstktlsvvv.nGtkvsevtfpst..gn 83 ed+ l+g +s ++h gy+Gsgfv+g+ + +++ t++ v +aG Y+l +rYa+g +gs++ ++v v G+++ +t++ g+ XDS46919.1|CBM35|GH65 112 EDGLLSGgLSSGNDHGGYQGSGFVQGFGSGSAKATLTlSGVSEAGIYDLVVRYAAGdpgDGSSNARTVLVsAGDAQHRLTLEPIedGS 199 677888889999*************************6779**************98777788889999967888887777754459* PP CBM35.hmm 84 wdtwgtaagtvt 95 wdtw+ a++ v+ XDS46919.1|CBM35|GH65 200 WDTWKIATIAVS 211 ****99998886 PP == domain 2 score: -3.2 bits; conditional E-value: 0.53 CBM35.hmm 41 dvpkaGsYelslrY 54 +v+++ sY+++ XDS46919.1|CBM35|GH65 401 NVETGKSYSFTKFV 414 33333333333222 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1247 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 326.83 // Query: XDS48375.1|CBM35|GH65 [L=1247] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-15 43.0 0.7 2.3e-14 40.9 0.0 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.9 0.0 1.1e-14 2.3e-14 4 95 .. 112 211 .. 110 218 .. 0.86 2 ? -3.2 0.2 0.53 1.1 41 54 .. 401 414 .. 371 444 .. 0.53 Alignments for each domain: == domain 1 score: 40.9 bits; conditional E-value: 1.1e-14 CBM35.hmm 4 edasltg.vsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang...tgstktlsvvv.nGtkvsevtfpst..gn 83 ed+ l+g +s ++h gy+Gsgfv+g+ + +++ t++ v +aG Y+l +rYa+g +gs++ ++v v G+++ +t++ g+ XDS48375.1|CBM35|GH65 112 EDGLLSGgLSSGNDHGGYQGSGFVQGFGSGSAKATLTlSGVSEAGIYDLVVRYAAGdpgDGSSNARTVLVsAGDAQHRLTLEPIedGS 199 677888889999*************************6779**************98777788889999967888887777754459* PP CBM35.hmm 84 wdtwgtaagtvt 95 wdtw+ a++ v+ XDS48375.1|CBM35|GH65 200 WDTWKIATIAVS 211 ****99998886 PP == domain 2 score: -3.2 bits; conditional E-value: 0.53 CBM35.hmm 41 dvpkaGsYelslrY 54 +v+++ sY+++ XDS48375.1|CBM35|GH65 401 NVETGKSYSFTKFV 414 33333333333222 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1247 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 285.15 // Query: BDT61642.1|CBM35|GH65|3.2.1.115 [L=1273] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-11 31.6 0.0 5.5e-11 30.0 0.0 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.0 0.0 2.7e-11 5.5e-11 4 90 .. 152 246 .. 150 252 .. 0.76 Alignments for each domain: == domain 1 score: 30.0 bits; conditional E-value: 2.7e-11 CBM35.hmm 4 edasltg.vsvntnhagysGsgfvdglqaagda.vtfnvdvpkaGsYelslrYang...tgstktlsvvv.nGtkvse 75 eda+l+g vsv ++h gy+Gsgf +g+ +a++ + ++ ++ + Y+l +rYa+g + s++++s+ v G+ + + BDT61642.1|CBM35|GH65|3.2.1.115 152 EDAQLSGgVSVASDHGGYQGSGFTQGWGNASAGaLLYANGAQPDAAYDLIVRYAAGnpgDNSANVRSLHVsVGDTSAD 229 89****99*******************98876615666778999**********997443333444555533444456 PP CBM35.hmm 76 vtfpst..gnwdtwgta 90 + +p + g+wdtw +a BDT61642.1|CBM35|GH65|3.2.1.115 230 IALPPSpqGDWDTWMQA 246 7776665799***9776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1273 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 358.43 // Query: XDS46002.1|CBM35|GH65 [L=1373] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-20 59.3 0.1 3.2e-19 56.5 0.1 2.6 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.5 0.1 1.6e-19 3.2e-19 4 95 .. 146 245 .. 143 265 .. 