# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM34/fasta_for_each_cluster/cluster_20.txt # target HMM database: merged_hmms/CBM34.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM34/CBM34_cluster_20.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: XJT37448.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XJT37448.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XJT37448.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.27 // Query: BDF58635.1|CBM34|GH13_39 [L=669] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-15 43.0 0.5 8.5e-15 41.6 0.0 2.0 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 41.6 0.0 8.5e-15 8.5e-15 2 118 .. 11 131 .. 10 133 .. 0.90 2 ? -2.3 0.5 0.34 0.34 80 106 .. 272 300 .. 268 320 .. 0.54 Alignments for each domain: == domain 1 score: 41.6 bits; conditional E-value: 8.5e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 H++ rsp g++++++t+++ L +k ++ V+l++ + + +++++M+ + +w a +++ epg l+Y F ++ BDF58635.1|CBM34|GH13_39 11 IHDSaqerfRSPTGALPCNTTVRLALALKDVYLQTVYLVVINGQ--DTQTIEMRL-----QEGVWAADYTVpsEPGVLWYWFCIK 88 688889999*********************************99..79*******.....3469999999888************ PP CBM34.hmm 80 dgd.ekvyygengfs..gegpedl.epasyqgnvfevpyinei 118 gd k+yyg++ + g+g ++ ep+ q +v++ + +++ BDF58635.1|CBM34|GH13_39 89 LGDgAKIYYGARSGQtcGVGMTYWnEPPAFQLTVHDEAFTTPN 131 9999********9999999999998888999999987777665 PP == domain 2 score: -2.3 bits; conditional E-value: 0.34 CBM34.hmm 80 dgdekvyygengfsgegpedl.epa.syq 106 +gd+++y+++ g ++ +++ ++ y BDF58635.1|CBM34|GH13_39 272 TGDDSIYFNKYGSYDSLGAYQsQESpFYH 300 56677777777777444444422222222 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (669 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 90.49 // Query: XQC64730.1|CBM34|GH13_39|GH77 [L=1125] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-16 47.5 0.0 3.2e-16 46.2 0.0 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.2 0.0 3.2e-16 3.2e-16 3 112 .. 5 134 .. 4 142 .. 0.90 Alignments for each domain: == domain 1 score: 46.2 bits; conditional E-value: 3.2e-16 CBM34.hmm 3 Hrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdel...........fdyweatik 66 H++ rs g+v g++l++++ ++ d + +V lr++ + ++e+ +pM+k+g +e + + +t++ XQC64730.1|CBM34|GH13_39|GH77 5 HNSldtryRSIAGAVAVGEQLRLTIDIWDDVPRRVVLRTWTDE-EKEKLVPMRKVGCSERrnialcgelngGCRYGVTLT 83 666666779999*******************************.88********999887788899999999******** PP CBM34.hmm 67 l.epgrlrYyFeledgd.ekvyygengfs..gegpedl.epasyqgnvfev 112 + +p+ l+Y F++++++ +++ yg+ ++ g+g + ep+s q++v++ XQC64730.1|CBM34|GH13_39|GH77 84 FdKPQVLWYSFQITSSKgDVWRYGAAQEDkvGVGAFAYgEPPSFQVTVYKK 134 **************8888***********8899999999999999999985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1125 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 131.59 // Query: WPC40595.1|CBM34|GH13_39 [L=643] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-19 55.8 0.2 3.3e-19 55.8 0.2 1.9 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 55.8 0.2 3.3e-19 3.3e-19 1 119 [. 6 133 .. 6 134 .. 0.91 2 ? -3.5 0.4 0.79 0.79 72 86 .. 295 310 .. 269 311 .. 0.70 Alignments for each domain: == domain 1 score: 55.8 bits; conditional E-value: 3.3e-19 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFe 77 i+H++ r pfg+v++++ +h+r+ ++ + v+ V+l++ d+y +++ +pM e ++++ +++ ++k +p +l YyFe WPC40595.1|CBM34|GH13_39 6 ILHNSwdsffRCPFGAVECDKDIHLRIEITAnSYVNVVKLVIFDDY--NKNYYPMDFEFKENDKTVFNFNLKTpaNPSLLFYYFE 88 679999999999***************8887467999*********..89**********999999999999999********** PP CBM34.hmm 78 ledgdekvyygengfs..gegpedl.epasyqgnvfevpyineid 119 + +++++yyg+n + g+g+ ++ +p yq++vf+ y ++++ WPC40595.1|CBM34|GH13_39 89 VWIDNKVLYYGNNSLLtgGKGDLYEsSPLPYQITVFQKGYSTPNW 133 ****************8888888887777********99987765 PP == domain 2 score: -3.5 bits; conditional E-value: 0.79 CBM34.hmm 72 lrYyFeledgd.ekvy 86 +Y F+ + ++ e+++ WPC40595.1|CBM34|GH13_39 295 SWYNFKNHPNEyESWW 310 4777777666656655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (643 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.03 // Query: XOW10550.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-15 44.3 0.1 2.6e-15 43.2 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.2 0.1 2.6e-15 2.6e-15 2 111 .. 3 120 .. 2 128 .. 0.84 Alignments for each domain: == domain 1 score: 43.2 bits; conditional E-value: 2.6e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ XOW10550.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRITIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfe 111 +++ ++ +yg +g+ geg + e++ yq +vfe XOW10550.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFE 120 766677799*********999888744443345555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 105.82 // Query: WLF69316.1|CBM34|GH13_39 [L=608] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-14 39.6 0.2 3.4e-14 39.6 0.2 1.8 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.6 0.2 3.4e-14 3.4e-14 1 111 [. 6 124 .. 6 131 .. 0.89 2 ? -4.1 0.5 1 1 87 87 .. 291 291 .. 264 311 .. 0.51 Alignments for each domain: == domain 1 score: 39.6 bits; conditional E-value: 3.4e-14 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsde.lfdyweatikl..epgrlrYyFe 77 i+H++ r pfg+v+ g ++ +++ +k + V l+ + e el Mk++ +++ + + + ++i+ g+++YyF+ WLF69316.1|CBM34|GH13_39 6 IFHNSwdikyRAPFGAVEVGRNVSLSIISNKYVISYVHLIFFNGE---ELELLMKRIDEEKfEKYTFNIEIDTskLRGLVNYYFK 87 79************************************9999966...9*******9999944555666666698899******* PP CBM34.hmm 78 ledgdekvyygengfs..gegpedl.epasyqgnvfe 111 + ++e++yyg+n++ g+g + +p+ yq++v++ WLF69316.1|CBM34|GH13_39 88 IIYNNEVFYYGNNEEGlgGKGSLYImNPKPYQITVYK 124 *************999989999999889999999997 PP == domain 2 score: -4.1 bits; conditional E-value: 1 CBM34.hmm 87 y 87 y WLF69316.1|CBM34|GH13_39 291 Y 291 1 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (608 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 111.45 // Query: WYC80580.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-14 38.5 0.2 1.7e-13 37.4 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.4 0.2 1.7e-13 1.7e-13 2 114 .. 3 123 .. 2 129 .. 0.83 Alignments for each domain: == domain 1 score: 37.4 bits; conditional E-value: 1.7e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k g + ++a++k+ ++g+++YyFe+ + + WYC80580.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TIKFIIRRDF-GARSEFDMQKLG----GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.9999999999.99********43....678*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvfevpy 114 +k+yyg +g+ geg ++ e++ yq + f + WYC80580.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMkENDvrPYQATIFSMRD 123 4567***********999999876665567777776655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.29 // Query: UWE05681.1|CBM34|GH13_39 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-11 31.3 1.9 2.7e-11 30.3 1.9 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.3 1.9 2.7e-11 2.7e-11 6 110 .. 13 114 .. 3 123 .. 0.79 Alignments for each domain: == domain 1 score: 30.3 bits; conditional E-value: 2.7e-11 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFeledgdekvyyge 89 +spfg++++++t++ r+++ + v+ ++l++ + ++ +pMkk+ + + +++++++ + g++ YyFe++++++ yy+e UWE05681.1|CBM34|GH13_39 13 KSPFGAIKARTTVTWRVKID-EPVDYINLWLTKAE-ETPVPYPMKKTDE----QTYQVQVTIgTSGLYHYYFEIKQSNQISYYQE 91 89*****************9.799*********99.8899******444....66***********************9999998 PP CBM34.hmm 90 ngfs.gegpedlepa.syqgnvf 110 ge +++++ +yq +++ UWE05681.1|CBM34|GH13_39 92 ALGGeGELVTSNQNLaQYQLTCY 114 65542333333334446666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 93.66 // Query: WFT74753.1|CBM34|GH13_39 [L=639] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-20 57.9 0.1 2.1e-19 56.5 0.1 1.8 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.5 0.1 2.1e-19 2.1e-19 1 119 [. 