# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM35/fasta_for_each_cluster/cluster_173.txt # target HMM database: merged_hmms/CBM35.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM35/CBM35_cluster_173.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 303958|HyFL0890_1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 [L=417] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-14 41.1 2.4 1.5e-12 35.0 0.2 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.8 0.1 0.00086 0.0017 73 108 .. 236 270 .. 188 284 .. 0.84 2 ! 35.0 0.2 7.5e-13 1.5e-12 1 118 [. 291 410 .. 291 411 .. 0.87 Alignments for each domain: == domain 1 score: 5.8 bits; conditional E-value: 0.00086 CBM35.hmm 73 vsevtfpstgnwdtwgtaagtvtLkaGkntitiksd 108 s+ tf+ tg ++ +++ ++ +aG++t+ti++ 303958|HyFL0890_1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 236 GSQNTFELTGGASS-NYVWAPLNINAGAHTVTIDYH 270 45778888877777.899999************983 PP == domain 2 score: 35.0 bits; conditional E-value: 7.5e-13 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a ltg +v +n ++ ++ v g+ ++++vtf+ 303958|HyFL0890_1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 291 YEAEHAALTGRAVVKNCNDCVSKRSVHGV-HSESEVTFHN 329 9*************************999.78899***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++++ ls++Y+ ++ ++ + ++vn++ + +++ ++ 303958|HyFL0890_1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 330 VTGTGERQWLSFHYRVNNPEAGEAHIFVNDEPAVNISsLN 369 667889999**********************999776156 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 s + + t ++ +++tLk G+ ntit+++ + G+ +d 303958|HyFL0890_1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 370 SRAGYHT--STSVQLTLKRGDvNTITFGAigSDGFEvAVD 407 6688888..***********77******999666543777 PP CBM35.hmm 116 sle 118 +e 303958|HyFL0890_1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 408 GIE 410 776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (417 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 116.25 // Query: 484202|XylFL1651_GeneCatalog_proteins_20190321.aa.fasta|GH43_25|GH43_25|CBM35 [L=419] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-08 19.8 0.4 7.6e-08 19.8 0.4 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.4 1.0 0.02 0.04 54 107 .. 231 288 .. 201 303 .. 0.66 2 ! 19.8 0.4 3.8e-08 7.6e-08 29 119 .] 322 415 .. 295 415 .. 0.80 Alignments for each domain: == domain 1 score: 1.4 bits; conditional E-value: 0.02 CBM35.hmm 54 YangtgstktlsvvvnGtkvsevtfpstgnwdtw.....g 88 +n gs++t ++++ Gt++ ++ +wd+ + 484202|XylFL1651_GeneCatalog_proteins_20190321.aa.fasta|GH43_25|GH43_25|CBM35 231 AQNTYGSQNTFELTIQGTQSTTYIYMGD-AWDSKggassN 269 5566677778888888888775544433.45443222226 PP CBM35.hmm 89 taagtvtLkaGkntitiks 107 ++ ++ + G++t+++++ 484202|XylFL1651_GeneCatalog_proteins_20190321.aa.fasta|GH43_25|GH43_25|CBM35 270 YVWLPMNINSGSKTVQLDY 288 6777788888888888876 PP == domain 2 score: 19.8 bits; conditional E-value: 3.8e-08 CBM35.hmm 29 lqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvv 68 ++++ ++vtf+ ++ l ++Y+ ++ ++ ++ +vv 484202|XylFL1651_GeneCatalog_proteins_20190321.aa.fasta|GH43_25|GH43_25|CBM35 322 VSNQPNEVTFHNVTGTGSLQWLAFHYKVNNPEAGEVYIVV 361 456778899996667888899******************* PP CBM35.hmm 69 nGtkvsevt.fpstgnwdtwgtaagtvtLkaGk.ntitik 106 n++ + +++ ++s + + + ++ +++tLkaG+ ntit++ 484202|XylFL1651_GeneCatalog_proteins_20190321.aa.fasta|GH43_25|GH43_25|CBM35 362 NNEPAVNISsLNSRAGYHE--STPVQLTLKAGDgNTITLG 399 9999887761555577777..***********87****** PP CBM35.hmm 107 s..dwGwi.nldslel 119 s + G+ +d++el 484202|XylFL1651_GeneCatalog_proteins_20190321.aa.fasta|GH43_25|GH43_25|CBM35 400 SlgEDGFEtVVDAIEL 415 9996666437788775 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (419 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 46.22 // Query: 400985|HypEC38_3_GeneCatalog_proteins_20130613.aa.fasta|GH43_25|GH43_25|CBM35 [L=424] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-12 34.9 2.2 2.5e-12 34.3 0.1 2.2 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.3 0.07 0.14 60 107 .. 225 276 .. 190 290 .. 0.65 2 ! 34.3 0.1 1.2e-12 2.5e-12 1 118 [. 298 417 .. 298 418 .. 0.87 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.07 CBM35.hmm 60 stktlsvvvnGtkvsevtfpstgnwdtw.....gtaagtv 94 s++t +++v G+++ ++ +wd+ +++ + 400985|HypEC38_3_GeneCatalog_proteins_20130613.aa.fasta|GH43_25|GH43_25|CBM35 225 SQNTFELTVKGSQKTTYIYMGD-AWDSKggassNYVWAPL 263 4555666666666554333322.34332211125566667 PP CBM35.hmm 95 tLkaGkntitiks 107 + + G++t ti++ 400985|HypEC38_3_GeneCatalog_proteins_20130613.aa.fasta|GH43_25|GH43_25|CBM35 264 NINSGAHTATIDY 276 7777777777765 PP == domain 2 score: 34.3 bits; conditional E-value: 1.2e-12 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v ++ +++ ++ v g+ +++++vtf+ 400985|HypEC38_3_GeneCatalog_proteins_20130613.aa.fasta|GH43_25|GH43_25|CBM35 298 YEAEHAVLSGRTVVKDCSDCVSKRSVHGV-GSESEVTFHN 336 9*************************999.89999***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++++ ls++Y+ ++ ++ + ++vn++ + +++ ++ 400985|HypEC38_3_GeneCatalog_proteins_20130613.aa.fasta|GH43_25|GH43_25|CBM35 337 VTGTGDRQWLSFHYRVNNPEAGEAHIFVNDEPAVNISsLN 376 667889999**********************999776156 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 s + + t ++ +++tLk G+ ntit+++ + G+ +d 400985|HypEC38_3_GeneCatalog_proteins_20130613.aa.fasta|GH43_25|GH43_25|CBM35 377 SRAGYHT--STPVQLTLKRGDvNTITFGAtgSDGFEvAVD 414 6688888..***********77******988666533777 PP CBM35.hmm 116 sle 118 +e 400985|HypEC38_3_GeneCatalog_proteins_20130613.aa.fasta|GH43_25|GH43_25|CBM35 415 GIE 417 776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (424 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 129.13 // Query: 1011393|Rorror1_GeneCatalog_proteins_20190202.aa.fasta|GH43_25|GH43_25|CBM35 [L=438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (438 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 603.55 // Query: 961518|Mycbel1_GeneCatalog_proteins_20171013.aa.fasta|GH43_25|GH43_25|CBM35 [L=454] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-08 21.4 2.3 2.4e-08 21.4 2.3 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.1 0.078 0.16 54 88 .. 258 291 .. 243 322 .. 0.76 2 ! 21.4 2.3 1.2e-08 2.4e-08 26 107 .. 356 435 .. 330 444 .. 0.82 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.078 CBM35.hmm 54 YangtgstktlsvvvnGtkvsevtfpstgnwdtwg 88 an s+++ ++v+ Gt+ ++ f +wd+ g 961518|Mycbel1_GeneCatalog_proteins_20171013.aa.fasta|GH43_25|GH43_25|CBM35 258 SANTYNSQNSAELVIKGTSTTSYIFLGD-AWDSTG 291 5676667788899999999998888776.576654 PP == domain 2 score: 21.4 bits; conditional E-value: 1.2e-08 CBM35.hmm 26 vdglqaagdavtfnvdvpkaGsYelslrYangtgstktls 65 v ++ +++++vtfn + k+++ +s+ Ya ++ ++ + 961518|Mycbel1_GeneCatalog_proteins_20171013.aa.fasta|GH43_25|GH43_25|CBM35 356 VHNI-NSSSNVTFNNIIGKGDKQWVSFEYAVNNVTAGEAH 394 4444.78999****************************** PP CBM35.hmm 66 vvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntiti 105 vvvnG++ +++ ++ + +t+ + ++L++G nt+t+ 961518|Mycbel1_GeneCatalog_proteins_20171013.aa.fasta|GH43_25|GH43_25|CBM35 395 VVVNGGAPVNLSQLNSRAGHY-STVPVALELQKGVNTLTF 433 *****9988877777754444.78***************9 PP CBM35.hmm 106 ks 107 ++ 961518|Mycbel1_GeneCatalog_proteins_20171013.aa.fasta|GH43_25|GH43_25|CBM35 434 GA 435 87 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (454 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 54.37 // Query: 1662186|Mycmet1_GeneCatalog_proteins_20180505.aa.fasta|GH43_25|GH43_25|CBM35 [L=415] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-07 18.7 0.9 1.7e-07 18.7 0.9 2.3 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.0 0.26 0.52 87 108 .. 29 52 .. 23 59 .. 0.77 2 ? -2.4 0.0 0.29 0.58 58 80 .. 229 251 .. 220 261 .. 0.74 3 ! 18.7 0.9 8.5e-08 1.7e-07 30 107 .. 317 393 .. 300 405 .. 0.80 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.26 CBM35.hmm 87 wgtaagtvtLkaGkntitiks..d 108 w+++ g L G + i+++ 1662186|Mycmet1_GeneCatalog_proteins_20180505.aa.fasta|GH43_25|GH43_25|CBM35 29 WTDTNGAKILAHGGHVIKVGTtfY 52 667888889999999999987444 PP == domain 2 score: -2.4 bits; conditional E-value: 0.29 CBM35.hmm 58 tgstktlsvvvnGtkvsevtfps 80 s+k+ ++v+ Gt+ ++ f 1662186|Mycmet1_GeneCatalog_proteins_20180505.aa.fasta|GH43_25|GH43_25|CBM35 229 YNSQKSAELVITGTSTTTYIFLG 251 45678888999998888777755 PP == domain 3 score: 18.7 bits; conditional E-value: 8.5e-08 CBM35.hmm 30 qaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvn 69 +++++vtf+ + ++++ +sl+Y+ ++ ++ + v+vn 1662186|Mycmet1_GeneCatalog_proteins_20180505.aa.fasta|GH43_25|GH43_25|CBM35 317 VNPSSNVTFTNVIGNGDKQWVSLKYSVSNVTAGEAHVSVN 356 388999****999*************************** PP CBM35.hmm 70 Gtkvsevt.fpst.gnwdtwgtaagtvtLkaGkntitiks 107 G++ +++ ++s g + +t+ + +Lk+G+nt+t++ 1662186|Mycmet1_GeneCatalog_proteins_20180505.aa.fasta|GH43_25|GH43_25|CBM35 357 GAAPINLSeLNSRaGHF---TTVPVAPSLKKGANTLTFGT 393 **977554155553333...469999***********987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (415 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 150.65 // Query: 364295|Linin1_GeneCatalog_proteins_20141206.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-10 27.4 0.1 1.4e-09 25.4 0.0 2.2 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.9 0.1 0.2 0.4 68 85 .. 280 296 .. 236 305 .. 0.59 2 ! 25.4 0.0 7e-10 1.4e-09 1 117 [. 313 431 .. 313 433 .. 0.87 Alignments for each domain: == domain 1 score: -1.9 bits; conditional E-value: 0.2 CBM35.hmm 68 vnGtkvsevtfpstgnwd 85 v+ +k+++vt++ ++w+ 364295|Linin1_GeneCatalog_proteins_20141206.aa.fasta|GH43_25|GH43_25|CBM35 280 VD-SKNKKVTLEYHAQWK 296 33.333455666665555 PP == domain 2 score: 25.4 bits; conditional E-value: 7e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a+++g +v + + ++ v ++ +++++vtf+ 364295|Linin1_GeneCatalog_proteins_20141206.aa.fasta|GH43_25|GH43_25|CBM35 313 YEAEHAEISGKAVARDCDHCLSKRGVHNI-DPSSEVTFRN 351 9*************************999.99*******9 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 + +G+ ++++Y+ +++ + + v+vn++ + +++ + 364295|Linin1_GeneCatalog_proteins_20141206.aa.fasta|GH43_25|GH43_25|CBM35 352 VAGLGGRQWVQFHYRVADKFAGEAHVFVNDEPAVNISSLN 391 99*****************************999877666 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiks...dwGwinld 115 + + ++ ++++L++G+ ntit++ + i ld 364295|Linin1_GeneCatalog_proteins_20141206.aa.fasta|GH43_25|GH43_25|CBM35 392 HrAGCHD--VVPIELNLREGAvNTITFGTsgsTEAGIVLD 429 5266666..9**********87*****9866533334455 PP CBM35.hmm 116 sl 117 + 364295|Linin1_GeneCatalog_proteins_20141206.aa.fasta|GH43_25|GH43_25|CBM35 430 GI 431 55 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 93.50 // Query: 503429|Hypfra2_GeneCatalog_proteins_20191031.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-13 36.6 2.6 6.9e-12 32.8 0.1 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.4 0.5 0.0046 0.0093 51 108 .. 228 289 .. 188 301 .. 0.73 2 ! 32.8 0.1 3.5e-12 6.9e-12 1 118 [. 310 429 .. 310 430 .. 0.85 Alignments for each domain: == domain 1 score: 3.4 bits; conditional E-value: 0.0046 CBM35.hmm 51 slrYangtgstktlsvvvnGtkvsevtfpstgnwdtw... 87 + +n gs++t +++v G+++ +++ ++wd+ 503429|Hypfra2_GeneCatalog_proteins_20191031.aa.fasta|GH43_25|GH43_25|CBM35 228 APQAQNTYGSQNTHELTVKGSQKT-THIYMGDAWDSKgga 266 555566677888889999887755.444444455543222 PP CBM35.hmm 88 ..gtaagtvtLkaGkntitiksd 108 +++ ++ + G+++++i++ 503429|Hypfra2_GeneCatalog_proteins_20191031.aa.fasta|GH43_25|GH43_25|CBM35 267 ssNYVWAPMNINSGSHSVQIDYH 289 23678889999999999999873 PP == domain 2 score: 32.8 bits; conditional E-value: 3.5e-12 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v + +++ ++ v g+ ++++ vtf+ 503429|Hypfra2_GeneCatalog_proteins_20191031.aa.fasta|GH43_25|GH43_25|CBM35 310 YEAEHAVLSGKTVVRDCSDCVSKRAVHGV-SDTSDVTFQN 348 9*************************999.7777888885 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++ + ls++Y+ ++ ++ + ++vn++ + +++ ++ 503429|Hypfra2_GeneCatalog_proteins_20191031.aa.fasta|GH43_25|GH43_25|CBM35 349 VTGTGSRQWLSFHYRVNNPEAGEAHIFVNDEPAINISsLN 388 557888899**********************999776155 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaG.kntitiks..dwGwi.nld 115 s + + t ++ +++tLk G +nti++++ + G+ +d 503429|Hypfra2_GeneCatalog_proteins_20191031.aa.fasta|GH43_25|GH43_25|CBM35 389 SRAGYHT--STPIQLTLKRGdANTISFGAtgSDGFEvAVD 426 5588888..***********559*****988666533777 PP CBM35.hmm 116 sle 118 +e 503429|Hypfra2_GeneCatalog_proteins_20191031.aa.fasta|GH43_25|GH43_25|CBM35 427 GIE 429 766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.70 // Query: 418153|Mycalb1_GeneCatalog_proteins_20180325.aa.fasta|GH43_25|GH43_25|CBM35 [L=438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-08 21.2 3.1 2.9e-08 21.2 3.1 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.3 0.1 0.26 0.52 58 86 .. 243 270 .. 220 278 .. 0.76 2 ! 21.2 3.1 1.4e-08 2.9e-08 26 107 .. 337 416 .. 305 423 .. 0.84 Alignments for each domain: == domain 1 score: -2.3 bits; conditional E-value: 0.26 CBM35.hmm 58 tgstktlsvvvnGtkvsevtfpstgnwdt 86 s+++ ++v+ Gt+ ++ f +wd+ 418153|Mycalb1_GeneCatalog_proteins_20180325.aa.fasta|GH43_25|GH43_25|CBM35 243 YNSQNSAELVIKGTSMTSYIFLGD-AWDS 270 456677888999999888887766.5666 PP == domain 2 score: 21.2 bits; conditional E-value: 1.4e-08 CBM35.hmm 26 vdglqaagdavtfnvdvpkaGsYelslrYangtgstktls 65 v ++ +++++vtf+ v +++ +s++Y ++ ++ + 418153|Mycalb1_GeneCatalog_proteins_20180325.aa.fasta|GH43_25|GH43_25|CBM35 337 VHNI-NSSSNVTFTNVVGRGDKQWVSFQYTVSNVTAGEAH 375 4444.78999****************************** PP CBM35.hmm 66 vvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntiti 105 v+vnG++ +++ ++ + +t+ + ++Lk+G+nt+t+ 418153|Mycalb1_GeneCatalog_proteins_20180325.aa.fasta|GH43_25|GH43_25|CBM35 376 VSVNGGAPVNLSQLNSRAGHY-STVPVALSLKQGSNTLTF 414 *****9988877777754444.78***************9 PP CBM35.hmm 106 ks 107 ++ 418153|Mycalb1_GeneCatalog_proteins_20180325.aa.fasta|GH43_25|GH43_25|CBM35 415 GA 416 87 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (438 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 155.99 // Query: 580618|Biscog1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 [L=438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (438 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 634.68 // Query: 649059|HyNC1633_2_GeneCatalog_proteins_20191103.aa.fasta|GH43_25|GH43_25|CBM35 [L=439] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-12 34.3 3.3 8.3e-11 29.4 0.0 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 4.5 1.3 0.0022 0.0044 54 109 .. 233 292 .. 199 304 .. 0.68 2 ! 29.4 0.0 4.2e-11 8.3e-11 1 118 [. 312 431 .. 312 432 .. 0.87 Alignments for each domain: == domain 1 score: 4.5 bits; conditional E-value: 0.0022 CBM35.hmm 54 YangtgstktlsvvvnGtkvsevtfpstgnwdtw.....g 88 +n gs++t +++v G+++ ++ +wd+ + 649059|HyNC1633_2_GeneCatalog_proteins_20191103.aa.fasta|GH43_25|GH43_25|CBM35 233 DQNTYGSQNTFELTVKGSQKTTYIYMGD-AWDSKggassN 271 5666677788888888888775544433.45543222237 PP CBM35.hmm 89 taagtvtLkaGkntitiksdw 109 ++ ++ + G++titi++ + 649059|HyNC1633_2_GeneCatalog_proteins_20191103.aa.fasta|GH43_25|GH43_25|CBM35 272 YVWAPMNINSGAHTITIDYHT 292 888999***********9843 PP == domain 2 score: 29.4 bits; conditional E-value: 4.2e-11 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v + +++ ++ v g+ ++ ++vtf+ 649059|HyNC1633_2_GeneCatalog_proteins_20191103.aa.fasta|GH43_25|GH43_25|CBM35 312 YEAEHAVLSGRTVVRDCSDCVSKRAVHGV-SDASEVTFHN 350 9*************************999.788899**96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 ++ + ls++Y+ g+ ++ + + vn++ + +++ + 649059|HyNC1633_2_GeneCatalog_proteins_20191103.aa.fasta|GH43_25|GH43_25|CBM35 351 ITGTGSRQWLSFHYSVGSPEAGEAYILVNDEPAVNISSLN 390 667888899**********************999876555 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 + + + ++ ++++Lk G+ ntit+++ + G+ +d 649059|HyNC1633_2_GeneCatalog_proteins_20191103.aa.fasta|GH43_25|GH43_25|CBM35 391 SrAGYHA--STPVQLNLKRGDvNTITFGAigSDGFEaAVD 428 5266666..***********77*****9988777654677 PP CBM35.hmm 116 sle 118 +e 649059|HyNC1633_2_GeneCatalog_proteins_20191103.aa.fasta|GH43_25|GH43_25|CBM35 429 GIE 431 665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (439 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 136.53 // Query: 335126|KdCBS826_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 [L=414] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (414 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 663.39 // Query: 309040|XylarbFL1030_GeneCatalog_proteins_20190320.aa.fasta|GH43_25|GH43_25|CBM35 [L=412] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (412 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 744.50 // Query: 1140570|Mycfil1_GeneCatalog_proteins_20171109.aa.fasta|GH43_25|GH43_25|CBM35 [L=434] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-08 21.0 0.7 3.4e-08 21.0 0.7 2.6 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.0 0.45 0.9 87 107 .. 29 49 .. 25 54 .. 0.79 2 ? -0.7 0.1 0.084 0.17 57 90 .. 241 273 .. 227 301 .. 0.76 3 ! 21.0 0.7 1.7e-08 3.4e-08 28 108 .. 338 418 .. 319 429 .. 0.80 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.45 CBM35.hmm 87 wgtaagtvtLkaGkntitiks 107 w+++ g L G + i+++ 1140570|Mycfil1_GeneCatalog_proteins_20171109.aa.fasta|GH43_25|GH43_25|CBM35 29 WTDTSGAKILAHGGHVIKVGT 49 667888889999999999876 PP == domain 2 score: -0.7 bits; conditional E-value: 0.084 CBM35.hmm 57 gtgstktlsvvvnGtkvsevtfpstgnwdtwgta 90 s+++ ++v+ Gt+ ++ f +wd+ gt 1140570|Mycfil1_GeneCatalog_proteins_20171109.aa.fasta|GH43_25|GH43_25|CBM35 241 TYNSQNSAELVIKGTSTTTYVFLGD-AWDSTGTD 273 4456778889999999998888776.67776554 PP == domain 3 score: 21.0 bits; conditional E-value: 1.7e-08 CBM35.hmm 28 glqaagdavtfnvdvpkaGsYelslrYangtgstktlsvv 67 ++ +++++vtf+ ++++ +s++Y ++ ++ + v+ 1140570|Mycfil1_GeneCatalog_proteins_20171109.aa.fasta|GH43_25|GH43_25|CBM35 338 NI-NSSSNVTFANVLGNGDKQWVSFKYTVSNVTAGEAHVS 376 44.78899***9888999999******************* PP CBM35.hmm 68 vnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitiks 107 vnG++ +++ ++ + ++t+ + + Lk+G+nt+t+++ 1140570|Mycfil1_GeneCatalog_proteins_20171109.aa.fasta|GH43_25|GH43_25|CBM35 377 VNGAAPVNLSTLNSR-AGHFSTVPVALALKKGANTLTFGA 415 ****98866655552.333456****************98 PP CBM35.hmm 108 ..d 108 d 1140570|Mycfil1_GeneCatalog_proteins_20171109.aa.fasta|GH43_25|GH43_25|CBM35 416 sgD 418 554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (434 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 55.55 // Query: 1045375|Myccro1_GeneCatalog_proteins_20171013.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-06 15.4 2.2 1.8e-06 15.4 2.2 2.7 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.0 0.24 0.48 87 107 .. 