0.86 Alignments for each domain: == domain 1 score: 56.5 bits; conditional E-value: 1.6e-19 CBM35.hmm 4 edasltg.vsvntnhagysGsgfvdglqaagdavtfn.vdvpkaGsYelslrYang...tgstktlsvvv.nGtkvsevtfpst..gn 83 eda+l+g +sv t+h gy+Gsgfv+g+ +++++ f+ vp+aG+Y++ +rYa+g + +t+ ++v++ G++ ++++++ t gn XDS46002.1|CBM35|GH65 146 EDAKLSGgLSVATDHGGYQGSGFVQGFGSDSARAVFTvPRVPSAGTYDMVFRYAAGnpgDNTTNPRKVSItAGSSTQTISMTPTedGN 233 99****99*****************************5589**************98555566667888867888887777766679* PP CBM35.hmm 84 wdtwgtaagtvt 95 wdtw+ta ++v XDS46002.1|CBM35|GH65 234 WDTWSTARVSVD 245 ******999886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1373 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 360.01 // Query: WNG24135.1|CBM35|GH65 [L=1335] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-54 168.3 12.7 2.3e-33 102.2 0.3 4.3 5 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.8 0.1 1.2e-23 2.4e-23 2 119 .] 49 180 .. 48 180 .. 0.88 2 ? -3.2 0.1 0.51 1 21 51 .. 307 337 .. 290 345 .. 0.76 3 ! 2.9 0.4 0.0068 0.014 23 77 .. 900 949 .. 878 967 .. 0.73 4 ? -2.6 0.0 0.33 0.66 58 79 .. 975 996 .. 955 1003 .. 0.76 5 ! 102.2 0.3 1.1e-33 2.3e-33 2 119 .] 1208 1329 .. 1207 1329 .. 0.99 Alignments for each domain: == domain 1 score: 69.8 bits; conditional E-value: 1.2e-23 CBM35.hmm 2 eAedasltg.vsvntnhagysGsgfvdglqaagda.....vtfn.vdvpkaGsYelslrYang....tgstktlsvvvnGtkvsevtf 78 eAe+++l g ++ t+h+g sG fv g+ ++g +t++ dvp++G+ +l +rYan+ + t++lsv+v Gtk+++v + WNG24135.1|CBM35|GH65 49 EAESGELAGgATRATDHSGASGGAFVAGYGDQGHPvvgarMTLRvTDVPTTGTSTLWVRYANSdggdGVRTRSLSVWVGGTKQGTVAL 136 8********9999****************9988765555589995579**************954334467889999*********** PP CBM35.hmm 79 pstgnwdtwgtaagtvtLkaGkntitiks..dwGwi.nldslel 119 p t+ wd+w+ta+++v+L+aG+ t++++ G + n+dsl l WNG24135.1|CBM35|GH65 137 PPTDGWDSWSTATVQVPLSAGTDTVALSCeaGDGCMvNVDSLAL 180 ***************************9988555555***9975 PP == domain 2 score: -3.2 bits; conditional E-value: 0.51 CBM35.hmm 21 sGsgfvdglqaagdavtfnvdvpkaGsYels 51 + + vdgl+++++a + + +v ++ +Y+++ WNG24135.1|CBM35|GH65 307 TPTALVDGLASSSAAQRASFEVRDGSTYTVT 337 5567788888888888888888888888775 PP == domain 3 score: 2.9 bits; conditional E-value: 0.0068 CBM35.hmm 23 sgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevt 77 g v +a+da++ +++p++ +Y ++++ a+ + + ++ s+ vn+t+v ++ WNG24135.1|CBM35|GH65 900 LGTV---GTADDATSSVITAPTTARY-VRYTAAS-GVTPEVASLEVNDTSVPDAP 949 4445...5677788888999999999.5666666.79************998665 PP == domain 4 score: -2.6 bits; conditional E-value: 0.33 CBM35.hmm 58 tgstktlsvvvnGtkvsevtfp 79 + +++t++ +v G+++ +vt WNG24135.1|CBM35|GH65 975 PVDHSTVTAYVGGSAAASVTTR 996 7889999999999998887765 PP == domain 5 score: 102.2 bits; conditional E-value: 1.1e-33 CBM35.hmm 2 eAedasltg.vsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 eAeda l g + + t+h gy+Gs+f ++ +g+av f+v++ +aG+YelslrYangtgs+ktl+++v + +++vt+pstg wdt WNG24135.1|CBM35|GH65 1208 EAEDAVLGGgACTATDHGGYTGSSFAACFDRKGAAVGFQVEAAQAGTYELSLRYANGTGSDKTLTLTVGAAPAQQVTLPSTGGWDT 1293 9*******9999************************************************************************** PP CBM35.hmm 87 wgtaagtvtLkaGkntitiks...dwGwinldslel 119 wg +++ v L aG t+++ + d+G +n+dsl++ WNG24135.1|CBM35|GH65 1294 WGLQTVRVALPAGVTTVSYAYgpeDSGHVNIDSLTV 1329 **********************************97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1335 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 172.19 // [ok]