6 135 .. 6 136 .. 0.87 Alignments for each domain: == domain 1 score: 56.5 bits; conditional E-value: 2.1e-19 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVt.lrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFe 77 iyH++ r+pfg++++g+++++++ +++ ++s+ l+y + +++ee+++M ++ ++ + +e t+k+ +p++++Y+Fe WFT74753.1|CBM34|GH13_39 6 IYHNSfeltyREPFGAAPKGSSVTLTIDINHRYPDSCVlLHYIYDKTDQEETIEMDRVSEKSPCCSFETTLKMpeDPQLIWYFFE 90 89*****************************888876515666666789************************************ PP CBM34.hmm 78 ledgdekvyygengfs..gegpedl.epasyqgnvfevpyineid 119 ++ ++ek+yyg + + geg ++ p+s q++v++ y ++ + WFT74753.1|CBM34|GH13_39 91 VRMEGEKLYYGRLNNEesGEGVVYEgLPPSWQITVYDPSYETPAW 135 ***********8777745666666666779999999988866665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (639 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 91.28 // Query: WFN82903.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-15 43.3 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ WFN82903.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe WFN82903.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.85 // Query: BFJ61893.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-14 39.2 0.2 1e-13 38.1 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.1 0.2 1e-13 1e-13 2 110 .. 3 119 .. 2 128 .. 0.80 Alignments for each domain: == domain 1 score: 38.1 bits; conditional E-value: 1e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k +d+ +++++k+ ++g+++YyFe+ + + BFJ61893.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TAKFIIRRDF-GARSEFDMQK-LEDG---IFSVSVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.7777777778.79********.6777...8999999999***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvf 110 +k+yyg +g+ geg ++ e++ yq + f BFJ61893.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnENDvrPYQATIF 119 4567***********99999885444333444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.28 // Query: WMX70698.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-15 44.5 0.3 2e-15 43.6 0.3 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.6 0.3 2e-15 2e-15 2 112 .. 3 117 .. 2 125 .. 0.84 Alignments for each domain: == domain 1 score: 43.6 bits; conditional E-value: 2e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+v+ g+++ +++ +++ +v +V++++ +++ ++++e+ M++ de ++++ti++ + g++ YyFe+ WMX70698.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAVKVGQAILLKFEANQTQV-EVKCIIRRDF-GKRYEFLMSR---DE-SGFFTVTIPFdeNAGLYFYYFEIL 81 7777888889***********************.**********.99********...55.789********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epasyqgnvfev 112 +g+ +k +yg +g+ geg + e ++ + ++ + WMX70698.1|CBM34|GH13_39 82 EGSdweqNKRFYGSSGIGGEGLLYTnE--NDIKPYQLT 117 77767779**********999888733..444444433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.48 // Query: UOE22966.1|CBM34|GH13_39 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-11 31.3 1.9 2.7e-11 30.3 1.9 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.3 1.9 2.7e-11 2.7e-11 6 110 .. 13 114 .. 3 123 .. 0.79 Alignments for each domain: == domain 1 score: 30.3 bits; conditional E-value: 2.7e-11 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFeledgdekvyyge 89 +spfg++++++t++ r+++ + v+ ++l++ + ++ +pMkk+ + + +++++++ + g++ YyFe++++++ yy+e UOE22966.1|CBM34|GH13_39 13 KSPFGAIKARTTVTWRVKID-EPVDYINLWLTKAE-ETPVPYPMKKTDE----QTYQVQVTIgTSGLYHYYFEIKQSNQISYYQE 91 89*****************9.799*********99.8899******444....66***********************9999998 PP CBM34.hmm 90 ngfs.gegpedlepa.syqgnvf 110 ge +++++ +yq +++ UOE22966.1|CBM34|GH13_39 92 ALGGeGELVTSNQNLaQYQLTCY 114 65542333333334446666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.46 // Query: WEV05509.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-17 49.8 0.3 2.4e-17 49.8 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.8 0.3 2.4e-17 2.4e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.8 bits; conditional E-value: 2.4e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ WEV05509.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e WEV05509.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p WEV05509.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.44 // Query: XQO16984.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.2 0.1 2.1e-14 40.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.3 0.1 2.1e-14 2.1e-14 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 40.3 bits; conditional E-value: 2.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ e g++ Y+Fe++ XQO16984.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMNLSFTTDRPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRVTIPFdeESGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XQO16984.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.62 // Query: WCK52693.1|CBM34|GH13_39 [L=669] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-19 55.4 0.0 1.2e-18 54.0 0.0 1.8 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 54.0 0.0 1.2e-18 1.2e-18 2 112 .. 9 143 .. 8 151 .. 0.91 Alignments for each domain: == domain 1 score: 54.0 bits; conditional E-value: 1.2e-18 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdel.................fdyweat 64 yH++ r+pfg v++g+++++rL + ++ v+sV +++ ++ + ++e+pM+ ++ d++ ++a+ WCK52693.1|CBM34|GH13_39 9 YHNShhslfREPFGSVPAGTQVTLRLLIFGSGVESVAILLHKDG-GHRQEIPMQLQQRDTEqlltylpeqceikeppeVFLFTAA 92 89999999*********************************999.89********9999977899************999***** PP CBM34.hmm 65 ikl.epgrlrYyFeledgdekvyygengfs.gegpedl.epasyqgnvfev 112 i++ +p +++Y F+++++++ +yyg+ + g g ++ + +yq++v++ WCK52693.1|CBM34|GH13_39 93 ITPaDPLLYWYSFKVQKEGQIYYYGNVSGKgGAGSITDaPTTDYQITVHHP 143 ***99*********************9998788888886666999999874 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (669 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.77 // Query: WNN67588.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.3 0.1 2.1e-14 40.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.3 0.1 2.1e-14 2.1e-14 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 40.3 bits; conditional E-value: 2.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ e g++ Y+Fe++ WNN67588.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMNLSFTTDRPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRVTIPFdeESGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe WNN67588.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 94.67 // Query: WVR01961.1|CBM34|GH13_39 [L=639] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-19 54.8 2.4 6.6e-19 54.8 2.4 2.2 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 54.8 2.4 6.6e-19 6.6e-19 1 119 [. 6 135 .. 6 136 .. 0.94 2 ? -1.2 0.5 0.15 0.15 80 111 .. 267 300 .. 264 310 .. 