29 49 .. 24 56 .. 0.81 2 ? -1.8 0.1 0.19 0.38 60 87 .. 244 270 .. 227 308 .. 0.55 3 ! 15.4 2.2 9e-07 1.8e-06 26 107 .. 336 415 .. 301 424 .. 0.82 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.24 CBM35.hmm 87 wgtaagtvtLkaGkntitiks 107 w+++ g L G + i+++s 1045375|Myccro1_GeneCatalog_proteins_20171013.aa.fasta|GH43_25|GH43_25|CBM35 29 WSDTSGAKILAHGGHVIKVGS 49 7778899999*******9987 PP == domain 2 score: -1.8 bits; conditional E-value: 0.19 CBM35.hmm 60 stktlsvvvnGtkvsevtfpstgnwdtw 87 s+++ ++v+ G++ ++ f +wd 1045375|Myccro1_GeneCatalog_proteins_20171013.aa.fasta|GH43_25|GH43_25|CBM35 244 SQNSAELVITGSSTTSYLFLGD-AWDAN 270 4555566666666665555444.34443 PP == domain 3 score: 15.4 bits; conditional E-value: 9e-07 CBM35.hmm 26 vdglqaagdavtfnvdvpkaGsYelslrYangtgstktls 65 v ++ +++++vtf+ v +++ +s++Y ++ ++ + 1045375|Myccro1_GeneCatalog_proteins_20171013.aa.fasta|GH43_25|GH43_25|CBM35 336 VHNI-NSSSNVTFSNIVGRGEKQWVSFKYTVSNVTAGEAH 374 4444.78899****************************** PP CBM35.hmm 66 vvvnGtkvsevt.fpstgnwdtwgtaagtvtLkaGkntit 104 v+vnG+ +++ ++s + + + + ++Lk+G+nt+t 1045375|Myccro1_GeneCatalog_proteins_20171013.aa.fasta|GH43_25|GH43_25|CBM35 375 VSVNGGPPINLSeLNSRAGHH--SNVPVVLELKNGANTLT 412 *****9987655155554444..5999************* PP CBM35.hmm 105 iks 107 +++ 1045375|Myccro1_GeneCatalog_proteins_20171013.aa.fasta|GH43_25|GH43_25|CBM35 413 FGA 415 987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 53.65 // Query: 447738|Photr1_GeneCatalog_proteins_20140424.aa.fasta|GH43_25|GH43_25|CBM35 [L=445] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-08 20.2 3.9 1.1e-07 19.2 0.2 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.7 0.4 0.015 0.03 14 71 .. 257 314 .. 241 317 .. 0.72 2 ! 19.2 0.2 5.7e-08 1.1e-07 1 107 [. 318 423 .. 318 441 .. 0.82 Alignments for each domain: == domain 1 score: 1.7 bits; conditional E-value: 0.015 CBM35.hmm 14 ntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslr 53 +++ y G+++v+g a ++++ +v ++ + +l+l 447738|Photr1_GeneCatalog_proteins_20140424.aa.fasta|GH43_25|GH43_25|CBM35 257 AKSTYIYMGDSWVKGGGAGSGYMWSPMTV-DSKNRKLTLD 295 56778899999999886666665555565.5578889999 PP CBM35.hmm 54 Yang.tgstktlsvvvnGt 71 Y + + + kt +v+v ++ 447738|Photr1_GeneCatalog_proteins_20140424.aa.fasta|GH43_25|GH43_25|CBM35 296 YHPQwKINVKTGEVSVPKK 314 9887777888888877655 PP == domain 2 score: 19.2 bits; conditional E-value: 5.7e-08 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAedas+ g +v ++ + ++ v ++ ++++ vtf+ 447738|Photr1_GeneCatalog_proteins_20140424.aa.fasta|GH43_25|GH43_25|CBM35 318 YEAEDASVVGRAVVADCEHCLSRRGVHKF-SSDSVVTFYN 356 9*********99*****************.6666788875 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 +Gs ++l+Y ++ ++ +l v+vn++ + +v+ + 447738|Photr1_GeneCatalog_proteins_20140424.aa.fasta|GH43_25|GH43_25|CBM35 357 VTGLGGSQWVQLHYHVANPDAGELYVTVNDGIAYNVSSLN 396 55789***********************999988776555 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaG.kntitiks 107 + + + + ++++L++G nti+++ 447738|Photr1_GeneCatalog_proteins_20140424.aa.fasta|GH43_25|GH43_25|CBM35 397 SqAGYY--DIVPVELNLREGpVNTISFGV 423 514444..5899********559999988 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (445 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 139.82 // Query: 587335|Xylcur114988_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 [L=420] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (420 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 489.20 // Query: 185693|Favcal1_2_GeneCatalog_proteins_20220405.aa.fasta|GH43_25|GH43_25|CBM35 [L=438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-08 20.5 1.7 1.1e-07 19.2 1.3 2.0 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.2 1.3 5.7e-08 1.1e-07 25 107 .. 336 416 .. 316 433 .. 0.79 Alignments for each domain: == domain 1 score: 19.2 bits; conditional E-value: 5.7e-08 CBM35.hmm 25 fvdglqaagdavtfnvdvpkaGsYelslrYangtgstktl 64 v ++ +++++vtf+ v +++ +s+ Y ++ ++ + 185693|Favcal1_2_GeneCatalog_proteins_20220405.aa.fasta|GH43_25|GH43_25|CBM35 336 AVHNI-NSSSNVTFTNIVGRGEKQWISFEYTVSNVTAGEA 374 56555.88999***************************** PP CBM35.hmm 65 svvvnGtkvs.evtfpstgnwdtwgtaagtvtLkaGknti 103 v+vnG++ +++s + + ++t+ + + L++G+nt+ 185693|Favcal1_2_GeneCatalog_proteins_20220405.aa.fasta|GH43_25|GH43_25|CBM35 375 HVSVNGGAPVkLSELNSRA--GHYSTVPVALMLEKGTNTL 412 *****98865145555553..33358************** PP CBM35.hmm 104 tiks 107 t++ 185693|Favcal1_2_GeneCatalog_proteins_20220405.aa.fasta|GH43_25|GH43_25|CBM35 413 TFGT 416 *997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (438 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.52 // Query: 37942|Lennov1_GeneCatalog_proteins_20180802.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 600.13 // Query: 1557470|LraJLM1587_1_GeneCatalog_proteins_20190401.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 726.94 // Query: 383240|Pseve2_GeneCatalog_proteins_20160326.aa.fasta|GH43_25|GH43_25|CBM35 [L=440] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-10 27.2 0.9 4.6e-09 23.8 0.0 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.4 0.4 0.019 0.038 60 107 .. 239 290 .. 217 305 .. 0.59 2 ! 23.8 0.0 2.3e-09 4.6e-09 1 108 [. 312 420 .. 312 431 .. 0.85 Alignments for each domain: == domain 1 score: 1.4 bits; conditional E-value: 0.019 CBM35.hmm 60 stktlsvvvnGtkvsevtfpstgnwdtw.....gtaagtv 94 s++t ++++ G+++ ++ +wd+ +++ + 383240|Pseve2_GeneCatalog_proteins_20160326.aa.fasta|GH43_25|GH43_25|CBM35 239 SQNTFELTIKGSQATTYIYMGD-AWDSTggassNYVWLPM 277 5555566666666554333322.33333222225667777 PP CBM35.hmm 95 tLkaGkntitiks 107 + + G++ti++++ 383240|Pseve2_GeneCatalog_proteins_20160326.aa.fasta|GH43_25|GH43_25|CBM35 278 NINTGAKTIQLQY 290 7788888888776 PP == domain 2 score: 23.8 bits; conditional E-value: 2.3e-09 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAeda l+g sv + + ++ v q+ +++vtf+ 383240|Pseve2_GeneCatalog_proteins_20160326.aa.fasta|GH43_25|GH43_25|CBM35 312 YEAEDADLSGRSVVKGCDHCLSKRSV--HQGYSSEVTFRN 349 9*************************..6899******96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 ++ + ls++Y+ ++ ++ + + vn++ + +++ + 383240|Pseve2_GeneCatalog_proteins_20160326.aa.fasta|GH43_25|GH43_25|CBM35 350 VTGTGSKQWLSFHYRVSNPEAGEAHILVNDEPAINISSLN 389 667888899**********************999887666 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiks...d 108 + + + + + +++tLk G+ ntit++s + 383240|Pseve2_GeneCatalog_proteins_20160326.aa.fasta|GH43_25|GH43_25|CBM35 390 SrAGYHN--SIPVQLTLKPGDvNTITFGStgkE 420 6255555..***********77*****984433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (440 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 128.15 // Query: 486282|Amnli1_GeneCatalog_proteins_20140304.aa.fasta|GH43_25|GH43_25|CBM35 [L=435] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-09 25.2 0.2 8e-09 23.0 0.0 2.2 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.12 0.23 44 55 .. 281 292 .. 227 305 .. 0.56 2 ! 23.0 0.0 4e-09 8e-09 1 107 [. 313 417 .. 313 431 .. 0.85 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.12 CBM35.hmm 44 kaGsYelslrYa 55 ++G+ +++l Y 486282|Amnli1_GeneCatalog_proteins_20140304.aa.fasta|GH43_25|GH43_25|CBM35 281 DTGNKKVTLEYH 292 334444444444 PP == domain 2 score: 23.0 bits; conditional E-value: 4e-09 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAeda++ g ++ ++ a + ++ v ++ ++++avtf+ 486282|Amnli1_GeneCatalog_proteins_20140304.aa.fasta|GH43_25|GH43_25|CBM35 313 YEAEDAQIVGRAAVADCAHCLSKRGVHEI-TSDSAVTFHN 351 9*********999999999999999*999.88999****6 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 +G+ ++++Y++ + ++ + v+vn++ + +++ + 486282|Amnli1_GeneCatalog_proteins_20140304.aa.fasta|GH43_25|GH43_25|CBM35 352 VTGLGGRQWVQFHYRQ-SREAGEAHVFVNDEPAVNISSLN 390 66899***********.8*************999776555 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiks 107 + + + + ++++L++G+ n+it++ 486282|Amnli1_GeneCatalog_proteins_20140304.aa.fasta|GH43_25|GH43_25|CBM35 391 HrAGYHD--IVPIELNLREGAvNKITFGT 417 5266776..999********779999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (435 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 132.07 // Query: 1164275|Myccro1_GeneCatalog_proteins_20171013.aa.fasta|GH43_25|GH43_25|CBM35 [L=435] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-07 17.8 1.1 3.2e-07 17.8 1.1 2.4 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.41 0.83 87 107 .. 24 44 .. 21 50 .. 0.79 2 ? -2.3 0.3 0.27 0.54 89 89 .. 266 266 .. 218 300 .. 0.54 3 ! 17.8 1.1 1.6e-07 3.2e-07 29 107 .. 339 415 .. 329 422 .. 0.83 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.41 CBM35.hmm 87 wgtaagtvtLkaGkntitiks 107 w+++ g L G + i+++s 1164275|Myccro1_GeneCatalog_proteins_20171013.aa.fasta|GH43_25|GH43_25|CBM35 24 WSDTSGAKILAPGGHVIKVGS 44 666888889999****99987 PP == domain 2 score: -2.3 bits; conditional E-value: 0.27 CBM35.hmm 89 t 89 + 1164275|Myccro1_GeneCatalog_proteins_20171013.aa.fasta|GH43_25|GH43_25|CBM35 266 Y 266 1 PP == domain 3 score: 17.8 bits; conditional E-value: 1.6e-07 CBM35.hmm 29 lqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvv 68 + +++++vtf+ v +++ +s++Y ++ ++ + v+v 1164275|Myccro1_GeneCatalog_proteins_20171013.aa.fasta|GH43_25|GH43_25|CBM35 339 I-NTSSNVTFTDIVGRGETQWVSFKYTVSNVTAGEAHVSV 377 4.78999****999************************** PP CBM35.hmm 69 nGtkvsevt.fpstgnwdtwgtaagtvtLkaGkntitiks 107 nG++ +++ ++s + +t+ + ++Lk+G+nt+t+++ 1164275|Myccro1_GeneCatalog_proteins_20171013.aa.fasta|GH43_25|GH43_25|CBM35 378 NGGAPINLSeLNSRAGHH--STVPVALELKNGANTLTFGA 415 *99987555155554444..59***************987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (435 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.58 // Query: 397926|Echmac1_GeneCatalog_proteins_20220225.aa.fasta|GH43_25|GH43_25|CBM35 [L=407] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (407 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 385.72 // Query: 379446|Karrh1_GeneCatalog_proteins_20140225.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-08 20.6 0.9 1.4e-07 19.0 0.1 2.2 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.12 0.25 15 55 .. 255 294 .. 235 308 .. 0.53 2 ! 19.0 0.1 6.9e-08 1.4e-07 1 118 [. 315 432 .. 315 433 .. 0.82 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 15 tnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrY 54 +++ y G+++ ++ ++++v + ++v+++G+ +l+l Y 379446|Karrh1_GeneCatalog_proteins_20140225.aa.fasta|GH43_25|GH43_25|CBM35 255 KTTYIYMGDSWDSKGGPDSNYVWLPIKVDTSGK-KLTLEY 293 333444444444444444455555566655554.355555 PP CBM35.hmm 55 a 55 379446|Karrh1_GeneCatalog_proteins_20140225.aa.fasta|GH43_25|GH43_25|CBM35 294 H 294 4 PP == domain 2 score: 19.0 bits; conditional E-value: 6.9e-08 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe a+l+g ++ t+ + ++ v +l + ++ v+f 379446|Karrh1_GeneCatalog_proteins_20140225.aa.fasta|GH43_25|GH43_25|CBM35 315 YEAELATLDGRAAITQCEHCVSKRGVYQL-NGDGVVRFGN 353 9*********9999999999999999888.6667799985 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 +G ++++Y ++s++ v+vn++++ +++ ++ 379446|Karrh1_GeneCatalog_proteins_20140225.aa.fasta|GH43_25|GH43_25|CBM35 354 VTGLGGLQWVQFHYHVPPSSEAGAWVSVNDGSAVNISeLN 393 55789***********************888777665166 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaG.kntitiksdwGw.inldsl 117 + + + ++ +++ Lk+G +nt+t++ + G i ld + 379446|Karrh1_GeneCatalog_proteins_20140225.aa.fasta|GH43_25|GH43_25|CBM35 394 HRAGYHS--VVPIQLDLKEGsENTVTFGTSGGEgIVLDGI 431 6677777..***********559*****966641357776 PP CBM35.hmm 118 e 118 e 379446|Karrh1_GeneCatalog_proteins_20140225.aa.fasta|GH43_25|GH43_25|CBM35 432 E 432 6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 153.61 // Query: 1391480|LboTFB7810_1_GeneCatalog_proteins_20191105.aa.fasta|GH43_25|GH43_25|CBM35 [L=448] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (448 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 650.33 // Query: 353400|XylFL1042_GeneCatalog_proteins_20190320.aa.fasta|GH43_25|GH43_25|CBM35 [L=408] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (408 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 633.51 // Query: 428685|Parsp1_GeneCatalog_proteins_20141011.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 660.28 // Query: 1074711|Mychae1_GeneCatalog_proteins_20170323.aa.fasta|GH43_25|GH43_25|CBM35 [L=424] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-08 21.7 2.4 6.1e-08 20.1 2.4 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.1 2.4 3e-08 6.1e-08 16 113 .. 306 407 .. 295 411 .. 0.78 Alignments for each domain: == domain 1 score: 20.1 bits; conditional E-value: 3e-08 CBM35.hmm 16 nhagysGsgfvdglq.aagdavtfnvdvpkaGsYelslrY 54 n++ ++ +v+g + +++++vtf+ + +++ +s++Y 1074711|Mychae1_GeneCatalog_proteins_20170323.aa.fasta|GH43_25|GH43_25|CBM35 306 NTTFHAADAIVGGSAvDSSSNVTFTNVMGRGDKQWVSFQY 345 555666677777776467788****888999999****** PP CBM35.hmm 55 angtgstktlsvvvnGtkvs.evtfpstgnwdtwgtaagt 93 ++ ++ + v+vnG++ +++s + + ++t+ + 1074711|Mychae1_GeneCatalog_proteins_20170323.aa.fasta|GH43_25|GH43_25|CBM35 346 TVSNVTAGEAHVSVNGGEPInLSDLNSRA--GHYSTVPVA 383 ***************99877244555553..33358**** PP CBM35.hmm 94 vtLkaGkntitiks....dwGwin 113 ++Lk+G+nt+t+++ ++G n 1074711|Mychae1_GeneCatalog_proteins_20170323.aa.fasta|GH43_25|GH43_25|CBM35 384 LSLKQGANTLTFGAtaadEQGLSN 407 ************997776667666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (424 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 164.72 // Query: 308070|XylFL0043_GeneCatalog_proteins_20190321.aa.fasta|GH43_25|GH43_25|CBM35 [L=415] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (415 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 568.87 // Query: 470213|Hyprub1_GeneCatalog_proteins_20190611.aa.fasta|GH43_25|GH43_25|CBM35 [L=435] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-13 36.5 5.4 7.2e-12 32.8 0.2 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.4 1.2 0.0011 0.0023 50 108 .. 226 288 .. 198 302 .. 0.67 2 ! 32.8 0.2 3.6e-12 7.2e-12 1 117 [. 309 427 .. 309 429 .. 0.85 Alignments for each domain: == domain 1 score: 5.4 bits; conditional E-value: 0.0011 CBM35.hmm 50 lslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw.. 87 + + +n s++t +++v G+++ ++ +wd+ 470213|Hyprub1_GeneCatalog_proteins_20190611.aa.fasta|GH43_25|GH43_25|CBM35 226 IAPQAQNTYNSQNTFELTVAGSQKTTYIYMGD-SWDSKgg 264 55555665566777788888877664443333.4544322 PP CBM35.hmm 88 ...gtaagtvtLkaGkntitiksd 108 +++ ++ +aG++t+ti++ 470213|Hyprub1_GeneCatalog_proteins_20190611.aa.fasta|GH43_25|GH43_25|CBM35 265 assNYVWAPMNINAGAHTVTIDYH 288 2237888999***********983 PP == domain 2 score: 32.8 bits; conditional E-value: 3.6e-12 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v ++ +++ + v g+ + ++vtf+ 470213|Hyprub1_GeneCatalog_proteins_20190611.aa.fasta|GH43_25|GH43_25|CBM35 309 YEAEHAVLSGRTVVKDCSNCLTKRSVHGV-RDASEVTFHN 347 9*************************999.7888999996 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++ + ls++Y+ ++ ++ + ++vn++ + +++ ++ 470213|Hyprub1_GeneCatalog_proteins_20190611.aa.fasta|GH43_25|GH43_25|CBM35 348 VTGTGSRQWLSFHYKVNSPEAGEAHIYVNDEPAVNISsLN 387 557888899**********************999765166 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 s + + t ++ ++++L+aG+ ntit+++ +G+ +d 470213|Hyprub1_GeneCatalog_proteins_20190611.aa.fasta|GH43_25|GH43_25|CBM35 388 SLAGYHT--STPVQLNLRAGDvNTITFGAtgGEGFEvAVD 425 6699999..***********77******955444422666 PP CBM35.hmm 116 sl 117 + 470213|Hyprub1_GeneCatalog_proteins_20190611.aa.fasta|GH43_25|GH43_25|CBM35 426 GI 427 55 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (435 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 129.42 // Query: 800745|Thiar1_GeneCatalog_proteins_20131210.aa.fasta|GH43_25|GH43_25|CBM35 [L=435] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (435 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 662.20 // Query: 345284|Anntru1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 [L=433] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-11 29.7 1.0 2.1e-10 28.0 0.0 2.3 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.7 0.3 0.084 0.17 59 86 .. 234 260 .. 197 299 .. 0.52 2 ! 28.0 0.0 1.1e-10 2.1e-10 1 118 [. 308 427 .. 308 428 .. 0.86 Alignments for each domain: == domain 1 score: -0.7 bits; conditional E-value: 0.084 CBM35.hmm 59 gstktlsvvvnGtkvsevtfpstgnwdt 86 gs++t +++v G++ ++ +wd+ 345284|Anntru1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 234 GSQNTFELTVAGSQTTTYIYMGD-AWDS 260 44445555555554443322222.2332 PP == domain 2 score: 28.0 bits; conditional E-value: 1.1e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g sv + ++ + v g+ +++++vtf+ 345284|Anntru1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 308 YEAEHAVLSGRSVVRDCHDCLTKRAVHGV-GDSSEVTFHN 346 9*************************999.99999***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 ++ + ls++Y+ ++ ++ + ++vn++ + +++ + 345284|Anntru1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 347 VTGTGSRQWLSFHYRVSNPEAGEAHIYVNDEPAVNISSLN 386 667888899**********************999876655 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 + + + + ++ +++ Lk G+ ntit+++ + G+ +d 345284|Anntru1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 387 SrAGYHS--STPVELLLKRGDvNTITFGAtgSDGFEvAVD 424 5266666..9**********77******988666533777 PP CBM35.hmm 116 sle 118 +e 345284|Anntru1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 425 GIE 427 776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (433 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 129.37 // Query: 703171|Acema1_GeneCatalog_proteins_20150224.aa.fasta|GH43_25|GH43_25|CBM35 [L=368] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-08 20.6 0.2 4.9e-07 17.2 0.0 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.1 0.1 0.048 0.095 11 39 .. 70 98 .. 65 111 .. 0.82 2 ! 17.2 0.0 2.5e-07 4.9e-07 1 107 [. 246 347 .. 246 360 .. 0.80 Alignments for each domain: == domain 1 score: 0.1 bits; conditional E-value: 0.048 CBM35.hmm 11 vsvntnhagysGsgfvdglqaagdavtfn 39 ++v+ n + ++++v+g+++ g+avt+ 703171|Acema1_GeneCatalog_proteins_20150224.aa.fasta|GH43_25|GH43_25|CBM35 70 SQVDRNIQALVSTQMVGGYATRGAAVTIP 98 67788888889999************986 PP == domain 2 score: 17.2 bits; conditional E-value: 2.5e-07 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a ++g + ys + f ++g++vtf+ 703171|Acema1_GeneCatalog_proteins_20150224.aa.fasta|GH43_25|GH43_25|CBM35 246 YEAESAIISGR---AGMHPYSDDAFT---VDSGSQVTFQN 279 89999999996...233456666666...5889*****95 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvs.evtfp 79 ++ +s++Y +++ ++ + v++n++++ ++++ 703171|Acema1_GeneCatalog_proteins_20150224.aa.fasta|GH43_25|GH43_25|CBM35 280 VTGTGYPQWISIHYIANNPEAGEAHVFINDESQPtNISLL 319 556666789***********************99888888 PP CBM35.hmm 80 st.gnwdtwgtaagtvtLkaGk.ntitiks 107 ++ + + ++ +++tLk G+ ntit+++ 703171|Acema1_GeneCatalog_proteins_20150224.aa.fasta|GH43_25|GH43_25|CBM35 320 NSrEGYH--KVIPVKLTLKLGDvNTITFGA 347 8835555..5***********779**9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (368 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 150.30 // Query: 159853|Aspala1_GeneCatalog_proteins_20160910.aa.fasta|GH43_25|GH43_25|CBM35 [L=305] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-09 22.8 0.6 3.3e-08 21.0 0.0 2.1 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.6 0.0 0.17 0.34 32 49 .. 37 54 .. 31 64 .. 0.80 2 ? -3.9 0.0 0.86 1.7 58 74 .. 106 122 .. 101 127 .. 0.63 3 ! 21.0 0.0 1.7e-08 3.3e-08 1 107 [. 181 287 .. 181 299 .. 0.84 Alignments for each domain: == domain 1 score: -1.6 bits; conditional E-value: 0.17 CBM35.hmm 32 agdavtfnvdvpkaGsYe 49 ++++v +v+v +aG Ye 159853|Aspala1_GeneCatalog_proteins_20160910.aa.fasta|GH43_25|GH43_25|CBM35 37 SDGTVGNRVNVLAAGAYE 54 556777889999999997 PP == domain 2 score: -3.9 bits; conditional E-value: 0.86 CBM35.hmm 58 tgstktlsvvvnGtkvs 74 g+++t ++v+ Gtk 159853|Aspala1_GeneCatalog_proteins_20160910.aa.fasta|GH43_25|GH43_25|CBM35 106 YGAQNTFELVIKGTKET 122 45566667777777755 PP == domain 3 score: 21.0 bits; conditional E-value: 1.7e-08 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAeda l+g ++ t+ + + v + +++++v fn 159853|Aspala1_GeneCatalog_proteins_20160910.aa.fasta|GH43_25|GH43_25|CBM35 181 YEAEDAILSGRAAVTSCGHCVNKRSVHRI-DHESEVVFNN 219 9*********999999999999999*999.5666777774 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvs..evtf 78 +++ +s++Y ++++t ++vn++ v ++ 159853|Aspala1_GeneCatalog_proteins_20160910.aa.fasta|GH43_25|GH43_25|CBM35 220 VTGTGEPEWVSFHYTVNNSTTGDAHIYVNDEPVPwnVSEL 259 446778899************************9856667 PP CBM35.hmm 79 pstgnwdtwgtaagtvtLkaG.kntitiks 107 +s + + + t+ +++ L+ G +nti++ + 159853|Aspala1_GeneCatalog_proteins_20160910.aa.fasta|GH43_25|GH43_25|CBM35 260 NSRAGYHQ--TVPVQLALRPGdSNTIRFAA 287 77777777..9**********559999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (305 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 128.21 // Query: 589580|Whamic1_GeneCatalog_proteins_20190712.aa.fasta|GH43_25|GH43_25|CBM35 [L=439] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-11 31.2 1.6 6.6e-11 29.7 0.0 2.4 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.8 0.3 0.095 0.19 60 93 .. 210 241 .. 154 274 .. 0.60 2 ? -1.2 0.2 0.12 0.25 28 29 .. 264 265 .. 230 304 .. 0.42 3 ! 29.7 0.0 3.3e-11 6.6e-11 1 109 [. 311 421 .. 311 431 .. 0.85 Alignments for each domain: == domain 1 score: -0.8 bits; conditional E-value: 0.095 CBM35.hmm 60 stktlsvvvnGtkvsevtfpstgnwdtwgtaagt 93 ++ +s ++nG + +++ +++ + ++ t 589580|Whamic1_GeneCatalog_proteins_20190712.aa.fasta|GH43_25|GH43_25|CBM35 210 NKVFTSTSINGPWTGGADVAPQAENTY--NSQNT 241 444455555555555444443332222..22222 PP == domain 2 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 28 gl 29 + 589580|Whamic1_GeneCatalog_proteins_20190712.aa.fasta|GH43_25|GH43_25|CBM35 264 KG 265 22 PP == domain 3 score: 29.7 bits; conditional E-value: 3.3e-11 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a+l+g +v ++ +++ ++ v g + +++vtf+ 589580|Whamic1_GeneCatalog_proteins_20190712.aa.fasta|GH43_25|GH43_25|CBM35 311 YEAEHAHLSGRAVVKECSDCLSRRSVHGA-NGDSEVTFRN 349 9*************************877.88889***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++ ls++Y++++ ++ + ++vn++ +++ ++ 589580|Whamic1_GeneCatalog_proteins_20190712.aa.fasta|GH43_25|GH43_25|CBM35 350 VTGTGSLQWLSFHYKANNPQAGEAHIFVNDEPPVNISsLN 389 667888999*********************9988665166 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks...dw 109 s + + t ++ +++ L+aG+ nti+++s d+ 589580|Whamic1_GeneCatalog_proteins_20190712.aa.fasta|GH43_25|GH43_25|CBM35 390 SRAGYHT--STPVQLRLEAGDvNTIKFGStgsDE 421 6688888..***********77*****9855444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (439 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.00 // Query: 875130|Mycepi1_GeneCatalog_proteins_20171002.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-07 17.8 1.8 4.4e-07 17.3 0.3 2.0 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.1 0.43 0.86 43 56 .. 84 97 .. 56 109 .. 0.63 2 ! 17.3 0.3 2.2e-07 4.4e-07 29 107 .. 339 415 .. 319 422 .. 0.87 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.43 CBM35.hmm 43 pkaGsYelslrYan 56 +G+Y+ ++ Y+ 875130|Mycepi1_GeneCatalog_proteins_20171002.aa.fasta|GH43_25|GH43_25|CBM35 84 AVTGMYRPKFIYSG 97 35677777777765 PP == domain 2 score: 17.3 bits; conditional E-value: 2.2e-07 CBM35.hmm 29 lqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvv 68 + +++++vtf+ ++++ + ++Y ++ ++ + v+v 875130|Mycepi1_GeneCatalog_proteins_20171002.aa.fasta|GH43_25|GH43_25|CBM35 339 I-NPSSNVTFTNVLGNGDKQWVAFKYTVSNITAGEAHVSV 377 4.78999***98889999999******************* PP CBM35.hmm 69 nGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitiks 107 nG++v +++ ++ + +t+ + ++L++G nt+t++ 875130|Mycepi1_GeneCatalog_proteins_20171002.aa.fasta|GH43_25|GH43_25|CBM35 378 NGGQVINLSALNSRAGHY-STVPVALSLREGPNTLTFGT 415 ******999988865555.89***************986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 172.34 // Query: 124214|ColoR110_1_GeneCatalog_proteins_20210506.aa.fasta|GH43_25|GH43_25|CBM35 [L=449] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (449 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 510.42 // Query: 134688|Hypmon1_GeneCatalog_proteins_20190301.aa.fasta|GH43_25|GH43_25|CBM35 [L=436] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-12 34.8 1.1 2.4e-11 31.1 0.0 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 2.0 0.3 0.012 0.025 65 108 .. 242 289 .. 218 303 .. 0.58 2 ! 31.1 0.0 1.2e-11 2.4e-11 1 118 [. 310 429 .. 310 430 .. 0.87 Alignments for each domain: == domain 1 score: 2.0 bits; conditional E-value: 0.012 CBM35.hmm 65 svvvnGtkvsevtfpstgnwdtw.....gtaagtvtLkaG 99 +++v G+++ +++ ++wd+ +++ ++ + G 134688|Hypmon1_GeneCatalog_proteins_20190301.aa.fasta|GH43_25|GH43_25|CBM35 242 ELTVKGSQKT-THIYMGDAWDSKggassNYVWAPMNINSG 280 5555554433.22222333333211112566666777777 PP CBM35.hmm 100 kntitiksd 108 +++++i++ 134688|Hypmon1_GeneCatalog_proteins_20190301.aa.fasta|GH43_25|GH43_25|CBM35 281 SHSVQIDYH 289 777777762 PP == domain 2 score: 31.1 bits; conditional E-value: 1.2e-11 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v + +++ ++ v g+ ++ ++vtf+ 134688|Hypmon1_GeneCatalog_proteins_20190301.aa.fasta|GH43_25|GH43_25|CBM35 310 YEAEHAVLSGRTVVRDCSDCLSKRSVHGV-GDASEVTFHN 348 9*************************999.8888999996 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++ + ls++Y+ ++ ++ + ++vn++ + +++ ++ 134688|Hypmon1_GeneCatalog_proteins_20190301.aa.fasta|GH43_25|GH43_25|CBM35 349 VTGTGARQWLSFHYRVNNPEAGEAHIFVNDEPAMNISsLN 388 667888999***********************99876155 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 s + + t ++ +++tLk G+ ntit+++ + G+ +d 134688|Hypmon1_GeneCatalog_proteins_20190301.aa.fasta|GH43_25|GH43_25|CBM35 389 SRAGYHT--STPVQLTLKPGDvNTITFGAtgSDGFEvAVD 426 5588888..***********77******988666533777 PP CBM35.hmm 116 sle 118 +e 134688|Hypmon1_GeneCatalog_proteins_20190301.aa.fasta|GH43_25|GH43_25|CBM35 427 GIE 429 776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (436 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 152.31 // Query: XDG07677.1|CBM35|GH43_25 [L=433] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-10 28.2 0.9 4.8e-10 26.9 0.0 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.13 0.25 60 77 .. 235 252 .. 198 299 .. 0.58 2 ! 26.9 0.0 2.4e-10 4.8e-10 1 108 [. 308 417 .. 308 428 .. 0.85 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.13 CBM35.hmm 60 stktlsvvvnGtkvsevt 77 s++t +++v G+++ ++ XDG07677.1|CBM35|GH43_25 235 SQNTFELTVAGSQATTYI 252 344444444444433222 PP == domain 2 score: 26.9 bits; conditional E-value: 2.4e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst.gnw 84 yeAe+a l+g +v + ++ + v g+ +++++vtf+ ++ + ls++Y+ ++ ++ + ++vn++ + +v+ ++ + + XDG07677.1|CBM35|GH43_25 308 YEAEHAVLSGRTVVRDCNECLTKRAVHGI-GDSSEVTFRNVTGTGARQWLSFHYRVNNPEAGEAHIYVNDEPAVNVSSLNSrAGY 391 9***************************9.99999***96667888999**********************99977655552666 PP CBM35.hmm 85 dtwgtaagtvtLkaGk.ntitiks...d 108 + ++ +++ Lk G+ ntit+++ d XDG07677.1|CBM35|GH43_25 392 HS--STPVELLLKRGDvNTITFGAtgsD 417 66..9**********779***9984433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (433 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 120.52 // Query: 374839|HyFL0543_1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 [L=375] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-11 30.3 5.4 9.7e-10 25.9 0.1 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.8 1.5 0.00082 0.0016 48 108 .. 164 228 .. 137 242 .. 0.68 2 ! 25.9 0.1 4.8e-10 9.7e-10 1 118 [. 249 368 .. 249 369 .. 0.84 Alignments for each domain: == domain 1 score: 5.8 bits; conditional E-value: 0.00082 CBM35.hmm 48 YelslrYangtgstktlsvvvnGtkvsevtfpstgnwdtw 87 ++ + +n gs++t +++v G+++ ++ +wd+ 374839|HyFL0543_1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 164 SDIAPQDQNTYGSQNTFELTVQGSQKTTYIYMGD-AWDSK 202 5555555676778888899999988775544443.45543 PP CBM35.hmm 88 .....gtaagtvtLkaGkntitiksd 108 +++ ++ +aG++t+ti++ 374839|HyFL0543_1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 203 ggassNYVWAPLNINAGAHTVTIDYH 228 222237888999***********983 PP == domain 2 score: 25.9 bits; conditional E-value: 4.8e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v ++ ++ ++ v g+ +++++vtf+ 374839|HyFL0543_1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 249 YEAEHAVLSGRTVVKDCNDCVSKRSVHGV-DSKSEVTFHN 287 9*************************999.7788999996 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++++ +s++Y+ ++ ++ + ++vn++ + +++ ++ 374839|HyFL0543_1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 288 VTGTGERQWFSFHYRVNNPEAGEAHIFVNDEPAVNISsLN 327 667888999**********************999776155 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 s + + t ++ +++tLk + ntit+++ + G+ +d 374839|HyFL0543_1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 328 SRAGYHT--STPVQLTLKRDDvNTITFGAtgSDGFEvAVD 365 5688888..999*****97644999999988666533777 PP CBM35.hmm 116 sle 118 +e 374839|HyFL0543_1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 366 GIE 368 666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (375 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 110.93 // Query: 325447|Hypfus1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 [L=434] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-12 34.4 4.1 4.8e-11 30.1 0.1 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.0 1.0 0.0015 0.003 55 108 .. 231 288 .. 198 301 .. 0.66 2 ! 30.1 0.1 2.4e-11 4.8e-11 1 117 [. 309 427 .. 309 429 .. 0.84 Alignments for each domain: == domain 1 score: 5.0 bits; conditional E-value: 0.0015 CBM35.hmm 55 angtgstktlsvvvnGtkvsevtfpstgnwdtw.....gt 89 +n gs++t +++v G+++ ++ +wd+ ++ 325447|Hypfus1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 231 QNTYGSQNTFELTVKGSQKTTYIYMGD-AWDSKggassNY 269 555666777778887777664443333.444432222367 PP CBM35.hmm 90 aagtvtLkaGkntitiksd 108 + ++ +aG++t++i++ 325447|Hypfus1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 270 VWAPMNINAGSHTVSIDYH 288 7888999999999999873 PP == domain 2 score: 30.1 bits; conditional E-value: 2.4e-11 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v ++ +++ ++ v g+ ++ ++vtf+ 325447|Hypfus1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 309 YEAEHAVLSGRTVVKDCSDCVSKRSVHGV-DDASEVTFHN 347 9*************************999.6778899996 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++ + ls++Y+ ++ ++ + ++vn++ + +++ ++ 325447|Hypfus1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 348 VTGTGSKQWLSFHYRVNSPEAGEAHIFVNDEPAVNISsLN 387 557888899**********************999776155 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 s + + t ++ +++ Lk G+ ntit+++ +G+ +d 325447|Hypfus1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 388 SRAGYHT--STPVELVLKRGDvNTITFGAtgGEGFEvAVD 425 6688888..9**********77******955444422666 PP CBM35.hmm 116 sl 117 + 325447|Hypfus1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 426 GI 427 55 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (434 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.17 // Query: 227361|Melpu1_GeneCatalog_proteins_20130415.aa.fasta|GH43_25|GH43_25|CBM35 [L=430] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-09 24.8 1.4 2.4e-08 21.4 0.0 2.7 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.4 0.0 0.58 1.2 32 49 .. 162 179 .. 155 179 .. 0.80 2 ? 1.3 0.3 0.021 0.042 3 58 .. 227 289 .. 225 299 .. 0.54 3 ! 21.4 0.0 1.2e-08 2.4e-08 1 119 [] 306 426 .. 306 426 .. 0.86 Alignments for each domain: == domain 1 score: -3.4 bits; conditional E-value: 0.58 CBM35.hmm 32 agdavtfnvdvpkaGsYe 49 +++++ +v+v ++G Ye 227361|Melpu1_GeneCatalog_proteins_20130415.aa.fasta|GH43_25|GH43_25|CBM35 162 SDGSIGSRVNVLAKGAYE 179 567788899999999995 PP == domain 2 score: 1.3 bits; conditional E-value: 0.021 CBM35.hmm 3 AedasltgvsvntnhagysGsgfv...dglqaagda...v 36 Ae+ ++++++ + +g s +++v d ++++g++ 227361|Melpu1_GeneCatalog_proteins_20130415.aa.fasta|GH43_25|GH43_25|CBM35 227 AEKTYNSQNTFELTVKGSSRTTYVymgDSWDSKGGEssnY 266 5666666666666666666666662222333333332235 PP CBM35.hmm 37 tfnvdvpkaGsYelslrYang.t 58 + v ++Gs +++l Y ++ + 227361|Melpu1_GeneCatalog_proteins_20130415.aa.fasta|GH43_25|GH43_25|CBM35 267 VWLPMVVDKGSKKVTLEYHAQwK 289 55556667788888888877544 PP == domain 3 score: 21.4 bits; conditional E-value: 1.2e-08 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 +eAe+a++ g ++ ++ + ++ v ++ ++++a+tf+ 227361|Melpu1_GeneCatalog_proteins_20130415.aa.fasta|GH43_25|GH43_25|CBM35 306 FEAEHAEIVGRAAVADCETCLSKRGVHQI-TSDSAITFRN 344 69********8888888888888889999.88999***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 +G+ ++++Y+ ++ ++ + v+vn++ + +++ + 227361|Melpu1_GeneCatalog_proteins_20130415.aa.fasta|GH43_25|GH43_25|CBM35 345 VTGLGGRQWVQFHYQVANRAAGEAHVFVNDEPAVNISALN 384 66899*****************************999999 PP CBM35.hmm 81 tgnwdtwgtaagtvtLkaGk.ntitiks...dwGwinlds 116 + g++ ++++L++G+ ntit+++ d i ld 227361|Melpu1_GeneCatalog_proteins_20130415.aa.fasta|GH43_25|GH43_25|CBM35 385 HRAGYH-GVVPIELELREGDvNTITFGMsgrDDAGIVLDG 423 855555.8***********77******9888555555777 PP CBM35.hmm 117 lel 119 +e+ 227361|Melpu1_GeneCatalog_proteins_20130415.aa.fasta|GH43_25|GH43_25|CBM35 424 IEV 426 765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (430 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.15 // Query: 441021|Annmor1_GeneCatalog_proteins_20190622.aa.fasta|GH43_25|GH43_25|CBM35 [L=434] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-10 29.0 1.1 3.1e-10 27.5 0.1 2.2 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.8 0.2 0.09 0.18 60 77 .. 235 252 .. 200 299 .. 0.56 2 ! 27.5 0.1 1.5e-10 3.1e-10 1 115 [. 308 424 .. 308 428 .. 0.85 Alignments for each domain: == domain 1 score: -0.8 bits; conditional E-value: 0.09 CBM35.hmm 60 stktlsvvvnGtkvsevt 77 s++t +++v G+k+ ++ 441021|Annmor1_GeneCatalog_proteins_20190622.aa.fasta|GH43_25|GH43_25|CBM35 235 SQNTFELTVAGSKATTYI 252 333344444444333222 PP == domain 2 score: 27.5 bits; conditional E-value: 1.5e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v + ++ + v g+ +++++vtf+ 441021|Annmor1_GeneCatalog_proteins_20190622.aa.fasta|GH43_25|GH43_25|CBM35 308 YEAEHAVLSGRTVVRDCNECLTKRAVHGV-SDSSEVTFHN 346 9*************************999.89999***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 ++ + ls++Y+ ++ ++ + ++vn++ + +++ + 441021|Annmor1_GeneCatalog_proteins_20190622.aa.fasta|GH43_25|GH43_25|CBM35 347 VTGTGARQWLSFHYRVNNPEAGEAHIYVNDEPAVNISSLN 386 667888999**********************999876655 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiks...dwGwinld 115 + + + + ++ +++ Lk G+ ntit+++ d + +d 441021|Annmor1_GeneCatalog_proteins_20190622.aa.fasta|GH43_25|GH43_25|CBM35 387 SrAGYHS--STPVELLLKRGDvNTITFGAtgsDDFEVAVD 424 5266666..9**********779****9855544455555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (434 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 125.58 // Query: 143316|LboTFB7829_1_GeneCatalog_proteins_20190713.aa.fasta|GH43_25|GH43_25|CBM35 [L=443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (443 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 622.44 // Query: 293416|HyFL1150_1_GeneCatalog_proteins_20190715.aa.fasta|GH43_25|GH43_25|CBM35 [L=435] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-13 35.8 5.5 5.3e-12 33.2 0.3 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 4.6 0.8 0.002 0.0039 55 108 .. 231 288 .. 198 301 .. 0.67 2 ! 33.2 0.3 2.7e-12 5.3e-12 1 110 [. 309 417 .. 309 429 .. 0.87 Alignments for each domain: == domain 1 score: 4.6 bits; conditional E-value: 0.002 CBM35.hmm 55 angtgstktlsvvvnGtkvsevtfpstgnwdtw.....gt 89 +n gs++t +++v G+++ ++ +wd+ ++ 293416|HyFL1150_1_GeneCatalog_proteins_20190715.aa.fasta|GH43_25|GH43_25|CBM35 231 QNTYGSQNTFELTVAGSQKTTYIYMGD-AWDSKggassNY 269 565667777788888777664444333.454432222367 PP CBM35.hmm 90 aagtvtLkaGkntitiksd 108 + ++ +aG++t+ti++ 293416|HyFL1150_1_GeneCatalog_proteins_20190715.aa.fasta|GH43_25|GH43_25|CBM35 270 VWAPLSINAGAHTVTIDYH 288 8889999********9983 PP == domain 2 score: 33.2 bits; conditional E-value: 2.7e-12 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v ++ + + ++ v g+ +++++vtf+ 293416|HyFL1150_1_GeneCatalog_proteins_20190715.aa.fasta|GH43_25|GH43_25|CBM35 309 YEAEHAVLSGRTVVKECSSCVSKRSVHGV-GDTSEVTFHN 347 9*************************999.99999***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 ++ + ls++Y+ ++ + + ++vn++ + +++ + 293416|HyFL1150_1_GeneCatalog_proteins_20190715.aa.fasta|GH43_25|GH43_25|CBM35 348 VTGTGSRQWLSFHYQVNNPEVGEAHIYVNDEPAVNISSLN 387 667888899***********************99888777 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiksdwG 110 t + + t ++ +++tL+aG+ ntit+++ G 293416|HyFL1150_1_GeneCatalog_proteins_20190715.aa.fasta|GH43_25|GH43_25|CBM35 388 TrAGYHT--STPVQLTLRAGDmNTITFGATGG 417 7577888..