0.65 Alignments for each domain: == domain 1 score: 54.8 bits; conditional E-value: 6.6e-19 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFe 77 +yH++ r+pfg++++g+++++++ + + v V+l+y + ++ e++ +M + ++ f +e ti + ep++++YyFe WVR01961.1|CBM34|GH13_39 6 VYHNSfqldyREPFGAAPKGSNVTLTIDVHNhYPVSDVILHYIFDKTDDEQTQDMDLYADQHHFFGYETTIVMpaEPQLVWYYFE 90 69****************************9899************999**********************9999********** PP CBM34.hmm 78 ledgdekvyygengfs..gegpedl.epasyqgnvfevpyineid 119 ++ +d +++yg ++++ g+g ++ p+s q++v++ y ++ + WVR01961.1|CBM34|GH13_39 91 IKLEDGQFFYGRQEIEesGTGMVYDrIPPSWQITVYDPDYETPTW 135 ****************8888888997777*******988876666 PP == domain 2 score: -1.2 bits; conditional E-value: 0.15 CBM34.hmm 80 dgdekvyygengfsgegpedl.epa.syqgnvfe 111 +g++++y++++g ++ +++ ++ +y +++f+ WVR01961.1|CBM34|GH13_39 267 TGSNSIYFNQRGQYESLGAYQsKESpYYSWYMFH 300 5678999999999955555554444466666553 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (639 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.69 // Query: XQO19573.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.2 0.1 2.1e-14 40.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.3 0.1 2.1e-14 2.1e-14 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 40.3 bits; conditional E-value: 2.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ e g++ Y+Fe++ XQO19573.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMNLSFTTDRPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRVTIPFdeESGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XQO19573.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.02 // Query: XJU44266.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-16 44.8 0.3 1.7e-15 43.8 0.3 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.8 0.3 1.7e-15 1.7e-15 2 111 .. 3 120 .. 2 128 .. 0.85 Alignments for each domain: == domain 1 score: 43.8 bits; conditional E-value: 1.7e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+v+ g+++ +++ +++ +v +V++++ +++ ++++e+ M++ de ++++ti++ + g++ YyFe+ XJU44266.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAVKVGQAILLKFDANQTQV-EVKCIIRRDF-GKRYEFLMSR---DE-SGFFTVTIPFdeNAGLYFYYFEIL 81 7777888889***********************.**********.99********...55.789********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfe 111 +g+ +k +yg +g+ geg + e++ yq +vfe XJU44266.1|CBM34|GH13_39 82 EGSdweqNKRFYGSSGIGGEGLLYTnENDikPYQLTVFE 120 77767779**********999888854443344555544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.92 // Query: UPG98586.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ UPG98586.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe UPG98586.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.22 // Query: XTA53648.1|CBM34|GH13_39 [L=689] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-12 32.0 0.1 2.2e-11 30.6 0.1 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.6 0.1 2.2e-11 2.2e-11 6 110 .. 23 147 .. 14 156 .. 0.77 Alignments for each domain: == domain 1 score: 30.6 bits; conditional E-value: 2.2e-11 CBM34.hmm 6 rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpy.......wseeeelpMkk......egsde..lfdyweatikl..epgrl 72 + p+g+v++g++++ +++++k +++V l++ +++ + + e+ M+k ++ d+ ++ + +ti+ +p++l XTA53648.1|CBM34|GH13_39 23 KAPYGAVPCGEKITFKIKINKkAMPENVRLHILEDNkenpncpH--KVEFSMEKkgivnvKENDGenEYIEYICTINSpnTPNLL 105 789******************88899*******99999999643..699999995555543335523477799999999****** PP CBM34.hmm 73 rYyFeledgd.ekvyygengfs..gegpedl.epasyqgnvf 110 YyFel+ ++ yyg+n g g+ ++ p+ yq++ + XTA53648.1|CBM34|GH13_39 106 FYYFELKLTGgIIKYYGNNYDDlgGFGNIYDsFPKPYQITTY 147 *******77758889999877777888888844445555444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (689 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.72 // Query: WIF98083.1|CBM34|GH13_39 [L=637] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-21 62.4 2.9 3e-21 62.4 2.9 2.1 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.4 2.9 3e-21 3e-21 1 120 [] 6 136 .. 6 136 .. 0.95 2 ? -1.6 0.5 0.2 0.2 80 111 .. 267 301 .. 265 310 .. 0.58 Alignments for each domain: == domain 1 score: 62.4 bits; conditional E-value: 3e-21 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFe 77 i+H++ r+pfg++++ +++++++ + + + v++V l+y + ++ee +M ++++++ +e+ i++ ep++++Y+Fe WIF98083.1|CBM34|GH13_39 6 IFHNSfdssyRDPFGAAPKSSQVKLSIDVHHrQHVTRVHLHYIFDKTNEEHIKEMDLYTEEHQYSGYEVMITMpeEPQLVWYFFE 90 79*****************************99**************************************************** PP CBM34.hmm 78 ledgdekvyygengfs..gegpedl.epasyqgnvfevpyineidv 120 +e++d+++yyg ++ + geg+ ++ +p s q++v++ y ++ ++ WIF98083.1|CBM34|GH13_39 91 IETEDRSLYYGCKNPEesGEGKVYDvDPLSWQITVYDPAYHTPHWW 136 *************9998899999998888********999887775 PP == domain 2 score: -1.6 bits; conditional E-value: 0.2 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfe 111 +g++++y++++g + +++ e + +++++ WIF98083.1|CBM34|GH13_39 267 TGSNSIYFNQKGTYNSVGAYQskESPyFSWYTFHQ 301 56788999999999444444423333333334444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (637 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.33 // Query: UZQ86521.1|CBM34|GH13_21 [L=635] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-17 50.8 0.1 1.2e-17 50.8 0.1 1.7 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 50.8 0.1 1.2e-17 1.2e-17 14 101 .. 28 115 .. 22 131 .. 0.91 2 ? -3.5 0.4 0.78 0.78 83 111 .. 263 293 .. 259 300 .. 0.50 Alignments for each domain: == domain 1 score: 50.8 bits; conditional E-value: 1.2e-17 CBM34.hmm 14 dgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatiklepgrlrYyFeledgdekvyygengfsgegp 97 g+++ i+Lr+ k vk V lry ++ + + ++M+ +++++ f+y+ ++ik+ ++ + Y+F + +++e++yy++ g+++++p UZQ86521.1|CBM34|GH13_21 28 LGENVLIKLRVFKwAPVKAVVLRYIKNG--GDMHIKMEEIEEKGIFKYYGCEIKVSQPEIHYHFLIGTDSETYYYTQLGLTDYSP 110 5899**********************88..8**************************************************9999 PP CBM34.hmm 98 edl.e 101 +++ + UZQ86521.1|CBM34|GH13_21 111 AEEyD 115 98833 PP == domain 2 score: -3.5 bits; conditional E-value: 0.78 CBM34.hmm 83 ekvyygengfs..gegpedlepasyqgnvfe 111 + +++++g++ ++ ++++p+s++ +++ UZQ86521.1|CBM34|GH13_21 263 AHKWFNKDGEFfpKTVGAYNNPDSEEREFYY 293 5566666666655433333333344444443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (635 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 89.84 // Query: BFW28465.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-15 42.1 0.1 1.1e-14 41.2 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 41.2 0.1 1.1e-14 1.1e-14 2 114 .. 3 123 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 41.2 bits; conditional E-value: 1.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ BFW28465.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLSFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRITIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevpy 114 +++ ++ +yg +g+ geg + e++ yq +vfe BFW28465.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKED 123 766677799*********999888755544566777766554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.75 // Query: WYC90813.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-14 38.6 0.3 1.6e-13 37.5 0.3 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.5 0.3 1.6e-13 1.6e-13 2 113 .. 3 122 .. 2 129 .. 0.83 Alignments for each domain: == domain 1 score: 37.5 bits; conditional E-value: 1.6e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k e + ++a++k+ ++g+++YyFe+ + + WYC90813.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TIKFIIRRDF-GARSEFDMQK---LE-GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.9999999999.99********...23.679*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +k+yyg +g+ geg ++ e++ yq + f + WYC90813.