***********779****99555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (435 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 127.85 // Query: 529923|Porpun1_GeneCatalog_proteins_20190712.aa.fasta|GH43_25|GH43_25|CBM35 [L=410] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (410 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 554.39 // Query: 501835|Xylacu1_GeneCatalog_proteins_20190613.aa.fasta|GH43_25|GH43_25|CBM35 [L=420] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (420 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 629.64 // Query: 526224|Xylcube1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 [L=420] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-06 15.1 3.6 4.3e-06 14.2 0.1 2.3 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.3 0.6 0.021 0.042 60 107 .. 237 288 .. 222 303 .. 0.60 2 ! 14.2 0.1 2.2e-06 4.3e-06 13 115 .. 310 411 .. 300 415 .. 0.78 Alignments for each domain: == domain 1 score: 1.3 bits; conditional E-value: 0.021 CBM35.hmm 60 stktlsvvvnGtkvsevtfpstgnwdtw.....gtaagtv 94 s++t +++v G+++ ++ +wd+ +++ + + 526224|Xylcube1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 237 SQNTFELTVKGSQKTTYIYMGD-AWDSKggassNYVWVPM 275 5556666666666554333322.34332222225677777 PP CBM35.hmm 95 tLkaGkntitiks 107 + + G++ti++++ 526224|Xylcube1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 276 NINTGAKTIQLDY 288 8888888888776 PP == domain 2 score: 14.2 bits; conditional E-value: 2.2e-06 CBM35.hmm 13 vntnhagysGsgfvdglqaagdavtfnvdvpkaGsYelsl 52 +++nh+ sG+++ ++ ++vtfn ++ ls+ 526224|Xylcube1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 310 YEANHSILSGRTVA----DEPNEVTFNNVTGTGSLQWLSF 345 56777788888766....45689****6667888999*** PP CBM35.hmm 53 rYangtgstktlsvvvnGtkvsevtfpst.gnwdtwgtaa 91 +Y+ ++ ++ + v+vn++ + +++ ++ + + + ++ 526224|Xylcube1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 346 HYQVNNPEAGEAYVIVNDEPAVNISSLNSrAGYHD--STP 383 *******************9997765555277777..9** PP CBM35.hmm 92 gtvtLkaGk.ntitiks...dwGwinld 115 ++++L+ G+ ntit++ d i ++ 526224|Xylcube1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 384 IQLKLRSGDvNTITFGFigeDDHKIAVN 411 ********779**998766555555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (420 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 49.17 // Query: 605876|Xylbam139988_1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 [L=428] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (428 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 659.71 // Query: 685680|XyFL0064_1_GeneCatalog_proteins_20191108.aa.fasta|GH43_25|GH43_25|CBM35 [L=408] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (408 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 643.12 // Query: 1003365|LboET3784_1_GeneCatalog_proteins_20190624.aa.fasta|GH43_25|GH43_25|CBM35 [L=443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (443 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 732.68 // Query: 37369|Lenafn_TMI1502_1_GeneCatalog_proteins_20180804.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 668.87 // Query: 569868|Zoprh1_GeneCatalog_proteins_20130606.aa.fasta|GH43_25|GH43_25|CBM35 [L=438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-08 22.5 0.4 6.6e-08 20.0 0.0 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.8 0.2 0.092 0.18 34 55 .. 273 293 .. 233 307 .. 0.45 2 ! 20.0 0.0 3.3e-08 6.6e-08 1 118 [. 314 433 .. 314 434 .. 0.86 Alignments for each domain: == domain 1 score: -0.8 bits; conditional E-value: 0.092 CBM35.hmm 34 davtfnvdvpkaGsYelslrYa 55 ++v + +v ++G+ +++l Y 569868|Zoprh1_GeneCatalog_proteins_20130606.aa.fasta|GH43_25|GH43_25|CBM35 273 NYVWLPMKV-DTGNKRVTLEYH 293 222222333.334444444444 PP == domain 2 score: 20.0 bits; conditional E-value: 3.3e-08 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a+++g ++ ++ a++ ++ v ++ a+++++tf+ 569868|Zoprh1_GeneCatalog_proteins_20130606.aa.fasta|GH43_25|GH43_25|CBM35 314 YEAEHAEISGRAAVADCAQCLSKRGVHKI-ASDSEITFRN 352 9*********999999999999999*999.88899***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 +G+ +++ Y+ ++ ++ + v+vn++ + +++ + 569868|Zoprh1_GeneCatalog_proteins_20130606.aa.fasta|GH43_25|GH43_25|CBM35 353 VTGLGGRQWVQFYYRVDNREAGEAHVFVNDEPALNISSLN 392 66899**************************999776555 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiks....dwGwinl 114 + + + + +++ L++G+ ntit++ d+G + l 569868|Zoprh1_GeneCatalog_proteins_20130606.aa.fasta|GH43_25|GH43_25|CBM35 393 HrAGYHD--IVPIELDLREGAvNTITFGTsgseDSGIV-L 429 5277777..99*********87*****99887666655.6 PP CBM35.hmm 115 dsle 118 d +e 569868|Zoprh1_GeneCatalog_proteins_20130606.aa.fasta|GH43_25|GH43_25|CBM35 430 DGIE 433 6665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (438 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.93 // Query: 1028|LnoICMP18003A_1_GeneCatalog_proteins_20201014.aa.fasta|GH43_25|GH43_25|CBM35 [L=433] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (433 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 619.50 // Query: 772175|Lenrap1_GeneCatalog_proteins_20170901.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 748.43 // Query: 291572|Hypcro1_GeneCatalog_proteins_20190611.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-13 37.1 5.5 3.9e-11 30.4 0.1 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 8.4 1.4 0.00013 0.00026 40 108 .. 217 289 .. 198 303 .. 0.71 2 ! 30.4 0.1 1.9e-11 3.9e-11 1 117 [. 310 428 .. 310 430 .. 0.83 Alignments for each domain: == domain 1 score: 8.4 bits; conditional E-value: 0.00013 CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfp 79 ++ p +G ++ + +n gs++t +++v G+++s++ 291572|Hypcro1_GeneCatalog_proteins_20190611.aa.fasta|GH43_25|GH43_25|CBM35 217 INGPWTGGSDIAPQAQNTYGSQNTFELTVKGSQKSTYIYM 256 5556677777777778888899999*****9999966555 PP CBM35.hmm 80 stgnwdtw.....gtaagtvtLkaGkntitiksd 108 +wd+ +++ ++ +aG++titi++ 291572|Hypcro1_GeneCatalog_proteins_20190611.aa.fasta|GH43_25|GH43_25|CBM35 257 GD-AWDSKggassNYVWAPMNINAGAHTITIDYR 289 44.4554322223789999************983 PP == domain 2 score: 30.4 bits; conditional E-value: 1.9e-11 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v ++ +++ ++ v g+ ++ ++v f+ 291572|Hypcro1_GeneCatalog_proteins_20190611.aa.fasta|GH43_25|GH43_25|CBM35 310 YEAEHAVLSGRTVVKDCSDCVSKRSVHGV-SDAGEVAFHN 348 9*************************999.6666788885 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 ++ + ls++Y+ ++ ++ + ++vn++ + +++ + 291572|Hypcro1_GeneCatalog_proteins_20190611.aa.fasta|GH43_25|GH43_25|CBM35 349 VTGTGSRQWLSFHYKVNNPEAGEAHIYVNDEPAVNISSLN 388 557788889**********************999876555 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 + + + ++ +++tLk G+ ntit+++ +G+ +d 291572|Hypcro1_GeneCatalog_proteins_20190611.aa.fasta|GH43_25|GH43_25|CBM35 389 SrAGYHA--STPIQLTLKRGDvNTITFGAtgGEGFEvAVD 426 5266666..***********77******955444422666 PP CBM35.hmm 116 sl 117 + 291572|Hypcro1_GeneCatalog_proteins_20190611.aa.fasta|GH43_25|GH43_25|CBM35 427 GI 428 55 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 125.92 // Query: 260331|Gymlu1_GeneCatalog_proteins_20110803.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 661.11 // Query: 416084|Lenafn1_GeneCatalog_proteins_20170906.aa.fasta|GH43_25|GH43_25|CBM35 [L=450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (450 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 696.27 // Query: 661300|CtCBS203_1_GeneCatalog_proteins_20190619.aa.fasta|GH43_25|GH43_25|CBM35 [L=438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (438 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 729.86 // Query: 992428|Rorror1_GeneCatalog_proteins_20190202.aa.fasta|GH43_25|GH43_25|CBM35 [L=438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (438 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 703.28 // Query: 3855844|LacJLM2183_1_GeneCatalog_proteins_20210203.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 758.78 // Query: 429697|Annsty1_GeneCatalog_proteins_20190620.aa.fasta|GH43_25|GH43_25|CBM35 [L=432] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-10 27.8 1.2 5.5e-10 26.7 0.1 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.2 0.12 0.25 60 77 .. 234 251 .. 197 298 .. 0.58 2 ! 26.7 0.1 2.7e-10 5.5e-10 1 108 [. 307 416 .. 307 427 .. 0.85 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 60 stktlsvvvnGtkvsevt 77 s++t +++v G+++ ++ 429697|Annsty1_GeneCatalog_proteins_20190620.aa.fasta|GH43_25|GH43_25|CBM35 234 SQNTFELTVAGSQATTYI 251 344444444444433222 PP == domain 2 score: 26.7 bits; conditional E-value: 2.7e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v + ++ + v g+ +++++vtf+ 429697|Annsty1_GeneCatalog_proteins_20190620.aa.fasta|GH43_25|GH43_25|CBM35 307 YEAEHAVLSGRTVVRDCNECLTKRAVHGV-GDSSEVTFRN 345 9*************************999.99999***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 ++ + ls++Y+ ++ ++ + ++vn++ + +v+ + 429697|Annsty1_GeneCatalog_proteins_20190620.aa.fasta|GH43_25|GH43_25|CBM35 346 VTGTGARQWLSFHYRVNNPEAGEAHIYVNDEPAVNVSSLN 385 667888999**********************999776555 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiks...d 108 + + + + ++ +++ Lk G+ ntit+++ d 429697|Annsty1_GeneCatalog_proteins_20190620.aa.fasta|GH43_25|GH43_25|CBM35 386 SrAGYHS--STPVELLLKRGDvNTITFGAtgsD 416 5266666..9**********779***9984433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (432 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 118.65 // Query: 442409|Xylscr1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 [L=420] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-07 16.8 3.3 8.5e-06 13.2 0.1 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.7 0.8 0.0037 0.0075 53 107 .. 230 288 .. 202 305 .. 0.70 2 ! 13.2 0.1 4.2e-06 8.5e-06 30 115 .. 323 411 .. 299 415 .. 0.79 Alignments for each domain: == domain 1 score: 3.7 bits; conditional E-value: 0.0037 CBM35.hmm 53 rYangtgstktlsvvvnGtkvsevtfpstgnwdtw..... 87 + +n gs++t +++v G+++ ++ +wd+ 442409|Xylscr1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 230 QAQNTYGSQNTFELTVKGSQKTTYIYMGD-AWDSKggass 268 55666777888899999888775544433.4554322223 PP CBM35.hmm 88 gtaagtvtLkaGkntitiks 107 +++ ++ +aG++ti++++ 442409|Xylscr1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 269 NYVWLPMNINAGAKTIQLDY 288 788899999*******9997 PP == domain 2 score: 13.2 bits; conditional E-value: 4.2e-06 CBM35.hmm 30 qaagdavtfnvdvpkaGsYelslrYangtgstktlsvvvn 69 +++ d+vtf+ ++ ls++Y+ ++ ++ + v+vn 442409|Xylscr1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 323 ADEPDEVTFHNVTGTGSLQWLSFHYQVNNPEAGEAYVIVN 362 456789***96667888899******************** PP CBM35.hmm 70 Gtkvsevtfpst.gnwdtwgtaagtvtLkaGk.ntitiks 107 ++ + +++ ++ + + + ++ ++++L+ G+ ntit++ 442409|Xylscr1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 363 DEPAVNISSLNSrAGYHD--STPVQLKLRSGDvNTITFGF 400 **9997765555277777..9**********779**9987 PP CBM35.hmm 108 ...dwGwinld 115 d i ++ 442409|Xylscr1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 401 igeDDHKIAVN 411 66555555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (420 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 46.35 // Query: 1636760|Mycgal1_GeneCatalog_proteins_20160823.aa.fasta|GH43_25|GH43_25|CBM35 [L=439] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-07 19.2 0.8 1.2e-07 19.2 0.8 1.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.1 0.65 1.3 60 79 .. 244 263 .. 239 275 .. 0.67 2 ! 19.2 0.8 5.8e-08 1.2e-07 26 107 .. 338 417 .. 318 429 .. 0.85 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.65 CBM35.hmm 60 stktlsvvvnGtkvsevtfp 79 s+++ ++v+ Gt+ ++ f 1636760|Mycgal1_GeneCatalog_proteins_20160823.aa.fasta|GH43_25|GH43_25|CBM35 244 SQNSAELVIKGTSTTTYIFL 263 56677788888888777665 PP == domain 2 score: 19.2 bits; conditional E-value: 5.8e-08 CBM35.hmm 26 vdglqaagdavtfnvdvpkaGsYelslrYangtgstktls 65 v ++ +++++vtf+ v +++ +s++Y ++ ++ + 1636760|Mycgal1_GeneCatalog_proteins_20160823.aa.fasta|GH43_25|GH43_25|CBM35 338 VHNI-NSSSNVTFTNIVGRGEKQWVSFQYTVSNVTAGEAH 376 5444.78999****************************** PP CBM35.hmm 66 vvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntiti 105 v+vnG+ +++ ++ + +t+ + ++L++G+nt+t+ 1636760|Mycgal1_GeneCatalog_proteins_20160823.aa.fasta|GH43_25|GH43_25|CBM35 377 VSVNGGTPINLSQLNSRAGHY-STVPVALELDNGANTLTF 415 ****99988777776644444.78***************9 PP CBM35.hmm 106 ks 107 ++ 1636760|Mycgal1_GeneCatalog_proteins_20160823.aa.fasta|GH43_25|GH43_25|CBM35 416 GA 417 97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (439 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 165.27 // Query: 960926|LlaRV95_379_1_GeneCatalog_proteins_20200517.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 621.17 // Query: 240613|Dalver1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-12 35.0 3.4 2.2e-11 31.2 0.1 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.9 0.8 0.0032 0.0063 55 108 .. 232 289 .. 199 303 .. 0.67 2 ! 31.2 0.1 1.1e-11 2.2e-11 1 118 [. 310 429 .. 310 430 .. 0.85 Alignments for each domain: == domain 1 score: 3.9 bits; conditional E-value: 0.0032 CBM35.hmm 55 angtgstktlsvvvnGtkvsevtfpstgnwdtw.....gt 89 +n gs++t +++v G+++ ++ +wd+ ++ 240613|Dalver1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 232 QNTYGSQNTFELTVKGSQKTTYIYMGD-AWDSKggassNY 270 566677778888888887765444333.455432222367 PP CBM35.hmm 90 aagtvtLkaGkntitiksd 108 + ++ +aG+++++i++ 240613|Dalver1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 271 VWAPLNINAGSHSVQIDYH 289 8888999999999999983 PP == domain 2 score: 31.2 bits; conditional E-value: 1.1e-11 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v ++ ++ ++ v g+ ++++ vtf+ 240613|Dalver1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 310 YEAEHAVLSGRTVVKDCNECLSKRSVHGV-GDSSDVTFHN 348 9*************************999.8888999995 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++ + ls++Y+ + ++ + ++vn++ + +++ ++ 240613|Dalver1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 349 VTGTGSRQWLSFHYRVTNPEAGEAHIFVNDEPAVNISsLN 388 557888899**********************999776156 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks..dwGw.inld 115 s + + t ++ +++tLk G+ ntit+++ G+ + +d 240613|Dalver1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 389 SRAGYHT--STPVQLTLKPGDvNTITFGAtgTDGFeVAVD 426 6688888..***********77*****9977444414677 PP CBM35.hmm 116 sle 118 +e 240613|Dalver1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 427 GIE 429 665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 123.59 // Query: 625231|Cloaq1_GeneCatalog_proteins_20160307.aa.fasta|GH43_25|GH43_25|CBM35 [L=425] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-10 27.2 1.1 4.6e-09 23.7 0.0 2.9 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.0 0.22 0.45 31 49 .. 156 174 .. 148 175 .. 0.80 2 ? 0.2 0.4 0.045 0.091 60 105 .. 228 277 .. 209 292 .. 0.46 3 ! 23.7 0.0 2.3e-09 4.6e-09 1 111 [. 301 414 .. 301 421 .. 0.84 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.22 CBM35.hmm 31 aagdavtfnvdvpkaGsYe 49 ++++++ +v+v ++GsYe 625231|Cloaq1_GeneCatalog_proteins_20160307.aa.fasta|GH43_25|GH43_25|CBM35 156 NSDGSIGSRVNVLAKGSYE 174 5667888899999999996 PP == domain 2 score: 0.2 bits; conditional E-value: 0.045 CBM35.hmm 60 stktlsvvvnGtkvsevtfpstgnwdtw.....gtaagtv 94 s++t +++v G+k+ ++ +wd+ +++ + 625231|Cloaq1_GeneCatalog_proteins_20160307.aa.fasta|GH43_25|GH43_25|CBM35 228 SQNTFELTVKGSKKTTYVYMGD-SWDSKggpdsNYVWLPM 266 4455555555555443322222.33322111113333333 PP CBM35.hmm 95 tLkaGkntiti 105 t + G++++t+ 625231|Cloaq1_GeneCatalog_proteins_20160307.aa.fasta|GH43_25|GH43_25|CBM35 267 TVDGGSKKVTL 277 33334444433 PP == domain 3 score: 23.7 bits; conditional E-value: 2.3e-09 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a++ g ++ + + ++ v ++ +a+++vtf+ 625231|Cloaq1_GeneCatalog_proteins_20160307.aa.fasta|GH43_25|GH43_25|CBM35 301 YEAEHAEIVGRALVRDCEHCFSKRGVHNI-DASSEVTFRN 339 9*********9999999999999999999.7889999996 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsev.tfp 79 +G+ ++++Y+ ++ ++ + v+vn++ + ++ +++ 625231|Cloaq1_GeneCatalog_proteins_20160307.aa.fasta|GH43_25|GH43_25|CBM35 340 VTGLGGRQWVQFHYRMADREAGEAHVFVNDGPAVNIsSLN 379 66899***********************988777651566 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks....dwGw 111 + + + t+ + ++L+ G+ ntit++ + G 625231|Cloaq1_GeneCatalog_proteins_20160307.aa.fasta|GH43_25|GH43_25|CBM35 380 HRAGFHD--TVPIALNLRSGAvNTITFGTsgpaNAGI 414 6699999..***********87*****9866644444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (425 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.28 // Query: 56240|Oidma1_GeneCatalog_proteins_20110606.aa.fasta|GH43_25|GH43_25|CBM35 [L=435] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-08 21.3 0.0 6.7e-08 20.0 0.0 1.7 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.0 0.0 3.3e-08 6.7e-08 2 108 .. 310 418 .. 309 425 .. 0.85 Alignments for each domain: == domain 1 score: 20.0 bits; conditional E-value: 3.3e-08 CBM35.hmm 2 eAedasltgvsvntnhagysGsgfvdglqaagdavtfnvd 41 Ae+a+l+g ++ ++ G+ ++g++++++av n++ 56240|Oidma1_GeneCatalog_proteins_20110606.aa.fasta|GH43_25|GH43_25|CBM35 310 MAEEAKLSGRATVMACDQCIGKRSITGINSESQAVFHNIT 349 59*******999999********************99999 PP CBM35.hmm 42 vpkaGsYelslrYangtgstktlsvvvnGtkvs..evtfp 79 ++ +sl+Y+ ++ ++ + ++vn++ +++ 56240|Oidma1_GeneCatalog_proteins_20110606.aa.fasta|GH43_25|GH43_25|CBM35 350 -GTGSPQWISLHYSVNNPEEGQAHIYVNDEPLPvnISDLN 388 .5677899***********************995344455 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaG.kntitiks..d 108 + + + t ++++Lk G +nti+i++ + 56240|Oidma1_GeneCatalog_proteins_20110606.aa.fasta|GH43_25|GH43_25|CBM35 389 RRAGYHK--TIPVQLNLKRGdENTIRIGAlgS 418 5555555..***********5599*9987555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (435 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 161.26 // Query: 1357996|Mycvul1_GeneCatalog_proteins_20180504.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-08 20.0 4.0 1.6e-07 18.8 0.2 3.0 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.2 0.0 0.044 0.088 86 109 .. 28 53 .. 18 59 .. 0.81 2 ? -1.0 0.1 0.1 0.21 47 86 .. 231 269 .. 224 278 .. 0.72 3 ! 18.8 0.2 8e-08 1.6e-07 27 107 .. 337 415 .. 318 423 .. 0.84 Alignments for each domain: == domain 1 score: 0.2 bits; conditional E-value: 0.044 CBM35.hmm 86 twgtaagtvtLkaGkntitiks..dw 109 w+++ gt L G + i+++s w 1357996|Mycvul1_GeneCatalog_proteins_20180504.aa.fasta|GH43_25|GH43_25|CBM35 28 VWTDTSGTKILAHGGHVIKVGStfYW 53 4778999*************985544 PP == domain 2 score: -1.0 bits; conditional E-value: 0.1 CBM35.hmm 47 sYelslrYangtgstktlsvvvnGtkvsevtfpstgnwdt 86 + ++ n s+++ ++v+ Gt+ ++ f +wd 1357996|Mycvul1_GeneCatalog_proteins_20180504.aa.fasta|GH43_25|GH43_25|CBM35 231 TTDIAPESVNTYNSQNSAELVIQGTSTTSYIFLGD-AWDA 269 55555566676667888999999999998888776.5776 PP == domain 3 score: 18.8 bits; conditional E-value: 8e-08 CBM35.hmm 27 dglqaagdavtfnvdvpkaGsYelslrYangtgstktlsv 66 ++ +++++vtf+ v +++ +s+rY ++ ++ + v 1357996|Mycvul1_GeneCatalog_proteins_20180504.aa.fasta|GH43_25|GH43_25|CBM35 337 HNI-NSSSNVTFTNVVGRGDKQWVSFRYTVSNVTAGEAHV 375 444.78999******************************* PP CBM35.hmm 67 vvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitik 106 +vnG+ + +++ ++ + + t+ + ++Lk G+n +t++ 1357996|Mycvul1_GeneCatalog_proteins_20180504.aa.fasta|GH43_25|GH43_25|CBM35 376 SVNGGPIINLSELNSR-AGHFLTVPVALSLKDGANALTFG 414 ******9976655542.3444679*************998 PP CBM35.hmm 107 s 107 + 1357996|Mycvul1_GeneCatalog_proteins_20180504.aa.fasta|GH43_25|GH43_25|CBM35 415 A 415 7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 140.60 // Query: 523677|XyAK1471_1_GeneCatalog_proteins_20191118.aa.fasta|GH43_25|GH43_25|CBM35 [L=420] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (420 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 566.91 // Query: 3720|Lened1_GeneCatalog_proteins_20170819.aa.fasta|GH43_25|GH43_25|CBM35 [L=448] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (448 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 693.46 // Query: EPS26531.1|CBM35|GH43_25 [L=494] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (494 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 761.26 // Query: 517042|Xyldig1_GeneCatalog_proteins_20190718.aa.fasta|GH43_25|GH43_25|CBM35 [L=414] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (414 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 696.89 // Query: 3485182|Mycoli1_GeneCatalog_proteins_20171218.aa.fasta|GH43_25|GH43_25|CBM35 [L=458] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-08 20.8 3.6 3.8e-08 20.8 3.6 2.3 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.43 0.86 42 57 .. 37 52 .. 32 58 .. 0.78 2 ? -2.6 0.1 0.33 0.66 59 86 .. 264 290 .. 258 298 .. 0.70 3 ! 20.8 3.6 1.9e-08 3.8e-08 26 107 .. 357 436 .. 325 443 .. 0.83 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.43 CBM35.hmm 42 vpkaGsYelslrYang 57 +++ G + ++l Y+n+ 3485182|Mycoli1_GeneCatalog_proteins_20171218.aa.fasta|GH43_25|GH43_25|CBM35 37 IQAHGGHVIKLGYSNA 52 6778899999999995 PP == domain 2 score: -2.6 bits; conditional E-value: 0.33 CBM35.hmm 59 gstktlsvvvnGtkvsevtfpstgnwdt 86 s+++ ++v+ Gt+ ++ f +wd+ 3485182|Mycoli1_GeneCatalog_proteins_20171218.aa.fasta|GH43_25|GH43_25|CBM35 264 NSQNSAELVIKGTSTTSYIFLGD-AWDS 290 45677888999999888887766.5666 PP == domain 3 score: 20.8 bits; conditional E-value: 1.9e-08 CBM35.hmm 26 vdglqaagdavtfnvdvpkaGsYelslrYangtgstktls 65 v ++ +++++vtf+ v +++ +s++Y ++ ++ + 3485182|Mycoli1_GeneCatalog_proteins_20171218.aa.fasta|GH43_25|GH43_25|CBM35 357 VHNI-NSSSNVTFTNVVGRGDKQWVSFQYTVSNVTAGEAH 395 4444.78999****************************** PP CBM35.hmm 66 vvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntiti 105 v+vnG++ +++ ++ + +t+ + ++Lk+G+nt+t+ 3485182|Mycoli1_GeneCatalog_proteins_20171218.aa.fasta|GH43_25|GH43_25|CBM35 396 VSVNGGAPVNLSQLNSRAGHY-STVPVALSLKQGSNTLTF 434 *****9988877777754444.78***************9 PP CBM35.hmm 106 ks 107 ++ 3485182|Mycoli1_GeneCatalog_proteins_20171218.aa.fasta|GH43_25|GH43_25|CBM35 435 GA 436 87 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (458 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 163.63 // Query: 400769|Bisma1_GeneCatalog_proteins_20190619.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-11 29.9 1.4 2e-09 24.9 0.1 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.6 0.1 0.0039 0.0078 80 108 .. 262 289 .. 222 303 .. 0.59 2 ! 24.9 0.1 9.8e-10 2e-09 1 118 [. 310 429 .. 310 430 .. 0.85 Alignments for each domain: == domain 1 score: 3.6 bits; conditional E-value: 0.0039 CBM35.hmm 80 stgnwdtwgtaagtvtLkaGkntitiksd 108 s+g d+ +++ ++ +aG++ti++++ 400769|Bisma1_GeneCatalog_proteins_20190619.aa.fasta|GH43_25|GH43_25|CBM35 262 SKGGADS-NYVWLPMKIDAGQHTISLDYH 289 2333333.677788888999999999873 PP == domain 2 score: 24.9 bits; conditional E-value: 9.8e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l g++ + +++ ++ vd++ ++ +++tf+ 400769|Bisma1_GeneCatalog_proteins_20190619.aa.fasta|GH43_25|GH43_25|CBM35 310 YEAEHADLVGTARVRDCSECLSRRSVDKV-TDASELTFHN 348 9*************************999.7778888885 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 ++ ls++Y ++ ++ + ++vn++ +++ + 400769|Bisma1_GeneCatalog_proteins_20190619.aa.fasta|GH43_25|GH43_25|CBM35 349 VTGNGSLQWLSFHYTVNNPKAGEAYIIVNDGPTVNISSLN 388 557888999*******99999*******998888766555 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 + + + + ++ +++tL+aG+ ntit++s + G+ ++d 400769|Bisma1_GeneCatalog_proteins_20190619.aa.fasta|GH43_25|GH43_25|CBM35 389 SrAGYHS--SVPVQLTLNAGDvNTITFGStsSHGFEvEVD 426 5266666..***********77******998888744788 PP CBM35.hmm 116 sle 118 +e 400769|Bisma1_GeneCatalog_proteins_20190619.aa.fasta|GH43_25|GH43_25|CBM35 427 GIE 429 776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 134.84 // Query: 507457|Xylcub1_GeneCatalog_proteins_20181030.aa.fasta|GH43_25|GH43_25|CBM35 [L=420] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (420 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 587.57 // Query: 209|Zalva1_GeneCatalog_proteins_20190111.aa.fasta|GH43_25|GH43_25|CBM35 [L=441] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-09 25.9 0.1 4.1e-09 23.9 0.0 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.41 0.83 19 38 .. 110 129 .. 104 142 .. 0.77 2 ! 23.9 0.0 2.1e-09 4.1e-09 1 109 [. 311 419 .. 311 429 .. 0.80 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.41 CBM35.hmm 19 gysGsgfvdglqaagdavtf 38 ++++++v+g+q +g+av + 209|Zalva1_GeneCatalog_proteins_20190111.aa.fasta|GH43_25|GH43_25|CBM35 110 SMKSTQMVGGYQLNGAAVAI 129 56778889999999988876 PP == domain 2 score: 23.9 bits; conditional E-value: 2.1e-09 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfn. 39 yeAeda ++g ++ + + ++ v ++ +ag++v f+ 209|Zalva1_GeneCatalog_proteins_20190111.aa.fasta|GH43_25|GH43_25|CBM35 311 YEAEDAFISGRAAIRSCNHCLSRRSVAKV-DAGSEVVFRn 349 9*********8888889999999999988.6677777772 PP CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfp 79 v+ ++ +s++Y ++++++ + +++n+++v + 209|Zalva1_GeneCatalog_proteins_20190111.aa.fasta|GH43_25|GH43_25|CBM35 350 VT-GTGSPQWISFQYTANDATAGEAHIFINDEQVPTNISS 388 55.6778899************************954433 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiksdw 109 + + +t+ +++tLkaG+ nti+++++ 209|Zalva1_GeneCatalog_proteins_20190111.aa.fasta|GH43_25|GH43_25|CBM35 389 LNCRAGYHKTVPVELTLKAGDdNTIRFGASG 419 333444445***********559***99843 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (441 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 91.75 // Query: 385324|Krezon1_GeneCatalog_proteins_20220127.aa.fasta|GH43_25|GH43_25|CBM35 [L=415] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (415 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 573.42 // Query: 1321886|Mycmet1_GeneCatalog_proteins_20180505.aa.fasta|GH43_25|GH43_25|CBM35 [L=338] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-06 14.9 0.9 5.1e-06 13.9 0.1 1.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.8 0.1 0.4 0.79 60 81 .. 139 160 .. 132 172 .. 0.64 2 ! 13.9 0.1 2.6e-06 5.1e-06 44 107 .. 254 316 .. 241 328 .. 0.78 Alignments for each domain: == domain 1 score: -2.8 bits; conditional E-value: 0.4 CBM35.hmm 60 stktlsvvvnGtkvsevtfpst 81 s+++ ++v+ Gt+ ++ f 1321886|Mycmet1_GeneCatalog_proteins_20180505.aa.fasta|GH43_25|GH43_25|CBM35 139 SQNSAELVITGTSTTTYIFLGD 160 4566677777777776666554 PP == domain 2 score: 13.9 bits; conditional E-value: 2.6e-06 CBM35.hmm 44 kaGsYelslrYangtgstktlsvvvnGtkvsevt.fpst. 81 ++++ +s++Y+ ++ + + v+vnG++ +++ ++s 1321886|Mycmet1_GeneCatalog_proteins_20180505.aa.fasta|GH43_25|GH43_25|CBM35 254 NGDKQWVSFKYSVSNVYAGEAHVSVNGAAPINLSeLNSRa 293 566778999***9999************977554155553 PP CBM35.hmm 82 gnwdtwgtaagtvtLkaGkntitiks 107 g + +t+ + ++Lk+G+nt+t++ 1321886|Mycmet1_GeneCatalog_proteins_20180505.aa.fasta|GH43_25|GH43_25|CBM35 294 GHF---TTVPVALSLKNGANTLTFGT 316 333...47***************987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (338 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 155.07 // Query: 29071|LraTFB9207_1_GeneCatalog_proteins_20190328.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 779.10 // Query: 397356|Annnit1_GeneCatalog_proteins_20190623.aa.fasta|GH43_25|GH43_25|CBM35 [L=432] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-10 27.4 0.8 9.5e-10 26.0 0.0 2.2 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.2 0.12 0.25 60 77 .. 234 251 .. 197 298 .. 0.58 2 ! 26.0 0.0 4.7e-10 9.5e-10 1 108 [. 307 416 .. 307 427 .. 0.85 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.12 CBM35.hmm 60 stktlsvvvnGtkvsevt 77 s++t +++v G+++ ++ 397356|Annnit1_GeneCatalog_proteins_20190623.aa.fasta|GH43_25|GH43_25|CBM35 234 SQNTFELTVAGSQATTYI 251 344444444444433222 PP == domain 2 score: 26.0 bits; conditional E-value: 4.7e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v + +++ + v g+ +++++vtf+ 397356|Annnit1_GeneCatalog_proteins_20190623.aa.fasta|GH43_25|GH43_25|CBM35 307 YEAEHAVLSGRTVVRDCSECLTKRAVHGV-GDSSEVTFRN 345 9*************************999.99999***97 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 ++ + ls++Y+ ++ ++ + ++vn++ + +v+ + 397356|Annnit1_GeneCatalog_proteins_20190623.aa.fasta|GH43_25|GH43_25|CBM35 346 ITGTGARQWLSFHYRVNNPEAGEAHIYVNDEPAVNVSSLN 385 668888999**********************999776555 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiks...d 108 + + + + ++ +++ Lk G+ ntit+++ d 397356|Annnit1_GeneCatalog_proteins_20190623.aa.fasta|GH43_25|GH43_25|CBM35 386 SrAGYHS--STPVELLLKRGDvNTITFGAtgsD 416 5266666..9**********779***9984433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (432 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.30 // Query: 1270787|Mycale1_GeneCatalog_proteins_20171027.aa.fasta|GH43_25|GH43_25|CBM35 [L=396] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-08 21.5 2.7 4e-08 20.7 1.4 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.3 0.0 0.26 0.53 87 108 .. 29 52 .. 22 59 .. 0.78 2 ! 20.7 1.4 2e-08 4e-08 27 108 .. 296 378 .. 270 385 .. 0.81 Alignments for each domain: == domain 1 score: -2.3 bits; conditional E-value: 0.26 CBM35.hmm 87 wgtaagtvtLkaGkntitiks..d 108 w+++ g L G + i+++ 1270787|Mycale1_GeneCatalog_proteins_20171027.aa.fasta|GH43_25|GH43_25|CBM35 29 WTDTSGAKILAHGGHVIKVGTifY 52 667888999999*99999987554 PP == domain 2 score: 20.7 bits; conditional E-value: 2e-08 CBM35.hmm 27 dglqaagdavtfnvdvpkaGsYelslrYangtgstktlsv 66 ++ +++++vtf+ + ++++ +s++Y+ ++ ++ + v 1270787|Mycale1_GeneCatalog_proteins_20171027.aa.fasta|GH43_25|GH43_25|CBM35 296 HNI-NSTSNVTFTNVIGNGDKQWVSFKYSVSNVTAGEAHV 334 444.78899****999************************ PP CBM35.hmm 67 vvnGtkvs.evtfpstgnwdtwgtaagtvtLkaGkntiti 105 +vnG+ +++s + ++t+ + ++Lk+G+nt+t+ 1270787|Mycale1_GeneCatalog_proteins_20171027.aa.fasta|GH43_25|GH43_25|CBM35 335 SVNGAGPInLSELNSR--AGHFTTVPVALSLKKGANTLTF 372 ****987624445555..333347**************** PP CBM35.hmm 106 ks...d 108 ++ + 1270787|Mycale1_GeneCatalog_proteins_20171027.aa.fasta|GH43_25|GH43_25|CBM35 373 GAtavN 378 985544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (396 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 149.85 // Query: 456479|Roster1_GeneCatalog_proteins_20190716.aa.fasta|GH43_25|GH43_25|CBM35 [L=434] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-10 27.8 1.3 5.1e-10 26.8 0.1 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.2 0.11 0.23 60 77 .. 235 252 .. 200 299 .. 0.57 2 ! 26.8 0.1 2.6e-10 5.1e-10 1 108 [. 308 417 .. 308 428 .. 0.85 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.11 CBM35.hmm 60 stktlsvvvnGtkvsevt 77 s++t +++v G+++ ++ 456479|Roster1_GeneCatalog_proteins_20190716.aa.fasta|GH43_25|GH43_25|CBM35 235 SQNTFELTVAGSQATTYI 252 333333444433333222 PP == domain 2 score: 26.8 bits; conditional E-value: 2.6e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v + ++ + v g+ +++++vtf+ 456479|Roster1_GeneCatalog_proteins_20190716.aa.fasta|GH43_25|GH43_25|CBM35 308 YEAEHAVLSGRTVVRDCNECLTKRAVHGV-GDSSQVTFRN 346 9*************************999.99999***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 ++ + ls++Y+ ++ ++ + ++vn++ + +v+ + 456479|Roster1_GeneCatalog_proteins_20190716.aa.fasta|GH43_25|GH43_25|CBM35 347 VTGTGARQWLSFHYRVNNPEAGEAHIYVNDEPAVNVSSLN 386 667888999**********************999776555 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiks...d 108 + + + + ++ +++ Lk G+ ntit+++ d 456479|Roster1_GeneCatalog_proteins_20190716.aa.fasta|GH43_25|GH43_25|CBM35 387 SrAGYHS--STPVELLLKRGDvNTITFGAtgsD 417 5266666..9**********779***9984433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (434 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 125.79 // Query: 508822|Xylhel2_GeneCatalog_proteins_20191119.aa.fasta|GH43_25|GH43_25|CBM35 [L=420] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (420 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 595.18 // Query: 31488|LlaTMI1499_1_GeneCatalog_proteins_20190712.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 714.45 // Query: 456980|Aaoar1_GeneCatalog_proteins_20140429.aa.fasta|GH43_25|GH43_25|CBM35 [L=443] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-08 20.5 0.9 1.1e-07 19.4 0.0 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.1 0.22 0.43 31 31 .. 272 272 .. 239 307 .. 0.48 2 ! 19.4 0.0 5.3e-08 1.1e-07 1 107 [. 316 421 .. 316 439 .. 0.82 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.22 CBM35.hmm 31 a 31 456980|Aaoar1_GeneCatalog_proteins_20140429.aa.fasta|GH43_25|GH43_25|CBM35 272 P 272 2 PP == domain 2 score: 19.4 bits; conditional E-value: 5.3e-08 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a++ g ++ t+ + ++ v +++ +++ v +nv 456980|Aaoar1_GeneCatalog_proteins_20140429.aa.fasta|GH43_25|GH43_25|CBM35 316 YEAEHAEIVGRAAVTSCEHCLSKRGVHKITPDSQVVFYNV 355 9*********999999999999999*99966655555567 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 + +G+ ++++Y+ ++ ++ + v vnG+ + +++ + 456980|Aaoar1_GeneCatalog_proteins_20140429.aa.fasta|GH43_25|GH43_25|CBM35 356 T-GLGGRQWVQFHYRVKDLESGEAYVNVNGGPAVNISSLN 394 7.688**************************999888777 PP CBM35.hmm 81 tgnwdtwgtaagtvtLkaGk.ntitiks 107 + ++ + + L++G+ n+it++ 456980|Aaoar1_GeneCatalog_proteins_20140429.aa.fasta|GH43_25|GH43_25|CBM35 395 HRAGHH-DVVPVALDLEEGAvNKITFGV 421 754444.5999********879999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (443 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 135.00 // Query: 1321323|Rhobut1_1_GeneCatalog_proteins_20160415.aa.fasta|GH43_25|GH43_25|CBM35 [L=446] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (446 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 698.42 // Query: 32419|DaFL1419_1_GeneCatalog_proteins_20190501.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-13 36.9 2.0 8.2e-12 32.6 0.0 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.5 0.4 0.0044 0.0088 59 108 .. 236 289 .. 202 303 .. 0.67 2 ! 32.6 0.0 4.1e-12 8.2e-12 1 118 [. 310 429 .. 310 430 .. 0.87 Alignments for each domain: == domain 1 score: 3.5 bits; conditional E-value: 0.0044 CBM35.hmm 59 gstktlsvvvnGtkvsevtfpstgnwdtw.....gtaagt 93 gs++t +++v G+++ ++ +wd+ +++ 32419|DaFL1419_1_GeneCatalog_proteins_20190501.aa.fasta|GH43_25|GH43_25|CBM35 236 GSQNTFELTVKGSQKTTYIYMGD-AWDSKggassNYVWAP 274 45566667777666554433332.4443322222677788 PP CBM35.hmm 94 vtLkaGkntitiksd 108 ++ +aG+++++i++ 32419|DaFL1419_1_GeneCatalog_proteins_20190501.aa.fasta|GH43_25|GH43_25|CBM35 275 LNINAGSHSVQIDYH 289 899999999999883 PP == domain 2 score: 32.6 bits; conditional E-value: 4.1e-12 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v ++ ++ ++ v g+ +++++vtf+ 32419|DaFL1419_1_GeneCatalog_proteins_20190501.aa.fasta|GH43_25|GH43_25|CBM35 310 YEAEHAVLSGRTVVKDCNECLSKRSVHGV-GDSSEVTFHN 348 9*************************999.99999***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++ + ls++Y+ ++ ++ + ++vn++ + +++ ++ 32419|DaFL1419_1_GeneCatalog_proteins_20190501.aa.fasta|GH43_25|GH43_25|CBM35 349 VTGTGSRQWLSFHYRVANPEAGEAHIFVNDEPAVNISsLN 388 667888899**********************999776156 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 s + + t ++ +++tLk G+ ntit+++ + G+ +d 32419|DaFL1419_1_GeneCatalog_proteins_20190501.aa.fasta|GH43_25|GH43_25|CBM35 389 SRAGYHT--STPVQLTLKPGDvNTITFGAtgSDGFEvAVD 426 6688888..***********77******988666533777 PP CBM35.hmm 116 sle 118 +e 32419|DaFL1419_1_GeneCatalog_proteins_20190501.aa.fasta|GH43_25|GH43_25|CBM35 427 GIE 429 776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 128.89 // Query: 20149|Lentinedodes1_GeneCatalog_proteins_20190125.aa.fasta|GH43_25|GH43_25|CBM35 [L=497] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (497 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 745.90 // Query: 422897|Dales1_GeneCatalog_proteins_20190708.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-13 36.2 1.0 2.8e-11 30.9 0.0 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.5 0.4 0.0043 0.0086 60 108 .. 237 289 .. 203 303 .. 0.68 2 ! 30.9 0.0 1.4e-11 2.8e-11 1 118 [. 310 429 .. 310 430 .. 0.87 Alignments for each domain: == domain 1 score: 3.5 bits; conditional E-value: 0.0043 CBM35.hmm 60 stktlsvvvnGtkvsevtfpstgnwdtw.....gtaagtv 94 s++t +++v G+++ ++ +wd+ +++ + 422897|Dales1_GeneCatalog_proteins_20190708.aa.fasta|GH43_25|GH43_25|CBM35 237 SQNTFELTVKGSQKTTYIYMGD-AWDSKggassNYVWAPL 275 5566666776666554433332.34433222226778889 PP CBM35.hmm 95 tLkaGkntitiksd 108 + +aG+++++i++ 422897|Dales1_GeneCatalog_proteins_20190708.aa.fasta|GH43_25|GH43_25|CBM35 276 NINAGSHSVQIDYH 289 99999999999983 PP == domain 2 score: 30.9 bits; conditional E-value: 1.4e-11 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v ++ +++ ++ v g+ +++++vtf+ 422897|Dales1_GeneCatalog_proteins_20190708.aa.fasta|GH43_25|GH43_25|CBM35 310 YEAEHAVLSGRTVVKDCSECLSKRSVHGV-GDSSEVTFHN 348 9*************************999.99999***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++ + ls++Y+ + ++ + ++vn++ +++ ++ 422897|Dales1_GeneCatalog_proteins_20190708.aa.fasta|GH43_25|GH43_25|CBM35 349 VTGTGSRQWLSFHYRVTNPEAGEAHIFVNDEPPVNISsLN 388 667888899*********************9988665166 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 s + + t ++ +++tLk G+ ntit+++ + G+ +d 422897|Dales1_GeneCatalog_proteins_20190708.aa.fasta|GH43_25|GH43_25|CBM35 389 SRAGYHT--STPVQLTLKPGDvNTITFGAtgSDGFEvSVD 426 6688888..***********77******988666533777 PP CBM35.hmm 116 sle 118 +e 422897|Dales1_GeneCatalog_proteins_20190708.aa.fasta|GH43_25|GH43_25|CBM35 427 GIE 429 766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 129.78 // Query: 1571014|Lbo_TFB10827_1_GeneCatalog_proteins_20190529.