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnENDvrPYQATIFSMR 122 4567***********99999886665556666666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.57 // Query: UTG78695.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-16 45.5 0.1 1e-15 44.6 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.6 0.1 1e-15 1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 44.6 bits; conditional E-value: 1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ UTG78695.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRVTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe UTG78695.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.82 // Query: XEQ99730.1|CBM34|GH13_39|GH77 [L=1169] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-22 66.1 0.0 2.2e-22 66.1 0.0 2.5 3 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.1 0.0 2.2e-22 2.2e-22 1 114 [. 6 134 .. 6 140 .. 0.88 2 ? -2.6 0.6 0.42 0.42 80 113 .. 273 309 .. 271 316 .. 0.56 3 ? -1.1 0.3 0.15 0.15 52 93 .. 832 876 .. 813 893 .. 0.85 Alignments for each domain: == domain 1 score: 66.1 bits; conditional E-value: 2.2e-22 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkdd......vksVtlrygdpywseeeelpMkkegsdelfdyweatikl.. 67 i+H++ rspfg+v++++++++rL ++ + v+ V lr +++ +e+ ++M+ ++ ++ ++a i XEQ99730.1|CBM34|GH13_39|GH77 6 ILHDShnndfRSPFGAVSCNTEVTLRLLIATPQhyrvppVEAVVLRQWQDG-FGETLTDMRLVQDQGGQHLYQAVIATpk 84 5788888899*****************888755578888***********9.56**********************999* PP CBM34.hmm 68 epgrlrYyFeledgdekvyygengfs..gegpedl.epasyqgnvfevpy 114 epg ++YyF++++g++++yyg+n ++ g+g+ + p+syq++ ++ XEQ99730.1|CBM34|GH13_39|GH77 85 EPGVIWYYFIVKQGGQTYYYGNNAEEtgGVGRILDdPPPSYQISTYRQGA 134 **************************988888888666699999887655 PP == domain 2 score: -2.6 bits; conditional E-value: 0.42 CBM34.hmm 80 dgdekvyygengfsgegpedl.epa..syqgnvfevp 113 +g++++y++++g ++ +++ ++ + +++ e+p XEQ99730.1|CBM34|GH13_39|GH77 273 TGSDSIYFNQDGTYDSIGAYQsKDSpyYSWYKFTEYP 309 6778999999999955555443333223333444444 PP == domain 3 score: -1.1 bits; conditional E-value: 0.15 CBM34.hmm 52 egsdelfdyweatikl...epgrlrYyFeledgdekvyygengfs 93 ++++e+ dy++ +++ ++ l+ +F ++++ kvy +++g++ XEQ99730.1|CBM34|GH13_39|GH77 832 TREHEALDYYRQALDEeieYQTFLQFVFWQQWQELKVYANNRGVR 876 677888999999999999888889999999999999999999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1169 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 138.57 // Query: XIH88893.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-15 43.3 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XIH88893.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XIH88893.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 108.03 // Query: UUY26342.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ UUY26342.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe UUY26342.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 106.44 // Query: XOW22437.1|CBM34|GH13_39 [L=480] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-15 44.0 0.1 2.9e-15 43.1 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.1 0.1 2.9e-15 2.9e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 43.1 bits; conditional E-value: 2.9e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg ++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ XOW22437.1|CBM34|GH13_39 3 YYNPwnldyKQPFGTIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRVTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XOW22437.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (480 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.56 // Query: UBK68924.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-17 49.9 0.2 2.3e-17 49.9 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.9 0.2 2.3e-17 2.3e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.9 bits; conditional E-value: 2.3e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK68924.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK68924.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK68924.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.27 // Query: WVU11515.1|CBM34|GH13_39|GH77 [L=1175] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-23 68.5 0.1 1.3e-22 66.8 0.1 1.9 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.8 0.1 1.3e-22 1.3e-22 3 111 .. 9 148 .. 7 156 .. 0.90 Alignments for each domain: == domain 1 score: 66.8 bits; conditional E-value: 1.3e-22 CBM34.hmm 3 Hrp.....rspfgyvydgdtlhirL..rtkk.ddvksVtlrygdpywseeeelpMkkegsdel................. 57 H++ r+pfg+v+ ++++ +rL rt++ +++ +V + d++ +++ +pM+++g +e WVU11515.1|CBM34|GH13_39|GH77 9 HDShnplyRKPFGAVSINKEILLRLyiRTTNpKEL-QVLANCIDDQ-GNKVAYPMYQTGISENdcdqidydngngsiyke 86 555555*******************8877775666.**********.99********99988667899999999999999 PP CBM34.hmm 58 ...fdyweatikl..epgrlrYyFeledgdekvyygengfs..gegpedl.epasyqgnvfe 111 ++++ea+ik +pg+++Y+F ++++++kvy+g+n++ g+g+e++ ep +yq++v+e WVU11515.1|CBM34|GH13_39|GH77 87 eltGYFYEASIKSpdTPGLFWYTFTVVSNETKVYFGNNQELsgGPGQESHqEPLGYQVTVHE 148 999*************************************99999999997777****9986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1175 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 138.74 // Query: ULQ48729.1|CBM34|GH13_39 [L=613] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-13 38.0 0.2 2.6e-13 36.8 0.2 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.8 0.2 2.6e-13 2.6e-13 6 119 .. 14 133 .. 4 134 .. 0.83 Alignments for each domain: == domain 1 score: 36.8 bits; conditional E-value: 2.6e-13 CBM34.hmm 6 rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFele..dgd...e 83 ++pfg+v++++ ++i Lr+ + + sV+l++ ++ + ++e++p++ ++ ++at+++ + g+++YyF+++ d ULQ48729.1|CBM34|GH13_39 14 KKPFGAVQAKQPVTINLRLVIeQPLLSVELMVHPDRQMTSENYPLHLVAA----GIYQATFTPtKAGLYYYYFKIViqH-DdqqA 93 89****************99978899**********9999*******665....57******************98531.24345 PP CBM34.hmm 84 kvyyg..engfsgegpedl.epa.syqgnvfevpyineid 119 +++yg ++gf g+g+ + ++ syq ++++ p +++++ ULQ48729.1|CBM34|GH13_39 94 VYFYGaaDDGFGGPGRLTTiDNLkSYQLTCYQKPAVSPEW 133 556653368888******999999********99988766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (613 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.26 // Query: WFE17776.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-17 49.8 0.3 2.4e-17 49.8 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.8 0.3 2.4e-17 2.4e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.8 bits; conditional E-value: 2.4e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ WFE17776.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e WFE17776.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p WFE17776.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.03 // Query: WEV13238.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-17 48.2 0.3 7.7e-17 48.2 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 48.2 0.3 7.7e-17 7.7e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 48.2 bits; conditional E-value: 7.7e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL ++ ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ WEV13238.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSIGSKVSLRLECE--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89***************************9..68889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e WEV13238.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p WEV13238.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.78 // Query: UBS48172.1|CBM34|GH13_39|GH77 [L=1139] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-16 45.5 0.0 2.1e-15 43.5 0.0 2.1 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.5 0.0 2.1e-15 2.1e-15 1 115 [. 