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 717.94 // Query: 511255|Kredeu1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 [L=414] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (414 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 691.55 // Query: 1029700|Lenra_T_1_GeneCatalog_proteins_20181105.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 748.14 // Query: 56693|LedTMI1633_1_GeneCatalog_proteins_20190915.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 710.15 // Query: 438118|Plesi1_GeneCatalog_proteins_20130603.aa.fasta|GH43_25|GH43_25|CBM35 [L=436] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-06 14.2 0.2 1.9e-05 12.0 0.0 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.9 0.0 0.2 0.39 67 90 .. 283 304 .. 266 315 .. 0.69 2 ! 12.0 0.0 9.7e-06 1.9e-05 36 107 .. 346 417 .. 327 432 .. 0.80 Alignments for each domain: == domain 1 score: -1.9 bits; conditional E-value: 0.2 CBM35.hmm 67 vvnGtkvsevtfpstgnwdtwgta 90 +v+ +++++v+++ ++w+ ++ 438118|Plesi1_GeneCatalog_proteins_20130603.aa.fasta|GH43_25|GH43_25|CBM35 283 TVD-KASKKVSLEYHAQWKV-DVK 304 455.4446688888888876.444 PP == domain 2 score: 12.0 bits; conditional E-value: 9.7e-06 CBM35.hmm 36 vtfnvdvpkaGsYelslrYangtgstktlsvvvnGtkvse 75 +tf+ + +G+ ++++Y+ + ++ + ++vn++ + + 438118|Plesi1_GeneCatalog_proteins_20130603.aa.fasta|GH43_25|GH43_25|CBM35 346 LTFRNVAGLGGRQWVQIHYRVTDRTAGEAHISVNDEPAVN 385 5666666778999***********************9997 PP CBM35.hmm 76 vtfpst.gnwdtwgtaagtvtLkaGk.ntitiks 107 v+ + + + ++ ++++L+aG+ nti++++ 438118|Plesi1_GeneCatalog_proteins_20130603.aa.fasta|GH43_25|GH43_25|CBM35 386 VSSLNHrAGYHH--VVPVELNLRAGSvNTISLGM 417 766555266666..***********879999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (436 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 60.75 // Query: 602730|Durrog2_GeneCatalog_proteins_20191122.aa.fasta|GH43_25|GH43_25|CBM35 [L=435] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-11 30.6 0.5 8.2e-11 29.4 0.1 1.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.1 0.2 0.39 66 78 .. 243 255 .. 222 299 .. 0.53 2 ! 29.4 0.1 4.1e-11 8.2e-11 1 112 [. 310 419 .. 310 430 .. 0.85 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.2 CBM35.hmm 66 vvvnGtkvsevtf 78 ++v G+++ ++ 602730|Durrog2_GeneCatalog_proteins_20191122.aa.fasta|GH43_25|GH43_25|CBM35 243 LTVKGSQKTTYIY 255 4444444332222 PP == domain 2 score: 29.4 bits; conditional E-value: 4.1e-11 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v + + ++ v g+ ++ ++vtf+ 602730|Durrog2_GeneCatalog_proteins_20191122.aa.fasta|GH43_25|GH43_25|CBM35 310 YEAEHAVLSGRTVVRDCNTCASKRSVHGV-GDASEVTFRN 348 9*************************999.8888999995 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 ++ + ls++Y+ ++ ++ + ++vn++ + +++ + 602730|Durrog2_GeneCatalog_proteins_20191122.aa.fasta|GH43_25|GH43_25|CBM35 349 VTGTGSRQWLSFHYRVNNPEAGEAHIFVNDGPAINISSLN 388 557888889*******************999888776555 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiksdwGwi 112 + + + ++ ++tLkaG+ ntit+++ +G 602730|Durrog2_GeneCatalog_proteins_20191122.aa.fasta|GH43_25|GH43_25|CBM35 389 SrAGYHA--STPLQLTLKAGDvNTITFGA-TGSE 419 5266666..***********77*****98.5544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (435 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 155.62 // Query: 159363|Annmae1_GeneCatalog_proteins_20190718.aa.fasta|GH43_25|GH43_25|CBM35 [L=434] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-11 32.1 0.9 3.9e-11 30.4 0.1 2.3 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 0.1 0.11 0.21 59 77 .. 234 252 .. 200 298 .. 0.60 2 ! 30.4 0.1 1.9e-11 3.9e-11 1 118 [. 308 427 .. 308 428 .. 0.86 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.11 CBM35.hmm 59 gstktlsvvvnGtkvsevt 77 gs++t +++v G+k+ ++ 159363|Annmae1_GeneCatalog_proteins_20190718.aa.fasta|GH43_25|GH43_25|CBM35 234 GSQNTFELTVAGSKATTYI 252 3333444444444433222 PP == domain 2 score: 30.4 bits; conditional E-value: 1.9e-11 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v + ++ + v g+ +++++vtf+ 159363|Annmae1_GeneCatalog_proteins_20190718.aa.fasta|GH43_25|GH43_25|CBM35 308 YEAEHAVLSGRTVVRDCNECLTKRAVHGV-GDSSEVTFHN 346 9*************************999.99999***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 ++ + ls++Y++++ ++ + ++vn++ + +++ + 159363|Annmae1_GeneCatalog_proteins_20190718.aa.fasta|GH43_25|GH43_25|CBM35 347 VTGTGARQWLSFHYRANNPEAGEAHIYVNDEPAVNISSLN 386 667888999**********************999876655 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 + + + + ++ +++ Lk G+ ntit+++ + G+ +d 159363|Annmae1_GeneCatalog_proteins_20190718.aa.fasta|GH43_25|GH43_25|CBM35 387 SrAGYHS--STPVELLLKRGDvNTITFGAtgSDGFEvAVD 424 5266666..9**********77******988666533777 PP CBM35.hmm 116 sle 118 +e 159363|Annmae1_GeneCatalog_proteins_20190718.aa.fasta|GH43_25|GH43_25|CBM35 425 GIE 427 776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (434 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 125.90 // Query: 1625231|Myclep1_GeneCatalog_proteins_20180625.aa.fasta|GH43_25|GH43_25|CBM35 [L=445] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (445 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 603.60 // Query: 406257|Mycmac1_GeneCatalog_proteins_20180503.aa.fasta|GH43_25|GH43_25|CBM35 [L=450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-07 19.1 0.8 1.3e-07 19.1 0.8 2.1 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.43 0.85 43 57 .. 98 112 .. 72 125 .. 0.69 2 ? -2.9 0.1 0.41 0.83 29 78 .. 225 276 .. 212 290 .. 0.63 3 ! 19.1 0.8 6.5e-08 1.3e-07 28 108 .. 352 431 .. 323 440 .. 0.83 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.43 CBM35.hmm 43 pkaGsYelslrYang 57 + +G+Y+ ++ Y+ g 406257|Mycmac1_GeneCatalog_proteins_20180503.aa.fasta|GH43_25|GH43_25|CBM35 98 QVTGMYRPKFIYSGG 112 467888877777764 PP == domain 2 score: -2.9 bits; conditional E-value: 0.41 CBM35.hmm 29 lqaagdavtfn..vdvpkaGsYelslrYangtgstktlsv 66 ++a+ d+v ++ +d p +G ++ n gs+++ ++ 406257|Mycmac1_GeneCatalog_proteins_20180503.aa.fasta|GH43_25|GH43_25|CBM35 225 WAANPDKVYWAtsIDGPWQGGTDIAPESTNTYGSQNSAEL 264 5555566666534444566666666666666666666666 PP CBM35.hmm 67 vvnGtkvsevtf 78 ++ G++ ++ f 406257|Mycmac1_GeneCatalog_proteins_20180503.aa.fasta|GH43_25|GH43_25|CBM35 265 MIVGSSTTTYIF 276 666666665555 PP == domain 3 score: 19.1 bits; conditional E-value: 6.5e-08 CBM35.hmm 28 glqaagdavtfnvdvpkaGsYelslrYangtgstktlsvv 67 ++ +++++vtf+ + k+++ + ++Y ++ ++ + v+ 406257|Mycmac1_GeneCatalog_proteins_20180503.aa.fasta|GH43_25|GH43_25|CBM35 352 NI-DSSSNVTFTNVIGKGDKQWVAFKYTVSNVTAGEAHVS 390 44.67889****99************************** PP CBM35.hmm 68 vnGtkvs.evtfpstgnwdtwgtaagtvtLkaGkntitik 106 vnG++ +++s + +++ t + + Lk+G+nt+t++ 406257|Mycmac1_GeneCatalog_proteins_20180503.aa.fasta|GH43_25|GH43_25|CBM35 391 VNGDAPInLSDLNSRAGYRS--TIPVALALKEGANTLTFG 428 ***99773667888888888..****************99 PP CBM35.hmm 107 s.d 108 406257|Mycmac1_GeneCatalog_proteins_20180503.aa.fasta|GH43_25|GH43_25|CBM35 429 TtA 431 853 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (450 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 137.48 // Query: 276232|Lbo_TFB10291_1_GeneCatalog_proteins_20190621.aa.fasta|GH43_25|GH43_25|CBM35 [L=446] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (446 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 670.49 // Query: 420489|Hypsub2_GeneCatalog_proteins_20191111.aa.fasta|GH43_25|GH43_25|CBM35 [L=436] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-12 35.0 1.2 4.9e-11 30.1 0.0 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.4 0.3 0.0046 0.0092 61 108 .. 238 289 .. 224 303 .. 0.61 2 ! 30.1 0.0 2.5e-11 4.9e-11 1 118 [. 310 429 .. 310 430 .. 0.87 Alignments for each domain: == domain 1 score: 3.4 bits; conditional E-value: 0.0046 CBM35.hmm 61 tktlsvvvnGtkvsevtfpstgnwdtw.....gtaagtvt 95 ++t +++v G+++ ++ +wd+ +++ ++ 420489|Hypsub2_GeneCatalog_proteins_20191111.aa.fasta|GH43_25|GH43_25|CBM35 238 QNTFELTVKGSQKTTYVYMGD-AWDSKggassNYVWAPLN 276 555566666665553333222.343322222267777888 PP CBM35.hmm 96 LkaGkntitiksd 108 +aG+++++i++ 420489|Hypsub2_GeneCatalog_proteins_20191111.aa.fasta|GH43_25|GH43_25|CBM35 277 INAGSHSVQIDYH 289 8999999999873 PP == domain 2 score: 30.1 bits; conditional E-value: 2.5e-11 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v ++ ++ ++ v g+ ++ ++vtf+ 420489|Hypsub2_GeneCatalog_proteins_20191111.aa.fasta|GH43_25|GH43_25|CBM35 310 YEAEHAVLSGRTVVKDCNDCLSRRSVHGV-GDASEVTFHN 348 9*************************999.8888999996 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++ + ls++Y+ ++ ++ + + vn++ + +++ ++ 420489|Hypsub2_GeneCatalog_proteins_20191111.aa.fasta|GH43_25|GH43_25|CBM35 349 VTGTGSRQWLSFHYRVSNPEAGEAHILVNNEPAMNISsLN 388 557888889**********************999776155 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 s + + t ++ +++tLk G+ ntit+++ + G+ ++d 420489|Hypsub2_GeneCatalog_proteins_20191111.aa.fasta|GH43_25|GH43_25|CBM35 389 SRAGYHT--STPIQLTLKRGDvNTITFGAtgSDGFEvEVD 426 5588888..***********77******988666543888 PP CBM35.hmm 116 sle 118 +e 420489|Hypsub2_GeneCatalog_proteins_20191111.aa.fasta|GH43_25|GH43_25|CBM35 427 GIE 429 776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (436 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 155.72 // Query: 533048|Dalba1_GeneCatalog_proteins_20190708.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-12 35.1 1.6 3.7e-11 30.5 0.0 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.4 0.3 0.0045 0.0091 60 108 .. 237 289 .. 204 303 .. 0.68 2 ! 30.5 0.0 1.8e-11 3.7e-11 1 118 [. 310 429 .. 310 430 .. 0.86 Alignments for each domain: == domain 1 score: 3.4 bits; conditional E-value: 0.0045 CBM35.hmm 60 stktlsvvvnGtkvsevtfpstgnwdtw.....gtaagtv 94 s++t +++v G+++ ++ +wd+ +++ + 533048|Dalba1_GeneCatalog_proteins_20190708.aa.fasta|GH43_25|GH43_25|CBM35 237 SQNTFELTVKGSQKTTYIYMGD-AWDSKggassNYVWAPL 275 5556666666666554433332.34432222226777888 PP CBM35.hmm 95 tLkaGkntitiksd 108 + +aG+++++i++ 533048|Dalba1_GeneCatalog_proteins_20190708.aa.fasta|GH43_25|GH43_25|CBM35 276 NINAGSHSVQIDYH 289 99999999999883 PP == domain 2 score: 30.5 bits; conditional E-value: 1.8e-11 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v ++ +++ ++ v g+ +++++vtf+ 533048|Dalba1_GeneCatalog_proteins_20190708.aa.fasta|GH43_25|GH43_25|CBM35 310 YEAEHAVLSGRTVVKDCSECLSKRSVHGV-DDSSEVTFHN 348 9*************************999.88999***95 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++ + +s++Y+ + ++ + +++vn++ +++ ++ 533048|Dalba1_GeneCatalog_proteins_20190708.aa.fasta|GH43_25|GH43_25|CBM35 349 VTGTGSRQWFSFHYRVTNPEAGEARIYVNDEPPVNISsLN 388 557778889*******99************9988665166 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 s + + t ++ +++tLk G+ ntit+++ + G+ +d 533048|Dalba1_GeneCatalog_proteins_20190708.aa.fasta|GH43_25|GH43_25|CBM35 389 SRAGYHT--STPVQLTLKRGDvNTITFGAtgSDGFEvSVD 426 6688888..***********77******988666533777 PP CBM35.hmm 116 sle 118 +e 533048|Dalba1_GeneCatalog_proteins_20190708.aa.fasta|GH43_25|GH43_25|CBM35 427 GIE 429 766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 138.43 // Query: 614452|Bismed1_GeneCatalog_proteins_20190620.aa.fasta|GH43_25|GH43_25|CBM35 [L=438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (438 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 598.29 // Query: 1229357|Conioc1_GeneCatalog_proteins_20180327.aa.fasta|GH43_25|GH43_25|CBM35 [L=402] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (402 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 648.19 // Query: 170839|Led_CS584_1_GeneCatalog_proteins_20190518.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 707.19 // Query: 9699|Aspuda1_GeneCatalog_proteins_20160920.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-09 22.7 0.0 5e-08 20.4 0.0 2.2 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.0 0.25 0.49 32 49 .. 169 186 .. 164 195 .. 0.84 2 ? -4.0 0.0 0.93 1.9 56 74 .. 236 254 .. 227 259 .. 0.70 3 ! 20.4 0.0 2.5e-08 5e-08 1 107 [. 313 419 .. 313 434 .. 0.82 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.25 CBM35.hmm 32 agdavtfnvdvpkaGsYe 49 ++++v +v+v +aG Ye 9699|Aspuda1_GeneCatalog_proteins_20160920.aa.fasta|GH43_25|GH43_25|CBM35 169 SDGSVGNRVNVLAAGAYE 186 567888899******997 PP == domain 2 score: -4.0 bits; conditional E-value: 0.93 CBM35.hmm 56 ngtgstktlsvvvnGtkvs 74 n g+++t ++v+ Gtk 9699|Aspuda1_GeneCatalog_proteins_20160920.aa.fasta|GH43_25|GH43_25|CBM35 236 NTYGAQNTFELVIKGTKET 254 5556677778888888765 PP == domain 3 score: 20.4 bits; conditional E-value: 2.5e-08 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfn. 39 yeAeda l+g +v t+ + + v ++ ++++v f+ 9699|Aspuda1_GeneCatalog_proteins_20160920.aa.fasta|GH43_25|GH43_25|CBM35 313 YEAEDAILSGRAVVTECDHCLTKRSVHRID-HESEVVFEn 351 9**************************995.566666662 PP CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvs..evt 77 v+ ++ +s++Y ++ + ++vn++ v + 9699|Aspuda1_GeneCatalog_proteins_20160920.aa.fasta|GH43_25|GH43_25|CBM35 352 VT-GTGQPEWVSFHYTVNNPTMGDAHIYVNDEPVPlnISE 390 65.6777789*******999**************974556 PP CBM35.hmm 78 fpstgnwdtwgtaagtvtLkaGk.ntitiks 107 ++s + + + t+ +++tLk G+ nti++ + 9699|Aspuda1_GeneCatalog_proteins_20160920.aa.fasta|GH43_25|GH43_25|CBM35 391 LNSRAGYHE--TVPVQLTLKPGDtNTIRFAA 419 666677777..***********549999986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 163.35 // Query: 597403|Xylpal124036_1_GeneCatalog_proteins_20190613.aa.fasta|GH43_25|GH43_25|CBM35 [L=409] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (409 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 586.66 // Query: 269661|XylFL0662B_GeneCatalog_proteins_20190320.aa.fasta|GH43_25|GH43_25|CBM35 [L=440] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-10 27.3 1.0 3.8e-09 24.0 0.0 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.5 0.2 0.018 0.037 53 107 .. 231 289 .. 197 303 .. 0.67 2 ! 24.0 0.0 1.9e-09 3.8e-09 1 117 [. 311 429 .. 311 431 .. 0.85 Alignments for each domain: == domain 1 score: 1.5 bits; conditional E-value: 0.018 CBM35.hmm 53 rYangtgstktlsvvvnGtkvsevtfpstgnwdtw..... 87 + n gs++t +++v G+++s++ +wd+ 269661|XylFL0662B_GeneCatalog_proteins_20190320.aa.fasta|GH43_25|GH43_25|CBM35 231 QAENTYGSQNTFELTVKGSEQSTYIYMGD-AWDSKggtds 269 55666777888899999999886554443.3433221112 PP CBM35.hmm 88 gtaagtvtLkaGkntitiks 107 +++ ++ +aGk+++++++ 269661|XylFL0662B_GeneCatalog_proteins_20190320.aa.fasta|GH43_25|GH43_25|CBM35 270 NYVWLPMSIDAGKKSLQLDY 289 66677777788888877776 PP == domain 2 score: 24.0 bits; conditional E-value: 1.9e-09 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+asl+g ++ ++ +++ ++ v g+ + ++vtf+ 269661|XylFL0662B_GeneCatalog_proteins_20190320.aa.fasta|GH43_25|GH43_25|CBM35 311 YEAEHASLSGRAAVKECSDCLSRRSVHGV-DGASEVTFRN 349 9*********9999************999.5667899985 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++ ls++Y+ ++ ++ + ++vn++ + +++ ++ 269661|XylFL0662B_GeneCatalog_proteins_20190320.aa.fasta|GH43_25|GH43_25|CBM35 350 VTGTGSLQWLSFHYRVNNPEAGEAHIFVNDQPAVNISsLN 389 557888999**********************999776155 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks...dwGwinld 115 s + + t ++ +++ L G+ ntit++s d+ + +d 269661|XylFL0662B_GeneCatalog_proteins_20190320.aa.fasta|GH43_25|GH43_25|CBM35 390 SRAGYHT--STPVQLRLAVGDvNTITFGStgsDEFEVTVD 427 5688888..***********77*****9866655556666 PP CBM35.hmm 116 sl 117 + 269661|XylFL0662B_GeneCatalog_proteins_20190320.aa.fasta|GH43_25|GH43_25|CBM35 428 GI 429 55 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (440 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 122.18 // Query: 34912|LedTMI1148_1_GeneCatalog_proteins_20190716.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 654.06 // Query: 447564|Hypcer1_GeneCatalog_proteins_20190613.aa.fasta|GH43_25|GH43_25|CBM35 [L=435] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-13 35.8 3.3 9.2e-12 32.4 0.1 2.6 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.4 0.5 0.0046 0.0092 46 108 .. 222 288 .. 198 300 .. 0.66 2 ! 32.4 0.1 4.6e-12 9.2e-12 1 117 [. 309 427 .. 309 429 .. 0.85 Alignments for each domain: == domain 1 score: 3.4 bits; conditional E-value: 0.0046 CBM35.hmm 46 GsYelslrYangtgstktlsvvvnGtkvsevtfpstgnwd 85 G ++ + +n gs++t +++v G+++ +++ ++wd 447564|Hypcer1_GeneCatalog_proteins_20190613.aa.fasta|GH43_25|GH43_25|CBM35 222 GGSDIAPQAQNTYGSQNTFELTVAGSQRT-THIYMGDAWD 260 55555556666667777788888877755.3444444555 PP CBM35.hmm 86 tw.....gtaagtvtLkaGkntitiksd 108 + +++ ++ +aG++t+ti++ 447564|Hypcer1_GeneCatalog_proteins_20190613.aa.fasta|GH43_25|GH43_25|CBM35 261 SRggassNYVWAPLSINAGAHTLTIDYH 288 4322223677888899999999999873 PP == domain 2 score: 32.4 bits; conditional E-value: 4.6e-12 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v + ++ ++ v g+ ++ ++vtf+ 447564|Hypcer1_GeneCatalog_proteins_20190613.aa.fasta|GH43_25|GH43_25|CBM35 309 YEAEHAVLSGRTVVRDCDDCLSKRSVHGV-GDASEVTFHN 347 9*************************999.8888999996 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++ + ls++Y+ ++ ++ + ++vn++ + +++ ++ 447564|Hypcer1_GeneCatalog_proteins_20190613.aa.fasta|GH43_25|GH43_25|CBM35 348 VTGTGSRQWLSFHYQVNNPEAGEAHIYVNDEPAVNISsLN 387 557888889**********************999776156 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 s + + t ++ ++++L+aG+ ntit+++ +G+ +d 447564|Hypcer1_GeneCatalog_proteins_20190613.aa.fasta|GH43_25|GH43_25|CBM35 388 SRAGYHT--STPVQLNLRAGDvNTITFGAtgGEGFEvAVD 425 6688888..***********77******955444422666 PP CBM35.hmm 116 sl 117 + 447564|Hypcer1_GeneCatalog_proteins_20190613.aa.fasta|GH43_25|GH43_25|CBM35 426 GI 427 55 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (435 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 130.08 // Query: 1633469|Mycgal1_GeneCatalog_proteins_20160823.aa.fasta|GH43_25|GH43_25|CBM35 [L=439] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-07 19.2 0.8 1.2e-07 19.2 0.8 1.9 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.1 0.65 1.3 60 79 .. 244 263 .. 239 275 .. 0.67 2 ! 19.2 0.8 5.8e-08 1.2e-07 26 107 .. 338 417 .. 318 429 .. 0.85 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.65 CBM35.hmm 60 stktlsvvvnGtkvsevtfp 79 s+++ ++v+ Gt+ ++ f 1633469|Mycgal1_GeneCatalog_proteins_20160823.aa.fasta|GH43_25|GH43_25|CBM35 244 SQNSAELVIKGTSTTTYIFL 263 56677788888888777665 PP == domain 2 score: 19.2 bits; conditional E-value: 5.8e-08 CBM35.hmm 26 vdglqaagdavtfnvdvpkaGsYelslrYangtgstktls 65 v ++ +++++vtf+ v +++ +s++Y ++ ++ + 1633469|Mycgal1_GeneCatalog_proteins_20160823.aa.fasta|GH43_25|GH43_25|CBM35 338 VHNI-NSSSNVTFTNIVGRGEKQWVSFQYTVSNVTAGEAH 376 5444.78999****************************** PP CBM35.hmm 66 vvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntiti 105 v+vnG+ +++ ++ + +t+ + ++L++G+nt+t+ 1633469|Mycgal1_GeneCatalog_proteins_20160823.aa.fasta|GH43_25|GH43_25|CBM35 377 VSVNGGTPINLSQLNSRAGHY-STVPVALELDNGANTLTF 415 ****99988777776644444.78***************9 PP CBM35.hmm 106 ks 107 ++ 1633469|Mycgal1_GeneCatalog_proteins_20160823.aa.fasta|GH43_25|GH43_25|CBM35 416 GA 417 97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (439 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 169.98 // Query: 623976|Lopnu1_GeneCatalog_proteins_20160906.aa.fasta|GH43_25|GH43_25|CBM35 [L=431] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (431 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 475.61 // Query: 880759|LboTFB10292_1_GeneCatalog_proteins_20200513.aa.fasta|GH43_25|GH43_25|CBM35 [L=448] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (448 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 689.43 // Query: 434672|Dalcal1_GeneCatalog_proteins_20190624.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-12 32.7 1.1 2.4e-10 27.9 0.0 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.2 0.3 0.0054 0.011 60 108 .. 237 289 .. 202 302 .. 0.69 2 ! 27.9 0.0 1.2e-10 2.4e-10 1 118 [. 310 429 .. 310 430 .. 0.85 Alignments for each domain: == domain 1 score: 3.2 bits; conditional E-value: 0.0054 CBM35.hmm 60 stktlsvvvnGtkvsevtfpstgnwdtw.....gtaagtv 94 s++t +++v G+++ ++ +wd+ +++ + 434672|Dalcal1_GeneCatalog_proteins_20190624.aa.fasta|GH43_25|GH43_25|CBM35 237 SQNTFELTVKGSQRTTYIYMGD-AWDSKggassNYVWAPL 275 5566667777766664443333.34432222226778888 PP CBM35.hmm 95 tLkaGkntitiksd 108 + +aG+++++i++ 434672|Dalcal1_GeneCatalog_proteins_20190624.aa.fasta|GH43_25|GH43_25|CBM35 276 NINAGSHSVQIDYH 289 99999999999873 PP == domain 2 score: 27.9 bits; conditional E-value: 1.2e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v ++ +++ ++ v g+ +++++vtf+ 434672|Dalcal1_GeneCatalog_proteins_20190624.aa.fasta|GH43_25|GH43_25|CBM35 310 YEAEHAVLSGRTVVKDCSECLSKRSVHGV-GDSSEVTFHN 348 9*************************999.99999***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 ++ + +s++Y+ + ++ + ++vn++ +++ + 434672|Dalcal1_GeneCatalog_proteins_20190624.aa.fasta|GH43_25|GH43_25|CBM35 349 VTGTGSRQWFSFHYRVTNPEAGEAHIFVNDEPPVNISSLN 388 557778889*******99*************988776555 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 + + + ++ +++tLk G+ ntit+++ + G+ +d 434672|Dalcal1_GeneCatalog_proteins_20190624.aa.fasta|GH43_25|GH43_25|CBM35 389 SrAGYHA--STPVQLTLKRGDvNTITFGAtgSDGFEvSVD 426 5266666..***********77******988666533777 PP CBM35.hmm 116 sle 118 +e 434672|Dalcal1_GeneCatalog_proteins_20190624.aa.fasta|GH43_25|GH43_25|CBM35 427 GIE 429 766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 131.82 // Query: 1894234|Mycmet1_GeneCatalog_proteins_20180505.aa.fasta|GH43_25|GH43_25|CBM35 [L=438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-07 18.6 1.5 1.8e-07 18.6 1.5 2.3 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.0 0.25 0.5 87 108 .. 29 52 .. 23 59 .. 0.77 2 ? -3.7 0.1 0.72 1.4 60 80 .. 245 265 .. 240 276 .. 0.65 3 ! 18.6 1.5 9.2e-08 1.8e-07 28 107 .. 339 416 .. 319 428 .. 0.82 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.25 CBM35.hmm 87 wgtaagtvtLkaGkntitiks..d 108 w+++ g L G + i+++ 1894234|Mycmet1_GeneCatalog_proteins_20180505.aa.fasta|GH43_25|GH43_25|CBM35 29 WTDTSGAKILAHGGHVIKVGTtfY 52 677888999999****99987444 PP == domain 2 score: -3.7 bits; conditional E-value: 0.72 CBM35.hmm 60 stktlsvvvnGtkvsevtfps 80 s+++ ++v+ Gt+ ++ f 1894234|Mycmet1_GeneCatalog_proteins_20180505.aa.fasta|GH43_25|GH43_25|CBM35 245 SQNSAELVITGTSTTTYIFLG 265 456667777777777766654 PP == domain 3 score: 18.6 bits; conditional E-value: 9.2e-08 CBM35.hmm 28 glqaagdavtfnvdvpkaGsYelslrYangtgstktlsvv 67 ++ +++++vtf+ + ++++ +s++Y+ ++ + + v+ 1894234|Mycmet1_GeneCatalog_proteins_20180505.aa.fasta|GH43_25|GH43_25|CBM35 339 NI-NSSSNVTFTNVIGNGDKQWVSFKYSVSNVYAGEAHVS 377 44.78999****999************************* PP CBM35.hmm 68 vnGtkvsevt.fpst.gnwdtwgtaagtvtLkaGkntiti 105 vnG++ +++ ++s g + +t+ + ++Lk+G+nt+t+ 1894234|Mycmet1_GeneCatalog_proteins_20180505.aa.fasta|GH43_25|GH43_25|CBM35 378 VNGAAPINLSeLNSRaGHF---TTVPVALSLKNGANTLTF 414 ****977554155553333...47***************9 PP CBM35.hmm 106 ks 107 + 1894234|Mycmet1_GeneCatalog_proteins_20180505.aa.fasta|GH43_25|GH43_25|CBM35 415 GT 416 87 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (438 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.59 // Query: 76056|Dalloc1_GeneCatalog_proteins_20190624.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-13 35.6 2.7 2.3e-11 31.2 0.0 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.9 0.8 0.0032 0.0063 55 108 .. 232 289 .. 199 303 .. 0.67 2 ! 31.2 0.0 1.1e-11 2.3e-11 1 118 [. 310 429 .. 310 430 .. 0.87 Alignments for each domain: == domain 1 score: 3.9 bits; conditional E-value: 0.0032 CBM35.hmm 55 angtgstktlsvvvnGtkvsevtfpstgnwdtw.....gt 89 +n gs++t +++v G+++ ++ +wd+ ++ 76056|Dalloc1_GeneCatalog_proteins_20190624.aa.fasta|GH43_25|GH43_25|CBM35 232 QNTYGSQNTFELTVKGSQKTTYIYMGD-AWDSKggassNY 270 566677778888888887765444333.455432222367 PP CBM35.hmm 90 aagtvtLkaGkntitiksd 108 + ++ +aG+++++i++ 76056|Dalloc1_GeneCatalog_proteins_20190624.aa.fasta|GH43_25|GH43_25|CBM35 271 VWAPLNINAGSHSVQIDYH 289 8888999999999999983 PP == domain 2 score: 31.2 bits; conditional E-value: 1.1e-11 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v ++ ++ ++ v gl +++++vtf+ 76056|Dalloc1_GeneCatalog_proteins_20190624.aa.fasta|GH43_25|GH43_25|CBM35 310 YEAEHAVLSGRTVVKDCNECLSKRSVHGL-GDSSEVTFHN 348 9****************************.99999***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++ + +s++Y+ + ++ + ++vn++ + +++ ++ 76056|Dalloc1_GeneCatalog_proteins_20190624.aa.fasta|GH43_25|GH43_25|CBM35 349 VTGTGSRQWFSFHYRVTNPEAGEAHIFVNDEPAVNISsLN 388 557778889*******99*************999776156 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 s + + t ++ +++tLk G+ ntit+++ + G+ +d 76056|Dalloc1_GeneCatalog_proteins_20190624.aa.fasta|GH43_25|GH43_25|CBM35 389 SRAGYHT--STPVQLTLKPGDvNTITFGAtgSDGFEvAVD 426 6688888..***********77******988666533777 PP CBM35.hmm 116 sle 118 +e 76056|Dalloc1_GeneCatalog_proteins_20190624.aa.fasta|GH43_25|GH43_25|CBM35 427 GIE 429 776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 125.07 // Query: 554164|Xyltel121673_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 [L=420] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-06 14.1 3.3 1.3e-05 12.6 0.1 2.3 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.7 0.8 0.015 0.03 54 107 .. 231 288 .. 202 305 .. 0.68 2 ! 12.6 0.1 6.4e-06 1.3e-05 31 107 .. 324 400 .. 298 415 .. 0.79 Alignments for each domain: == domain 1 score: 1.7 bits; conditional E-value: 0.015 CBM35.hmm 54 YangtgstktlsvvvnGtkvsevtfpstgnwdtw.....g 88 +n gs++t +++v G+++ ++ +wd+ + 554164|Xyltel121673_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 231 AQNTYGSQNTFELTVKGSQKTTYIYMGD-AWDSKggassN 269 5566677778888888887775544333.45543222236 PP CBM35.hmm 89 taagtvtLkaGkntitiks 107 ++ ++ + G++ti++++ 554164|Xyltel121673_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 270 YVWLPMNINSGAKTIQLDY 288 7788889999999999887 PP == domain 2 score: 12.6 bits; conditional E-value: 6.4e-06 CBM35.hmm 31 aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnG 70 ++ ++vtf+ ++ ls++Y+ ++ ++ + v+vn+ 554164|Xyltel121673_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 324 DEPNEVTFHNVTGTGSLQWLSFHYQVNNPEAGEAYVIVND 363 4557899996557888899********************* PP CBM35.hmm 71 tkvsevtfpst.gnwdtwgtaagtvtLkaG.kntitiks 107 + + +++ ++ + + + ++ ++++L+ G +ntit++ 554164|Xyltel121673_1_GeneCatalog_proteins_20190615.aa.fasta|GH43_25|GH43_25|CBM35 364 EPAVNISSLNSrAGYHD--STPVQLKLRDGdANTITFGF 400 *9997765555277777..9**********559***987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (420 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 46.22 // Query: 919726|Mycepi1_GeneCatalog_proteins_20171002.aa.fasta|GH43_25|GH43_25|CBM35 [L=430] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-07 16.8 1.0 6.6e-07 16.8 1.0 2.6 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.13 0.27 87 109 .. 28 52 .. 19 58 .. 0.79 2 ? -1.8 0.1 0.19 0.38 53 85 .. 223 254 .. 190 262 .. 0.68 3 ! 16.8 1.0 3.3e-07 6.6e-07 29 107 .. 332 408 .. 304 415 .. 0.78 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.13 CBM35.hmm 87 wgtaagtvtLkaGkntitiks..dw 109 w+++ g L G + i+++s w 919726|Mycepi1_GeneCatalog_proteins_20171002.aa.fasta|GH43_25|GH43_25|CBM35 28 WTDTSGAKILAHGGHVIKVGStfYW 52 667889999*********9985544 PP == domain 2 score: -1.8 bits; conditional E-value: 0.19 CBM35.hmm 53 rYangtgstktlsvvvnGtkvsevtfpstgnwd 85 n s+++ ++v+ Gt++ ++ f +wd 919726|Mycepi1_GeneCatalog_proteins_20171002.aa.fasta|GH43_25|GH43_25|CBM35 223 ETTNTYNSQNSAELVITGTSATTYIFLGD-AWD 254 55565566777888888888887777655.455 PP == domain 3 score: 16.8 bits; conditional E-value: 3.3e-07 CBM35.hmm 29 lqaagdavtfnvdvpkaGsYelslrYangtgstktlsvvv 68 + ++ ++vtf+ v k+++ +s++Y ++ ++ + v+v 919726|Mycepi1_GeneCatalog_proteins_20171002.aa.fasta|GH43_25|GH43_25|CBM35 332 I-NSFSNVTFTNVVGKGDKQWVSFKYTVSNVTAGEAHVSV 370 4.56689********************************* PP CBM35.hmm 69 nGtkvs.evtfpst.gnwdtwgtaagtvtLkaGkntitik 106 nG+ +++ g + +t+ + ++L++G+nt+t++ 919726|Mycepi1_GeneCatalog_proteins_20171002.aa.fasta|GH43_25|GH43_25|CBM35 371 NGGTPInLSELNCRaGHF---TTVPVALSLEKGTNTLTFG 407 *98866234444442344...46***************98 PP CBM35.hmm 107 s 107 919726|Mycepi1_GeneCatalog_proteins_20171002.aa.fasta|GH43_25|GH43_25|CBM35 408 T 408 6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (430 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 136.82 // Query: 1395186|Mycreb1_GeneCatalog_proteins_20171023.aa.fasta|GH43_25|GH43_25|CBM35 [L=439] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-07 18.1 1.8 2.5e-07 18.1 1.8 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.8 0.0 0.76 1.5 87 106 .. 29 48 .. 26 53 .. 0.79 2 ! 18.1 1.8 1.3e-07 2.5e-07 26 107 .. 338 417 .. 316 424 .. 0.80 Alignments for each domain: == domain 1 score: -3.8 bits; conditional E-value: 0.76 CBM35.hmm 87 wgtaagtvtLkaGkntitik 106 w+++ g L G + i+++ 1395186|Mycreb1_GeneCatalog_proteins_20171023.aa.fasta|GH43_25|GH43_25|CBM35 29 WTDTSGAKILAHGGHVIKVG 48 66788888899999999886 PP == domain 2 score: 18.1 bits; conditional E-value: 1.3e-07 CBM35.hmm 26 vdglqaagdavtfnvdvpkaGsYelslrYangtgstktls 65 v ++ + +++vtf+ v ++++ +s+ Y ++ ++ + 1395186|Mycreb1_GeneCatalog_proteins_20171023.aa.fasta|GH43_25|GH43_25|CBM35 338 VHNI-NRSSNVTFTNIVGNGDKQWVSFEYTVSNVTAGEAH 376 5444.78999****************************** PP CBM35.hmm 66 vvvnGtkvsevt.fpstgnwdtwgtaagtvtLkaGkntit 104 v+vnG + +++ ++s + +t+ + +tL++G+n++t 1395186|Mycreb1_GeneCatalog_proteins_20171023.aa.fasta|GH43_25|GH43_25|CBM35 377 VSVNGRAPINLSeLNSRAGHH--STVPVALTLNKGANSLT 414 *****9987655155554444..59*************** PP CBM35.hmm 105 iks 107 ++ 1395186|Mycreb1_GeneCatalog_proteins_20171023.aa.fasta|GH43_25|GH43_25|CBM35 415 FGT 417 986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (439 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.00 // Query: 1253381|Mycale1_GeneCatalog_proteins_20171027.aa.fasta|GH43_25|GH43_25|CBM35 [L=420] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-08 20.4 3.8 6.3e-08 20.1 1.8 2.2 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.0 0.22 0.45 87 108 .. 29 52 .. 21 59 .. 0.78 2 ! 20.1 1.8 3.1e-08 6.3e-08 28 108 .. 321 402 .. 301 409 .. 0.81 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.22 CBM35.hmm 87 wgtaagtvtLkaGkntitiks..d 108 w+++ g L G + i+++ 1253381|Mycale1_GeneCatalog_proteins_20171027.aa.fasta|GH43_25|GH43_25|CBM35 29 WTDTSGAKILAHGGHVIKVGTtfY 52 667888999999****99987444 PP == domain 2 score: 20.1 bits; conditional E-value: 3.1e-08 CBM35.hmm 28 glqaagdavtfnvdvpkaGsYelslrYangtgstktlsvv 67 ++ +++++vtf+ + ++++ +s++Y+ ++ ++ + v+ 1253381|Mycale1_GeneCatalog_proteins_20171027.aa.fasta|GH43_25|GH43_25|CBM35 321 NI-NSTSNVTFTNVIGNGDKQWVSFKYSVSNVTAGEAHVS 359 44.78899****999************************* PP CBM35.hmm 68 vnGtkvs.evtfpstgnwdtwgtaagtvtLkaGkntitik 106 vnG+ +++s + ++t+ + ++Lk+G+nt+t++ 1253381|Mycale1_GeneCatalog_proteins_20171027.aa.fasta|GH43_25|GH43_25|CBM35 360 VNGAGPInLSELNSR--AGHFTTVPVALSLKKGANTLTFG 397 ***987624445555..333347****************9 PP CBM35.hmm 107 s...d 108 + + 1253381|Mycale1_GeneCatalog_proteins_20171027.aa.fasta|GH43_25|GH43_25|CBM35 398 AtavN 402 85544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (420 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.23 // Query: 589673|Xyllon1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 [L=420] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (420 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 562.66 // Query: 121493|Lopma1_GeneCatalog_proteins_20130805.aa.fasta|GH43_25|GH43_25|CBM35 [L=439] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-06 16.2 0.9 3.2e-06 14.6 0.0 2.3 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.2 0.13 0.26 67 85 .. 280 297 .. 236 306 .. 0.54 2 ! 14.6 0.0 1.6e-06 3.2e-06 1 107 [. 314 419 .. 314 435 .. 0.76 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.13 CBM35.hmm 67 vvnGtkvsevtfpstgnwd 85 +v +t++++vt++ ++w+ 121493|Lopma1_GeneCatalog_proteins_20130805.aa.fasta|GH43_25|GH43_25|CBM35 280 TV-DTANKKVTLDYHAQWK 297 22.3455566666666665 PP == domain 2 score: 14.6 bits; conditional E-value: 1.6e-06 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe a++ g ++ + + + v ++ ++++avtf+ 121493|Lopma1_GeneCatalog_proteins_20130805.aa.fasta|GH43_25|GH43_25|CBM35 314 YEAERAEIVGRAAVGECGRCLNKRGVRKI-TSDSAVTFHN 352 89999999995555555555555558777.88999****6 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevtfps 80 +G+ ++++Y ++ + ++ v+vn++ + +++ + 121493|Lopma1_GeneCatalog_proteins_20130805.aa.fasta|GH43_25|GH43_25|CBM35 353 VTGLGGRQWVQFHYHMQDRNLAEAHVYVNDQPAVNISSLN 392 66899**************************999776555 PP CBM35.hmm 81 t.gnwdtwgtaagtvtLkaGk.ntitiks 107 + + + + ++++L++G+ n+i ++ 121493|Lopma1_GeneCatalog_proteins_20130805.aa.fasta|GH43_25|GH43_25|CBM35 393 HrAGYHD--IVPIELNLREGAdNKIIFSV 419 5266666..99999999999636776665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (439 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.95 // Query: 201296|Daldec1_GeneCatalog_proteins_20190620.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-12 34.1 2.7 5.5e-11 29.9 0.0 2.4 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.7 0.7 0.0038 0.0075 55 108 .. 232 289 .. 200 302 .. 0.68 2 ! 29.9 0.0 2.8e-11 5.5e-11 1 118 [. 310 429 .. 310 430 .. 0.87 Alignments for each domain: == domain 1 score: 3.7 bits; conditional E-value: 0.0038 CBM35.hmm 55 angtgstktlsvvvnGtkvsevtfpstgnwdtw.....gt 89 +n gs++t +++v G+++ ++ +wd+ ++ 201296|Daldec1_GeneCatalog_proteins_20190620.aa.fasta|GH43_25|GH43_25|CBM35 232 QNTYGSQNTFELTVKGSQKTTYIYMGD-AWDSKggassNY 270 555667777888888877665444333.454432222367 PP CBM35.hmm 90 aagtvtLkaGkntitiksd 108 + ++ +aG+++++i++ 201296|Daldec1_GeneCatalog_proteins_20190620.aa.fasta|GH43_25|GH43_25|CBM35 271 VWAPLNINAGSHSVQIDYH 289 8888999999999999983 PP == domain 2 score: 29.9 bits; conditional E-value: 2.8e-11 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v ++ ++ ++ v g+ +++++v f+ 201296|Daldec1_GeneCatalog_proteins_20190620.aa.fasta|GH43_25|GH43_25|CBM35 310 YEAEHAVLSGRTVVKDCNECLSKRSVHGV-GDSSEVAFHN 348 9*************************999.89999***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++ + ls++Y+ + ++ + ++vn++ + +++ ++ 201296|Daldec1_GeneCatalog_proteins_20190620.aa.fasta|GH43_25|GH43_25|CBM35 349 VTGTGSRQWLSFHYRVTNPEAGEAHIFVNDEPAVNISsLN 388 557888889**********************999776156 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 s + + t ++ +++tLk G+ ntit+++ + G+ +d 201296|Daldec1_GeneCatalog_proteins_20190620.aa.fasta|GH43_25|GH43_25|CBM35 389 SRAGYHT--STPVQLTLKPGDvNTITFGAtgSDGFEvAVD 426 6688888..***********77******988666533777 PP CBM35.hmm 116 sle 118 +e 201296|Daldec1_GeneCatalog_proteins_20190620.aa.fasta|GH43_25|GH43_25|CBM35 427 GIE 429 776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 121.72 // Query: 697059|LraINPA1820_1_GeneCatalog_proteins_20190216.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 629.99 // Query: 1221877|Lenedo1_GeneCatalog_proteins_20170719.aa.fasta|GH43_25|GH43_25|CBM35 [L=455] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (455 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 685.24 // Query: 974333|Patat1_GeneCatalog_proteins_20130514.aa.fasta|GH43_25|GH43_25|CBM35 [L=439] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-10 28.4 0.4 6.2e-10 26.6 0.0 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.1 0.14 0.27 88 107 .. 273 292 .. 235 300 .. 0.49 2 ! 26.6 0.0 3.1e-10 6.2e-10 1 108 [. 314 424 .. 314 435 .. 0.81 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.14 CBM35.hmm 88 gtaagtvtLkaGkntitiks 107 +++ ++ + G++++t+++ 974333|Patat1_GeneCatalog_proteins_20130514.aa.fasta|GH43_25|GH43_25|CBM35 273 NYVWLPMNVNTGSKSVTLQY 292 44455555555555555554 PP == domain 2 score: 26.6 bits; conditional E-value: 3.1e-10 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfn. 39 yeA+da ++g+++ t g+ ++ v ++ ++++++tf+ 974333|Patat1_GeneCatalog_proteins_20130514.aa.fasta|GH43_25|GH43_25|CBM35 314 YEAADADIKGNAALTACEGCISKRSVHKI-DSSSQITFRn 352 9**************************99.7888999994 PP CBM35.hmm 40 vdvpkaGsYelslrYangtgstktlsvvvnGtkvs..evt 77 v+ ++G+ ++++Y ++ + v+vn++ + 974333|Patat1_GeneCatalog_proteins_20130514.aa.fasta|GH43_25|GH43_25|CBM35 353 VT-AAGGRQWVQFHYNVNDRNRGDAHVYVNDDPLPlnISN 391 66.599***************************9953333 PP CBM35.hmm 78 fpstgnwdtwgtaagtvtLkaG.kntitiks...d 108 ++ + + +++ +++ Lk+G +ntit++ + 974333|Patat1_GeneCatalog_proteins_20130514.aa.fasta|GH43_25|GH43_25|CBM35 392 LNHRAGYH--HVVPVELDLKEGsENTITFGGvgsS 424 44444444..5***********559**99864444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (439 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 147.19 // Query: 89000|XylFL1019_GeneCatalog_proteins_20190320.aa.fasta|GH43_25|GH43_25|CBM35 [L=417] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (417 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 579.47 // Query: 96760|Mycpur1_GeneCatalog_proteins_20190304.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-07 18.8 1.2 4.7e-07 17.2 1.2 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 17.2 1.2 2.4e-07 4.7e-07 24 107 .. 334 415 .. 314 424 .. 