2 124 .. 2 129 .. 0.88 Alignments for each domain: == domain 1 score: 43.5 bits; conditional E-value: 2.1e-15 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrl 72 i+H++ rsp g+v++++ +++ + + d+v V l++++++ ++ + +kk de +++++ +++ + ++ UBS48172.1|CBM34|GH13_39|GH77 2 IFHDSrnlyyRSPIGAVPTQSFVRLAIDVDLkDKVSLVRLHTWQET-CGSIYYNLKKSSWDE--KHYFIDLDMpeDGCLV 78 79*************************9998799***********9.67999*****77777..8999999998566689 PP CBM34.hmm 73 rYyFeledgd.ekvyygengfs..gegpedl.epasyqgnvfevpyi 115 +YyF++e d + +yyg+n+++ g g+e l p+syq++vf+ + UBS48172.1|CBM34|GH13_39|GH77 79 WYYFIIELADgKLLYYGNNKAQmgGIGQEALeVPPSYQITVFKKD-V 124 *******7777************9*******7777*******854.4 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1139 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 144.60 // Query: UPS11423.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.2 0.1 2.1e-14 40.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.3 0.1 2.1e-14 2.1e-14 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 40.3 bits; conditional E-value: 2.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ e g++ Y+Fe++ UPS11423.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMNLSFTTDRPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRVTIPFdeESGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe UPS11423.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.89 // Query: UBK53014.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-17 49.9 0.2 2.3e-17 49.9 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.9 0.2 2.3e-17 2.3e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.9 bits; conditional E-value: 2.3e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK53014.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK53014.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK53014.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.67 // Query: UBK91828.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-17 49.9 0.2 2.3e-17 49.9 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.9 0.2 2.3e-17 2.3e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.9 bits; conditional E-value: 2.3e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK91828.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK91828.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK91828.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.54 // Query: XBO34812.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-16 44.8 0.3 1.7e-15 43.8 0.3 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.8 0.3 1.7e-15 1.7e-15 2 111 .. 3 120 .. 2 128 .. 0.85 Alignments for each domain: == domain 1 score: 43.8 bits; conditional E-value: 1.7e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+v+ g+++ +++ +++ +v +V++++ +++ ++++e+ M++ de ++++ti++ + g++ YyFe+ XBO34812.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAVKVGQAILLKFDANQTQV-EVKCIIRRDF-GKRYEFLMSR---DE-SGFFTVTIPFdeNAGLYFYYFEIL 81 7777888889***********************.**********.99********...55.789********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfe 111 +g+ +k +yg +g+ geg + e++ yq +vfe XBO34812.1|CBM34|GH13_39 82 EGSdweqNKRFYGSSGIGGEGLLYTnENDikPYQLTVFE 120 77767779**********999888854443344555544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.93 // Query: WRY46298.1|CBM34|GH13_39 [L=641] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-14 39.2 0.2 4.7e-14 39.2 0.2 2.2 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.2 0.2 4.7e-14 4.7e-14 2 114 .. 2 117 .. 1 123 [. 0.83 2 ? -0.9 0.3 0.12 0.12 80 108 .. 262 292 .. 259 303 .. 0.71 Alignments for each domain: == domain 1 score: 39.2 bits; conditional E-value: 4.7e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 H++ r+p g+v +g+++++rL + + V+l++ ++ +++ M+ ++e+ i++ + +l+YyF+++ WRY46298.1|CBM34|GH13_39 2 IHNAsieqyREPVGAVTKGEEVKLRLFALEGTAVTVELVLYSED--YHKTFSMRE-----KKGFYECIIEMpeKACILWYYFRIT 79 57777788899*******************99999999887777..589****99.....457********8778899******* PP CBM34.hmm 80 dgdekvyygengfs..gegpedlepa.syqgnvfevpy 114 +g+ ++yyg++ + geg +e+ + q++v+e + WRY46298.1|CBM34|GH13_39 80 EGNYTYYYGARPGRtcGEGIRVEEDVrGFQITVYERGF 117 **********9988665655555444599999998766 PP == domain 2 score: -0.9 bits; conditional E-value: 0.12 CBM34.hmm 80 dgdekvyygengfsgegpedl.epa.syqgn 108 +g +++y+++ng ++ +++ ++ +y ++ WRY46298.1|CBM34|GH13_39 262 TGADSLYFNKNGNYKSVGAYQsQDSpYYDWY 292 4558899999999977777775555455444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (641 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.45 // Query: BDS15836.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-17 49.8 0.3 2.4e-17 49.8 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.8 0.3 2.4e-17 2.4e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.8 bits; conditional E-value: 2.4e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ BDS15836.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e BDS15836.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p BDS15836.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.82 // Query: BDE09018.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-16 44.8 0.3 1.7e-15 43.8 0.3 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.8 0.3 1.7e-15 1.7e-15 2 111 .. 3 120 .. 2 128 .. 0.85 Alignments for each domain: == domain 1 score: 43.8 bits; conditional E-value: 1.7e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+v+ g+++ +++ +++ +v +V++++ +++ ++++e+ M++ de ++++ti++ + g++ YyFe+ BDE09018.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAVKVGQAILLKFDANQTQV-EVKCIIRRDF-GKRYEFLMSR---DE-SGFFTVTIPFdeNAGLYFYYFEIL 81 7777888889***********************.**********.99********...55.789********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfe 111 +g+ +k +yg +g+ geg + e++ yq +vfe BDE09018.1|CBM34|GH13_39 82 EGSdweqNKRFYGSSGIGGEGLLYTnENDikPYQLTVFE 120 77767779**********999888854443344555544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 93.63 // Query: UNO29601.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-15 43.3 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ UNO29601.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe UNO29601.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.70 // Query: XJU43152.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-15 43.3 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XJU43152.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XJU43152.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.29 // Query: XOW25697.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XOW25697.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XOW25697.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.76 // Query: WYJ76948.1|CBM34|GH13_39 [L=623] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-14 39.0 2.3 1.5e-13 37.6 2.3 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.6 2.3 1.5e-13 1.5e-13 2 115 .. 12 123 .. 6 130 .. 0.89 Alignments for each domain: == domain 1 score: 37.6 bits; conditional E-value: 1.5e-13 CBM34.hmm 2 yHrprspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatiklepgrlrYyFeledgd.ekv 85 yH+ pfg+v+++ +++++ + +d+ +V+l++ +++ + e+++ M+k ++e f+ +e ++ ++g++ Y+Fe++++ ++v WYJ76948.1|CBM34|GH13_39 12 YHKH--PFGAVKENGLVRLSIEVIAEDILQVYLVMHKDH-QPEQRIFMEK--QEEGFYSYEYFFNQGKGLYFYHFEVHTKVnDQV 91 5665..