0.79 Alignments for each domain: == domain 1 score: 17.2 bits; conditional E-value: 2.4e-07 CBM35.hmm 24 gfvdglqaagdavtfnvdvpkaGsYelslrYangtgstkt 63 v ++ +++++vtf+ + +++ +s++Y ++ ++ + 96760|Mycpur1_GeneCatalog_proteins_20190304.aa.fasta|GH43_25|GH43_25|CBM35 334 RAVHNI-NSSSNVTFTNIAGRGEKQWVSFQYTVNNFTAGE 372 456555.88999****999********************* PP CBM35.hmm 64 lsvvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGknti 103 v++nG++ +++ ++ + + ++t+ + ++L++G+nt+ 96760|Mycpur1_GeneCatalog_proteins_20190304.aa.fasta|GH43_25|GH43_25|CBM35 373 AHVSINGGAPINLSELNSRA-GHYSTVPVALELQKGSNTL 411 *******9977655444433.33368************** PP CBM35.hmm 104 tiks 107 t++ 96760|Mycpur1_GeneCatalog_proteins_20190304.aa.fasta|GH43_25|GH43_25|CBM35 412 TFGG 415 *975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 172.21 // Query: 657720|Conlig1_GeneCatalog_proteins_20140604.aa.fasta|GH43_25|GH43_25|CBM35 [L=440] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (440 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 674.87 // Query: 664098|Bisme1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 [L=438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (438 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 689.97 // Query: 1386100|Rhobut1_1_GeneCatalog_proteins_20160415.aa.fasta|GH43_25|GH43_25|CBM35 [L=424] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (424 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 675.58 // Query: 399034|Glost2_GeneCatalog_proteins_20140303.aa.fasta|GH43_25|GH43_25|CBM35 [L=422] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (422 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 513.09 // Query: 1377292|Mycreb1_GeneCatalog_proteins_20171023.aa.fasta|GH43_25|GH43_25|CBM35 [L=439] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-07 16.7 1.8 6.8e-07 16.7 1.8 2.1 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.8 0.0 0.76 1.5 87 106 .. 29 48 .. 26 53 .. 0.79 2 ! 16.7 1.8 3.4e-07 6.8e-07 26 107 .. 338 417 .. 311 424 .. 0.79 Alignments for each domain: == domain 1 score: -3.8 bits; conditional E-value: 0.76 CBM35.hmm 87 wgtaagtvtLkaGkntitik 106 w+++ g L G + i+++ 1377292|Mycreb1_GeneCatalog_proteins_20171023.aa.fasta|GH43_25|GH43_25|CBM35 29 WTDTSGAKILAHGGHVIKVG 48 66788888899999999886 PP == domain 2 score: 16.7 bits; conditional E-value: 3.4e-07 CBM35.hmm 26 vdglqaagdavtfnvdvpkaGsYelslrYangtgstktls 65 v ++ + +++vtf+ v ++++ +s+ Y ++ ++ + 1377292|Mycreb1_GeneCatalog_proteins_20171023.aa.fasta|GH43_25|GH43_25|CBM35 338 VHNI-TRSSNVTFTNIVGNGDKQWVSFEYTVSNDTAGEAH 376 4444.77899****************************** PP CBM35.hmm 66 vvvnGtkvsevt.fpstgnwdtwgtaagtvtLkaGkntit 104 v+vnG++ +++ ++s + +t+ + + L++G+n++t 1377292|Mycreb1_GeneCatalog_proteins_20171023.aa.fasta|GH43_25|GH43_25|CBM35 377 VSVNGGAPINLSeLNSRAGHH--STVPVALALNKGANSLT 414 ****99987555155554444..59*************** PP CBM35.hmm 105 iks 107 ++ 1377292|Mycreb1_GeneCatalog_proteins_20171023.aa.fasta|GH43_25|GH43_25|CBM35 415 FGT 417 986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (439 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.07 // Query: 408692|XylFL0933_GeneCatalog_proteins_20190320.aa.fasta|GH43_25|GH43_25|CBM35 [L=414] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (414 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 544.36 // Query: 1274867|Mycros1_GeneCatalog_proteins_20170424.aa.fasta|GH43_25|GH43_25|CBM35 [L=450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-08 20.9 0.6 1.1e-07 19.3 0.6 1.8 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.3 0.6 5.5e-08 1.1e-07 27 110 .. 350 434 .. 330 440 .. 0.78 Alignments for each domain: == domain 1 score: 19.3 bits; conditional E-value: 5.5e-08 CBM35.hmm 27 dglqaagdavtfnvdvpkaGsYelslrYangtgstktlsv 66 +g+ +++++vtf+ ++++ +s++Y ++ ++ v 1274867|Mycros1_GeneCatalog_proteins_20170424.aa.fasta|GH43_25|GH43_25|CBM35 350 GGI-NSSSNVTFTNIPGRGDKHWVSFQYTVNNVTAGDAHV 388 444.7889999996666777899***************** PP CBM35.hmm 67 vvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntitik 106 +vnG+ +++ ++ + ++t+ + ++Lk+G+nt+t++ 1274867|Mycros1_GeneCatalog_proteins_20170424.aa.fasta|GH43_25|GH43_25|CBM35 389 SVNGGPTINLSELNSR-AGHYSTVPVALSLKEGANTLTFG 427 *****98766544443.334478****************9 PP CBM35.hmm 107 s...dwG 110 + d G 1274867|Mycros1_GeneCatalog_proteins_20170424.aa.fasta|GH43_25|GH43_25|CBM35 428 AtatDDG 434 8665555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (450 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 179.96 // Query: 492847|Trepe1_GeneCatalog_proteins_20140415.aa.fasta|GH43_25|GH43_25|CBM35 [L=414] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-09 23.0 2.3 8.4e-09 22.9 0.1 2.2 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.2 0.0 0.53 1.1 31 49 .. 140 158 .. 133 158 .. 0.79 2 ? -2.1 0.1 0.24 0.48 24 47 .. 235 258 .. 208 279 .. 0.54 3 ! 22.9 0.1 4.2e-09 8.4e-09 1 115 [. 286 406 .. 286 410 .. 0.80 Alignments for each domain: == domain 1 score: -3.2 bits; conditional E-value: 0.53 CBM35.hmm 31 aagdavtfnvdvpkaGsYe 49 +a++a+ +v+v ++G Ye 492847|Trepe1_GeneCatalog_proteins_20140415.aa.fasta|GH43_25|GH43_25|CBM35 140 NADGAIGDRVNVLAKGAYE 158 5667888889999999995 PP == domain 2 score: -2.1 bits; conditional E-value: 0.24 CBM35.hmm 24 gfvdglqaagdavtfnvdvpkaGs 47 ++ ++ ++++v + + v++aG+ 492847|Trepe1_GeneCatalog_proteins_20140415.aa.fasta|GH43_25|GH43_25|CBM35 235 SWDSKGGPDSNYVWLPISVDTAGK 258 433333334444444455544443 PP == domain 3 score: 22.9 bits; conditional E-value: 4.2e-09 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe a++ g ++ ++ a + + v g+ +++++vtf+ 492847|Trepe1_GeneCatalog_proteins_20140415.aa.fasta|GH43_25|GH43_25|CBM35 286 YEAERAEVIGRAAVAECAHCGTKRGVRGF-SHSSTVTFRN 324 9*********999999999999999****.8999****96 PP CBM35.hmm 41 dvpkaGsYelslrYa..ng..tgstktlsvvvnGtkvsev 76 +G ++l+Y+ ng + ++++ v+vn + v +v 492847|Trepe1_GeneCatalog_proteins_20140415.aa.fasta|GH43_25|GH43_25|CBM35 325 VTGLGGLQWVQLHYRvrNGegGEQAAQAHVSVNEGPVVNV 364 668899999999886225544556778899**99998866 PP CBM35.hmm 77 .tfpstgnwdtwgtaagtvtLkaGk.ntitiks...dwGw 111 +++ + w++ ++ ++++L++G+ ntit++ + + 492847|Trepe1_GeneCatalog_proteins_20140415.aa.fasta|GH43_25|GH43_25|CBM35 365 sSLNHRAGWQD--VVPIQLELREGSgNTITFGVsgeAEEA 402 156777*****..***********879***9985554445 PP CBM35.hmm 112 inld 115 + ld 492847|Trepe1_GeneCatalog_proteins_20140415.aa.fasta|GH43_25|GH43_25|CBM35 403 VVLD 406 5555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (414 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 126.85 // Query: 367034|Xylarb124340_1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 [L=415] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (415 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 576.42 // Query: 1489666|Myclat1_GeneCatalog_proteins_20190110.aa.fasta|GH43_25|GH43_25|CBM35 [L=416] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-08 19.7 0.4 8e-08 19.7 0.4 2.8 3 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.0 0.24 0.48 41 58 .. 36 53 .. 32 62 .. 0.75 2 ? -0.1 0.1 0.055 0.11 43 88 .. 221 265 .. 202 272 .. 0.71 3 ! 19.7 0.4 4e-08 8e-08 31 107 .. 327 402 .. 317 411 .. 0.86 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.24 CBM35.hmm 41 dvpkaGsYelslrYangt 58 ++++ G + ++l Y+n+ 1489666|Myclat1_GeneCatalog_proteins_20190110.aa.fasta|GH43_25|GH43_25|CBM35 36 KIQAHGGHVIKLGYSNAA 53 567789999999999963 PP == domain 2 score: -0.1 bits; conditional E-value: 0.055 CBM35.hmm 43 pkaGsYelslrYangtgstktlsvvvnGtkvsevtfpstg 82 p +G+ ++ n s+++ ++v+ Gt++ ++ f 1489666|Myclat1_GeneCatalog_proteins_20190110.aa.fasta|GH43_25|GH43_25|CBM35 221 PWQGDTDIAPEAVNTYNSQNSAELVIKGTSATTYIFLGD- 259 55677777777778777788899999**99999988877. PP CBM35.hmm 83 nwdtwg 88 +wd+ g 1489666|Myclat1_GeneCatalog_proteins_20190110.aa.fasta|GH43_25|GH43_25|CBM35 260 AWDSTG 265 677654 PP == domain 3 score: 19.7 bits; conditional E-value: 4e-08 CBM35.hmm 31 aagdavtfnvdvpkaGsYelslrYangtgstktlsvvvnG 70 +++++vtf+ v ++++ + ++Y ++ ++ v+vnG 1489666|Myclat1_GeneCatalog_proteins_20190110.aa.fasta|GH43_25|GH43_25|CBM35 327 NSSSNVTFTNVVGTGDKQWVAFQYTVSNVTAGDAHVSVNG 366 67899*********************************** PP CBM35.hmm 71 tkvsevtfpstgnwdtwgtaagtvtLkaGkntitiks 107 ++ +++ ++ + ++t+ + ++Lk+G+nt+t++ 1489666|Myclat1_GeneCatalog_proteins_20190110.aa.fasta|GH43_25|GH43_25|CBM35 367 GAPINLSQLNSR-AGHFSTVPVALSLKKGANTLTFDF 402 998877766663.344467***************985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (416 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 170.18 // Query: 629481|LedVB361_1_GeneCatalog_proteins_20190713.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 655.60 // Query: 357346|Chalo1_GeneCatalog_proteins_20130611.aa.fasta|GH43_25|GH43_25|CBM35 [L=424] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (424 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 670.98 // Query: 557196|Mycsan1_GeneCatalog_proteins_20171021.aa.fasta|GH43_25|GH43_25|CBM35 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-09 23.3 1.6 1.9e-08 21.8 1.6 1.9 1 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.8 1.6 9.5e-09 1.9e-08 26 110 .. 336 419 .. 309 427 .. 0.81 Alignments for each domain: == domain 1 score: 21.8 bits; conditional E-value: 9.5e-09 CBM35.hmm 26 vdglqaagdavtfnvdvpkaGsYelslrYangtgstktls 65 v ++ +++++vtf+ v +++ +s++Y ++ +t + 557196|Mycsan1_GeneCatalog_proteins_20171021.aa.fasta|GH43_25|GH43_25|CBM35 336 VHNI-DSSSNVTFTNLVGRGDKQWVSFQYTVNNVTTGEAH 374 4444.67899****************************** PP CBM35.hmm 66 vvvnGtkvsevtfpstgnwdtwgtaagtvtLkaGkntiti 105 v+vnG++ +++ ++ + +t+ + ++L++G+nt+t+ 557196|Mycsan1_GeneCatalog_proteins_20171021.aa.fasta|GH43_25|GH43_25|CBM35 375 VSVNGGEPINLSQLNSRAGHY-STVPVALSLEQGANTLTF 413 *****9988877777754444.78**************** PP CBM35.hmm 106 ks.dwG 110 ++ +G 557196|Mycsan1_GeneCatalog_proteins_20171021.aa.fasta|GH43_25|GH43_25|CBM35 414 GAtATG 419 986555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 209.14 // Query: 466255|DallocAZ0526_2_GeneCatalog_proteins_20191203.aa.fasta|GH43_25|GH43_25|CBM35 [L=299] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-13 37.2 2.8 1.1e-11 32.3 0.0 2.2 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 4.8 0.8 0.0017 0.0034 55 108 .. 94 151 .. 61 165 .. 0.67 2 ! 32.3 0.0 5.3e-12 1.1e-11 1 118 [. 172 291 .. 172 292 .. 0.87 Alignments for each domain: == domain 1 score: 4.8 bits; conditional E-value: 0.0017 CBM35.hmm 55 angtgstktlsvvvnGtkvsevtfpstgnwdtw.....gt 89 +n gs++t +++v G+++ ++ +wd+ ++ 466255|DallocAZ0526_2_GeneCatalog_proteins_20191203.aa.fasta|GH43_25|GH43_25|CBM35 94 QNTYGSQNTFELTVKGSQKTTYIYMGD-AWDSKggassNY 132 566677788888888888775544433.455432222367 PP CBM35.hmm 90 aagtvtLkaGkntitiksd 108 + ++ +aG+++++i++ 466255|DallocAZ0526_2_GeneCatalog_proteins_20191203.aa.fasta|GH43_25|GH43_25|CBM35 133 VWAPLNINAGSHSVQIDYH 151 888999999***9999983 PP == domain 2 score: 32.3 bits; conditional E-value: 5.3e-12 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v ++ ++ ++ v gl +++++vtf+ 466255|DallocAZ0526_2_GeneCatalog_proteins_20191203.aa.fasta|GH43_25|GH43_25|CBM35 172 YEAEHAVLSGRTVVKDCNECLSKRSVHGL-GDSSEVTFHN 210 9****************************.99999***96 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++ + +s++Y+ + ++ + ++vn++ + +++ ++ 466255|DallocAZ0526_2_GeneCatalog_proteins_20191203.aa.fasta|GH43_25|GH43_25|CBM35 211 VTGTGSRQWFSFHYRVTNPEAGEAHIFVNDEPAVNISsLN 250 557778889*******99*************999776156 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 s + + t ++ +++tLk G+ ntit+++ + G+ +d 466255|DallocAZ0526_2_GeneCatalog_proteins_20191203.aa.fasta|GH43_25|GH43_25|CBM35 251 SRAGYHT--STPVQLTLKPGDvNTITFGAtgSDGFEvAVD 288 6688888..***********77******988666533777 PP CBM35.hmm 116 sle 118 +e 466255|DallocAZ0526_2_GeneCatalog_proteins_20191203.aa.fasta|GH43_25|GH43_25|CBM35 289 GIE 291 776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (299 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 109.50 // Query: 114842|LedB17_3_GeneCatalog_proteins_20201027.aa.fasta|GH43_25|GH43_25|CBM35 [L=430] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (430 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 368.50 // Query: 285877|Nemabo1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 [L=427] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (427 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 694.01 // Query: 403779|Xylven1_GeneCatalog_proteins_20190325.aa.fasta|GH43_25|GH43_25|CBM35 [L=409] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (409 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 520.30 // Query: 948358|Lenlat1_GeneCatalog_proteins_20170901.aa.fasta|GH43_25|GH43_25|CBM35 [L=453] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (453 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 678.66 // Query: 11072|MroMCA2997_1_GeneCatalog_proteins_20201126.aa.fasta|GH43_25|GH43_25|CBM35 [L=438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-06 15.6 0.1 4.2e-06 14.2 0.0 1.8 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.2 0.0 0.5 1 23 27 .. 251 255 .. 235 290 .. 0.50 2 ! 14.2 0.0 2.1e-06 4.2e-06 1 111 [. 310 422 .. 310 434 .. 0.82 Alignments for each domain: == domain 1 score: -3.2 bits; conditional E-value: 0.5 CBM35.hmm 23 sgfvd 27 +++v 11072|MroMCA2997_1_GeneCatalog_proteins_20201126.aa.fasta|GH43_25|GH43_25|CBM35 251 TTYVY 255 33331 PP == domain 2 score: 14.2 bits; conditional E-value: 2.1e-06 CBM35.hmm 1 yeAedasltg...vsvntnhagysGsgfvdglqaagdavt 37 yeAe+a+l+ +++ ++ +++ v + +gd+vt 11072|MroMCA2997_1_GeneCatalog_proteins_20201126.aa.fasta|GH43_25|GH43_25|CBM35 310 YEAEHAHLKLrsrAAIIGRCEDCASKQAVHRM-HSGDEVT 348 8999999998778888888999999****988.89999** PP CBM35.hmm 38 fn.vdvpkaGsYelslrYangtgstktlsvvvnGtkvsev 76 f+ v+ + +Y ++++Y ++++ + ++vn++ v + 11072|MroMCA2997_1_GeneCatalog_proteins_20201126.aa.fasta|GH43_25|GH43_25|CBM35 349 FYnVTGLGKLEY-VTFHYTVTNSEAGEAHIYVNDEVVPTN 387 996776655555.899999999****************87 PP CBM35.hmm 77 tfpstgnwdtwgtaagtvtLkaGk.ntitiksdwGw 111 + + + +++ + ++L++G+ nti+++ +G+ 11072|MroMCA2997_1_GeneCatalog_proteins_20201126.aa.fasta|GH43_25|GH43_25|CBM35 388 ISDLNMRAGHHRSVPVPLKLQEGDvNTIRFGV-TGY 422 7777777777789**********779999998.343 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (438 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 148.45 // Query: 22552|Delco1_GeneCatalog_proteins_20140624.aa.fasta|GH43_25|GH43_25|CBM35 [L=438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-07 19.1 2.9 2.7e-07 18.0 0.1 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.4 0.4 0.04 0.081 58 107 .. 238 291 .. 221 306 .. 0.56 2 ! 18.0 0.1 1.4e-07 2.7e-07 3 118 .. 316 433 .. 313 434 .. 0.83 Alignments for each domain: == domain 1 score: 0.4 bits; conditional E-value: 0.04 CBM35.hmm 58 tgstktlsvvvnGtkvsevtfpstgnwdtw.....gtaag 92 s++t +++v G+k+ ++ +wd+ +++ 22552|Delco1_GeneCatalog_proteins_20140624.aa.fasta|GH43_25|GH43_25|CBM35 238 YNSQNTFELTVQGSKRTTYIYMGD-SWDSKggpdsNYVWL 276 445566667777777664443333.344322222255666 PP CBM35.hmm 93 tvtLkaGkntitiks 107 +t + G++++t+++ 22552|Delco1_GeneCatalog_proteins_20140624.aa.fasta|GH43_25|GH43_25|CBM35 277 PMTVDTGNKKVTLDY 291 666666666666665 PP == domain 2 score: 18.0 bits; conditional E-value: 1.4e-07 CBM35.hmm 3 AedasltgvsvntnhagysGsgfvdglqaagdavtfnvdv 42 A +a+++g ++ t+ + ++ v++l a++++vtf+ 22552|Delco1_GeneCatalog_proteins_20140624.aa.fasta|GH43_25|GH43_25|CBM35 316 AKHATISGRATITQCDYCLSKRGVSNL-ASDSEVTFRNVT 354 778999999999999999999999999.88899***9666 PP CBM35.hmm 43 pkaGsYelslrYangtgstktlsvvvnGtkvsevtfpst. 81 +G+ ++++Y+ ++ + + v+vn++ + +++ + 22552|Delco1_GeneCatalog_proteins_20140624.aa.fasta|GH43_25|GH43_25|CBM35 355 GLGGRQWVQFHYKVQNRMAGEAHVIVNDGPAMNISTLNHr 394 899***********************99999988776662 PP CBM35.hmm 82 gnwdtwgtaagtvtLkaG.kntitiks....dwGwinlds 116 + + + + ++++L++G +ntit+++ d G + ld 22552|Delco1_GeneCatalog_proteins_20140624.aa.fasta|GH43_25|GH43_25|CBM35 395 AGYHN--IVPVELELQEGlANTITFGMtgseDAGIV-LDG 431 55555..9**********77******9887555544.666 PP CBM35.hmm 117 le 118 +e 22552|Delco1_GeneCatalog_proteins_20140624.aa.fasta|GH43_25|GH43_25|CBM35 432 IE 433 65 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (438 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.54 // Query: 38381|Lenrap1_155_GeneCatalog_proteins_20180804.aa.fasta|GH43_25|GH43_25|CBM35 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 627.83 // Query: 257963|HyprubER1909_1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 [L=435] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-13 36.4 5.7 5.1e-12 33.3 0.3 2.5 2 CBM35.hmm Domain annotation for each model (and alignments): >> CBM35.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.3 0.8 0.0012 0.0024 55 108 .. 231 288 .. 199 300 .. 0.67 2 ! 33.3 0.3 2.6e-12 5.1e-12 1 117 [. 309 427 .. 309 429 .. 0.86 Alignments for each domain: == domain 1 score: 5.3 bits; conditional E-value: 0.0012 CBM35.hmm 55 angtgstktlsvvvnGtkvsevtfpstgnwdtw.....gt 89 n gs++t +++v G+++ ++ +wd+ ++ 257963|HyprubER1909_1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 231 ENTYGSQNTFELTVAGSQKTTYVYMGD-AWDSKggassNY 269 555666777778888777664443333.444432222368 PP CBM35.hmm 90 aagtvtLkaGkntitiksd 108 + ++ +aG++t+ti++ 257963|HyprubER1909_1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 270 VWAPMNINAGAHTVTIDYH 288 889999*********9983 PP == domain 2 score: 33.3 bits; conditional E-value: 2.6e-12 CBM35.hmm 1 yeAedasltgvsvntnhagysGsgfvdglqaagdavtfnv 40 yeAe+a l+g +v ++ g+ ++ v g+ ++ ++vtf+ 257963|HyprubER1909_1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 309 YEAEHAVLSGRTVVKECGGCVSKRSVHGV-GDASEVTFHN 347 9*************************999.8888999996 PP CBM35.hmm 41 dvpkaGsYelslrYangtgstktlsvvvnGtkvsevt.fp 79 ++ + ls++Y+ ++ + + ++vn++ + +++ ++ 257963|HyprubER1909_1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 348 VTGTGSRQWLSFHYQVNNPEVGEAHIYVNDEPAINISsLN 387 557888889**********************999776155 PP CBM35.hmm 80 stgnwdtwgtaagtvtLkaGk.ntitiks..dwGwi.nld 115 s + + t ++ +++tLkaG+ ntit+++ +G+ +d 257963|HyprubER1909_1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 388 SRAGYHT--STPVQLTLKAGDvNTITFGAtgAEGFEvSVD 425 5588888..***********77*****9977666533666 PP CBM35.hmm 116 sl 117 + 257963|HyprubER1909_1_GeneCatalog_proteins_20190612.aa.fasta|GH43_25|GH43_25|CBM35 426 GI 427 66 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (435 residues searched) Target model(s): 2 (268 nodes) Passed MSV filter: 1 (0.5); expected 0.0 (0.02) Passed bias filter: 1 (0.5); expected 0.0 (0.02) Passed Vit filter: 1 (0.5); expected 0.0 (0.001) Passed Fwd filter: 1 (0.5); expected 0.0 (1e-05) Initial search space (Z): 2 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 121.62 // [ok]