********************************9.78********..55569999999999************9998999 PP CBM34.hmm 86 yygengfsgegpedl.epa.syqgnvfevpyi 115 + + g+s++g e++ +++ + + +++++y WYJ76948.1|CBM34|GH13_39 92 FVEYYGASEQGGEGRlYDEpATIWDFQITCYK 123 99999999888888888887888888888875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (623 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.28 // Query: WKB48279.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.2 0.1 2.1e-14 40.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.3 0.1 2.1e-14 2.1e-14 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 40.3 bits; conditional E-value: 2.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ e g++ Y+Fe++ WKB48279.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMNLSFTTDRPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRVTIPFdeESGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe WKB48279.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.11 // Query: UXV71462.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ UXV71462.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe UXV71462.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.35 // Query: WQH36643.1|CBM34|GH13_39 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-11 31.0 1.8 3.8e-11 29.8 1.8 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.8 1.8 3.8e-11 3.8e-11 6 110 .. 13 114 .. 3 123 .. 0.79 Alignments for each domain: == domain 1 score: 29.8 bits; conditional E-value: 3.8e-11 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFeledgdekvyyge 89 +spfg++++++t++ r+++ + v+ ++l++ + ++ +pMkk+ + + + +++++ + g++ YyFe++++++ yy+e WQH36643.1|CBM34|GH13_39 13 KSPFGAIKARTTVTWRVKID-EPVDYINLWLTKAE-ETPVLYPMKKTDE----QTYHVQVTIgTSGLYHYYFEIKQSNQISYYQE 91 89*****************9.799*********99.889*******444....66***********************9999998 PP CBM34.hmm 90 ngfs.gegpedlepa.syqgnvf 110 ge +++++ +yq +++ WQH36643.1|CBM34|GH13_39 92 ALGGeGELVTSNQNLaQYQLTCY 114 65542333333334446666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 103.51 // Query: WMM22740.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-15 44.3 0.1 2.6e-15 43.2 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.2 0.1 2.6e-15 2.6e-15 2 111 .. 3 120 .. 2 128 .. 0.84 Alignments for each domain: == domain 1 score: 43.2 bits; conditional E-value: 2.6e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ WMM22740.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRITIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfe 111 +++ ++ +yg +g+ geg + e++ yq +vfe WMM22740.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFE 120 766677799*********999888744443345555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 105.56 // Query: UBK58353.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-17 49.2 0.2 3.7e-17 49.2 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.2 0.2 3.7e-17 3.7e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -2.0 1.4 0.27 0.27 80 113 .. 263 299 .. 260 306 .. 0.56 Alignments for each domain: == domain 1 score: 49.2 bits; conditional E-value: 3.7e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++ +pM+ e+ +++ ++ i+ g ++YyF+ UBK58353.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYLIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK58353.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -2.0 bits; conditional E-value: 0.27 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevp 113 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK58353.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYNWYRFYDYP 299 5667788888888855555542223334444555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.11 // Query: WJE15644.1|CBM34|GH13_39 [L=639] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-19 54.6 0.8 7.6e-19 54.6 0.8 1.9 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 54.6 0.8 7.6e-19 7.6e-19 1 120 [] 6 136 .. 6 136 .. 0.93 2 ? -3.3 0.4 0.66 0.66 81 110 .. 268 300 .. 266 310 .. 0.48 Alignments for each domain: == domain 1 score: 54.6 bits; conditional E-value: 7.6e-19 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFe 77 +yH++ r+pfg+++ g+++++ + + + +V+l+y + ++ e + +M + ++ +e+ti++ ep++++Y+Fe WJE15644.1|CBM34|GH13_39 6 MYHNSfeasyREPFGAAPRGSAVTLAIDVHArYQASQVILHYILDRTDDEHTKKMDVRSEGHQQASYEVTIEMpeEPQLIWYFFE 90 59*************************9998899************999********999999********************** PP CBM34.hmm 78 ledgdekvyygengfs..gegpedl.epasyqgnvfevpyineidv 120 ++ d+++yyg ++ geg+ ++ p+s q++v++ y +++++ WJE15644.1|CBM34|GH13_39 91 VVLADQTLYYGRERSNesGEGKIYEhIPPSWQITVYDPAYRTPKWW 136 ***********988776688888886666********999888876 PP == domain 2 score: -3.3 bits; conditional E-value: 0.66 CBM34.hmm 81 gdekvyygengfsgegpedl.epa..syqgnvf 110 g++++y++ +g ++ +++ ++ + ++++ WJE15644.1|CBM34|GH13_39 268 GSNSIYFNREGKYDSLGAYQsKDSpyYSWYTFH 300 556677777777733333332222212233333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (639 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.60 // Query: UXV65186.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-16 44.8 0.3 1.7e-15 43.8 0.3 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.8 0.3 1.7e-15 1.7e-15 2 111 .. 3 120 .. 2 128 .. 0.85 Alignments for each domain: == domain 1 score: 43.8 bits; conditional E-value: 1.7e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+v+ g+++ +++ +++ +v +V++++ +++ ++++e+ M++ de ++++ti++ + g++ YyFe+ UXV65186.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAVKVGQAILLKFDANQTQV-EVKCIIRRDF-GKRYEFLMSR---DE-SGFFTVTIPFdeNAGLYFYYFEIL 81 7777888889***********************.**********.99********...55.789********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfe 111 +g+ +k +yg +g+ geg + e++ yq +vfe UXV65186.1|CBM34|GH13_39 82 EGSdweqNKRFYGSSGIGGEGLLYTnENDikPYQLTVFE 120 77767779**********999888854443344555544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.45 // Query: XJC34780.1|CBM34|GH13_39|GH77 [L=1129] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-19 54.6 0.0 1.9e-18 53.3 0.0 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.3 0.0 1.9e-18 1.9e-18 2 119 .. 6 128 .. 5 129 .. 0.83 Alignments for each domain: == domain 1 score: 53.3 bits; conditional E-value: 1.9e-18 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvk..sVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrl 72 yH++ rs+fg+v++g++l++rL + + ++t+r+++ + +e +pM+ ++d + at ++ + +l XJC34780.1|CBM34|GH13_39|GH77 6 YHDShdshyRSRFGAVPSGSELTLRLSVSGRPASscKATVRLWQSN-AGESLVPMTA-----AGDTFAATWQVpqKGCLL 79 7888888*******************9999665534899*******.77*******9.....445566666664355789 PP CBM34.hmm 73 rYyFeledgdekvyygengfs..gegpedl.epasyqgnvfevpyineid 119 +YyF++e++++++yyg+n+ + g+g ++ p+ q++v++ + +++d XJC34780.1|CBM34|GH13_39|GH77 80 WYYFIVEWDGKRLYYGNNQDHlgGVGALYDtVPPAFQITVYDKN-AHTPD 128 *******************9999*******888899****9965.45555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1129 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 144.22 // Query: UOR10862.1|CBM34|GH13_39 [L=637] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-22 64.1 0.2 2.4e-21 62.7 0.2 1.8 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.7 0.2 2.4e-21 2.4e-21 1 120 [] 6 136 .. 6 136 .. 0.95 Alignments for each domain: == domain 1 score: 62.7 bits; conditional E-value: 2.4e-21 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFe 77 iyH++ r+pfg+v++g+++++++ + + + + +V+l++ ++ ++ee++++M ++ + + +ea++ + ep++++Y+Fe UOR10862.1|CBM34|GH13_39 6 IYHNSfalqyREPFGAVPKGSSVTLTIDIDQrHPLLHVILHCIHDKTNEEQTIEMDQVSGRNSYCTFEANLIMpeEPQLVWYFFE 90 89****************************9999************************************99999********** PP CBM34.hmm 78 ledgdekvyygengfs..gegpedl.epasyqgnvfevpyineidv 120 ++ +d+ +yyg + + geg+ ++ +p+s q++v++ y+++ ++ UOR10862.1|CBM34|GH13_39 91 IQLEDKMMYYGRLNSEesGEGEVYEeHPPSWQITVYDPSYQTPAWW 136 ***********887776699999997777***********999886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (637 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 111.86 // Query: XJU61393.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XJU61393.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XJU61393.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.48 // Query: UBL00890.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-17 49.9 0.2 2.3e-17 49.9 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.9 0.2 2.3e-17 2.3e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.9 bits; conditional E-value: 2.3e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBL00890.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBL00890.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBL00890.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 91.17 // Query: UOB68674.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ UOB68674.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe UOB68674.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.42 // Query: WMM07677.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.2 0.1 2.1e-14 40.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.3 0.1 2.1e-14 2.1e-14 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 40.3 bits; conditional E-value: 2.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ e g++ Y+Fe++ WMM07677.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMNLSFTTDRPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRVTIPFdeESGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe WMM07677.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.86 // Query: UZQ49050.1|CBM34|GH13_39 [L=596] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (596 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 488.56 // Query: WZL19261.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-14 38.5 0.2 1.7e-13 37.4 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.4 0.2 1.7e-13 1.7e-13 2 113 .. 3 122 .. 2 129 .. 0.83 Alignments for each domain: == domain 1 score: 37.4 bits; conditional E-value: 1.7e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k g + ++a++k+ ++g+++YyFe+ + + WZL19261.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TIKFIIRRDF-GARSEFDMQKLG----GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.9999999999.99********43....678*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +k+yyg +g+ geg ++ e++ yq + f + WZL19261.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnENDvhPYQATIFSMR 122 4567***********99999986555445666666554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.82 // Query: UOQ95418.1|CBM34|GH13_39 [L=637] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-23 68.4 0.2 1.1e-22 67.1 0.2 1.8 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.1 0.2 1.1e-22 1.1e-22 1 120 [] 6 136 .. 6 136 .. 0.95 Alignments for each domain: == domain 1 score: 67.1 bits; conditional E-value: 1.1e-22 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFe 77 iyH++ r+pfg++++g+++++++ + + + + +V+l++ ++ ++ee++++M ++ +++ ++ +eat+ + ep++++Y+Fe UOQ95418.1|CBM34|GH13_39 6 IYHNSfalqyREPFGAAPKGSSVTLTIDIDQrHPLLHVILHCIHDKTNEEQTIEMDQVSEKNSCYTFEATLIMpeEPQLVWYFFE 90 89****************************9999*************************************9999********** PP CBM34.hmm 78 ledgdekvyygengfs..gegpedl.epasyqgnvfevpyineidv 120 ++ +d+ yyg + + geg+ ++ p+s q++v++ +y+++ ++ UOQ95418.1|CBM34|GH13_39 91 IQLEDKIRYYGRLNSEesGEGEVYEkRPPSWQITVYDPCYQTPAWW 136 ***********887776688999997777************99886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (637 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.97 // Query: BDF61303.1|CBM34|GH13_39 [L=669] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-15 43.0 0.5 8.5e-15 41.6 0.0 2.0 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 41.6 0.0 8.5e-15 8.5e-15 2 118 .. 11 131 .. 10 133 .. 0.90 2 ? -2.3 0.5 0.34 0.34 80 106 .. 272 300 .. 268 320 .. 0.54 Alignments for each domain: == domain 1 score: 41.6 bits; conditional E-value: 8.5e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 H++ rsp g++++++t+++ L +k ++ V+l++ + + +++++M+ + +w a +++ epg l+Y F ++ BDF61303.1|CBM34|GH13_39 11 IHDSaqerfRSPTGALPCNTTVRLALALKDVYLQTVYLVVINGQ--DTQTIEMRL-----QEGVWAADYTVpsEPGVLWYWFCIK 88 688889999*********************************99..79*******.....3469999999888************ PP CBM34.hmm 80 dgd.ekvyygengfs..gegpedl.epasyqgnvfevpyinei 118 gd k+yyg++ + g+g ++ ep+ q +v++ + +++ BDF61303.1|CBM34|GH13_39 89 LGDgAKIYYGARSGQtcGVGMTYWnEPPAFQLTVHDEAFTTPN 131 9999********9999999999998888999999987777665 PP == domain 2 score: -2.3 bits; conditional E-value: 0.34 CBM34.hmm 80 dgdekvyygengfsgegpedl.epa.syq 106 +gd+++y+++ g ++ +++ ++ y BDF61303.1|CBM34|GH13_39 272 TGDDSIYFNKYGSYDSLGAYQsQESpFYH 300 56677777777777444444422222222 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (669 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.81 // Query: XRP88808.1|CBM34|GH13_39|GH77 [L=1206] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-22 66.9 3.1 1.5e-22 66.6 0.0 2.5 3 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.6 0.0 1.5e-22 1.5e-22 3 113 .. 7 162 .. 5 167 .. 0.91 2 ? -3.3 0.1 0.67 0.67 80 110 .. 301 333 .. 300 344 .. 0.65 3 ? -0.5 0.1 0.094 0.094 70 93 .. 905 928 .. 878 948 .. 0.80 Alignments for each domain: == domain 1 score: 66.6 bits; conditional E-value: 1.5e-22 CBM34.hmm 3 Hrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdel................... 57 H++ r+pfg+v +g++++irL++ v++++lr+++++ ++e +pM+ ++++ XRP88808.1|CBM34|GH13_39|GH77 7 HHSqkrvyRDPFGAVVCGQNVVIRLQISSeVPVEQCFLRLWQTDSEQEVLIPMHVLEKKDVknitdnyepiqgcvhldkh 86 555588889********************899************999********7776655777888999999999999 PP CBM34.hmm 58 ...............fdyweatikl..epgrlrYyFeledgdekvyygengfs..gegpedl.epasyqgnvfevp 113 ++++e+++k pg+++YyF+l+ +++++yyg+n+++ g g+ ++ +p+s q++v++ XRP88808.1|CBM34|GH13_39|GH77 87 vktsfltqcscleldHTWFECEVKGpsLPGLVWYYFILKINGQTLYYGNNEERlgGAGQLSDtQPPSWQITVYNRM 162 999999999999************9999**********************************9999*******865 PP == domain 2 score: -3.3 bits; conditional E-value: 0.67 CBM34.hmm 80 dgdekvyygengfs.gegpedl.epasyqgnvf 110 +g++++y+++ng + + g ++ e ++y ++ f XRP88808.1|CBM34|GH13_39|GH77 301 TGSDSLYFNKNGNYpSIGAFQSpESPYYDWYTF 333 567888888888885555555544445555555 PP == domain 3 score: -0.5 bits; conditional E-value: 0.094 CBM34.hmm 70 grlrYyFeledgdekvyygengfs 93 + ++Y+F +++++ k+y + n+++ XRP88808.1|CBM34|GH13_39|GH77 905 QFVQYTFYFQWQELKAYASLNNIQ 928 5689*********99998877777 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1206 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 125.55 // Query: WDA68142.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-16 45.5 0.1 1e-15 44.6 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.6 0.1 1e-15 1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 44.6 bits; conditional E-value: 1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ WDA68142.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRVTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe WDA68142.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 98.43 // Query: UZP06634.1|CBM34|GH13_39 [L=604] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-18 53.7 0.1 1.5e-18 53.7 0.1 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.7 0.1 1.5e-18 1.5e-18 6 111 .. 16 123 .. 6 130 .. 0.90 2 ? -1.4 2.0 0.18 0.18 81 119 .. 264 305 .. 260 306 .. 0.60 Alignments for each domain: == domain 1 score: 53.7 bits; conditional E-value: 1.5e-18 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgdekvyyg 88 ++pfg+v+ g+ +++++ ++kd + V l + d + +e+ l+Mkke+ ++ ++ ++++i+ + g+lrYyF+l dg +++yyg UZP06634.1|CBM34|GH13_39 16 KKPFGAVEIGQVIKLSIIVNKDLL--VALELTDFN-NESSLLEMKKEYLSDGNYKYSVEIDTsnKSGLLRYYFILIDGYKRIYYG 97 89******************9998..*******99.89***********999********************************* PP CBM34.hmm 89 engfs..gegpedl.epasyqgnvfe 111 +n+++ geg+ ++ +p y+++v+e UZP06634.1|CBM34|GH13_39 98 NNDEKlgGEGQVYNnDPVPYEITVYE 123 *****999999999555588888876 PP == domain 2 score: -1.4 bits; conditional E-value: 0.18 CBM34.hmm 81 gdekvyygengfsgegpedl..epa.syqgnvfevpyineid 119 g+++ y+++ g ++e +++ + + ++ +++ ++py+ +++ UZP06634.1|CBM34|GH13_39 264 GSDSRYFNKYGNYDEVGAYQspNSKyYNWYKFITYPYQYQSW 305 568899999999966665553334433344555667766555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (604 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.89 // Query: WPK09665.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.3 0.1 2.1e-14 40.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.3 0.1 2.1e-14 2.1e-14 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 40.3 bits; conditional E-value: 2.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ e g++ Y+Fe++ WPK09665.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMNLSFTTDRPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRVTIPFdeESGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe WPK09665.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 93.58 // Query: XCI36049.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.3 0.1 2.1e-14 40.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.3 0.1 2.1e-14 2.1e-14 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 40.3 bits; conditional E-value: 2.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ e g++ Y+Fe++ XCI36049.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMNLSFTTDRPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRVTIPFdeESGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XCI36049.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.59 // Query: UBS54009.1|CBM34|GH13_39|GH77 [L=1136] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-19 55.9 0.0 1.1e-17 50.9 0.0 2.5 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 50.9 0.0 1.1e-17 1.1e-17 2 119 .. 13 134 .. 12 135 .. 0.89 2 ? 2.1 0.0 0.015 0.015 68 93 .. 825 850 .. 801 865 .. 0.82 Alignments for each domain: == domain 1 score: 50.9 bits; conditional E-value: 1.1e-17 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlr 73 yH++ rs fg+v++g++l +rL + + ++ ++++r+++ + +e l M+ + ++a +++ + +l+ UBS54009.1|CBM34|GH13_39|GH77 13 YHNShdfyyRSAFGAVPSGSRLILRLGASGqGENCRAEVRLWQSN-VGESHLSMTY-----EDRAFKAVVPIpdKGCLLW 86 9999999*******************999989999**********.67******99.....3569*******8666689* PP CBM34.hmm 74 YyFeledgdekvyygengfs..gegpedl.epasyqgnvfevpyineid 119 YyF++ dgd+++yyg+n ++ geg ++ p+ yq++v++ +++d UBS54009.1|CBM34|GH13_39|GH77 87 YYFIVSDGDTTCYYGNNYEQlgGEGAVYEaAPPAYQITVYDKE-AHTPD 134 ********************9999999998888*******954.45555 PP == domain 2 score: 2.1 bits; conditional E-value: 0.015 CBM34.hmm 68 epgrlrYyFeledgdekvyygengfs 93 + + ++Y Fe ++++ ++y +eng++ UBS54009.1|CBM34|GH13_39|GH77 825 HVKFMQYIFERQWHELRAYAKENGVT 850 66789*******************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1136 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 133.80 // Query: XTR85336.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-15 43.5 0.1 4.3e-15 42.5 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.5 0.1 4.3e-15 4.3e-15 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 42.5 bits; conditional E-value: 4.3e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XTR85336.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XTR85336.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.79 // Query: WVP48485.1|CBM34|GH13_39 [L=641] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-14 39.2 0.2 4.7e-14 39.2 0.2 2.2 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.2 0.2 4.7e-14 4.7e-14 2 114 .. 2 117 .. 1 123 [. 0.83 2 ? -0.9 0.3 0.12 0.12 80 108 .. 262 292 .. 259 303 .. 0.71 Alignments for each domain: == domain 1 score: 39.2 bits; conditional E-value: 4.7e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 H++ r+p g+v +g+++++rL + + V+l++ ++ +++ M+ ++e+ i++ + +l+YyF+++ WVP48485.1|CBM34|GH13_39 2 IHNAsieqyREPVGAVTKGEEVKLRLFALEGTAVTVELVLYSED--YHKTFSMRE-----KKGFYECIIEMpeKACILWYYFRIT 79 57777788899*******************99999999887777..589****99.....457********8778899******* PP CBM34.hmm 80 dgdekvyygengfs..gegpedlepa.syqgnvfevpy 114 +g+ ++yyg++ + geg +e+ + q++v+e + WVP48485.1|CBM34|GH13_39 80 EGNYTYYYGARPGRtcGEGIRVEEDVrGFQITVYERGF 117 **********9988665655555444599999998766 PP == domain 2 score: -0.9 bits; conditional E-value: 0.12 CBM34.hmm 80 dgdekvyygengfsgegpedl.epa.syqgn 108 +g +++y+++ng ++ +++ ++ +y ++ WVP48485.1|CBM34|GH13_39 262 TGADSLYFNKNGNYKSVGAYQsQDSpYYDWY 292 4558899999999977777775555455444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (641 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.63 // Query: XIH91464.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-15 41.6 0.1 1.6e-14 40.6 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.6 0.1 1.6e-14 1.6e-14 2 114 .. 3 123 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 40.6 bits; conditional E-value: 1.6e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ XIH91464.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLSFTTDQPSV-LVTCVIRRDF-GKRYEFSMSK---DS-GGDFRITIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevpy 114 +++ ++ +yg +g+ geg + e++ yq +vfe XIH91464.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKED 123 766677799*********999888755544566777766554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.95 // Query: UBK55787.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-17 49.2 0.2 3.7e-17 49.2 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.2 0.2 3.7e-17 3.7e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -2.0 1.4 0.27 0.27 80 113 .. 263 299 .. 260 306 .. 0.56 Alignments for each domain: == domain 1 score: 49.2 bits; conditional E-value: 3.7e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++ +pM+ e+ +++ ++ i+ g ++YyF+ UBK55787.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYLIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK55787.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -2.0 bits; conditional E-value: 0.27 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevp 113 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK55787.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYNWYRFYDYP 299 5667788888888855555542223334444555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.54 // Query: UWN70369.1|CBM34|GH13_39 [L=641] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-14 39.2 0.2 4.7e-14 39.2 0.2 2.2 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.2 0.2 4.7e-14 4.7e-14 2 114 .. 2 117 .. 1 123 [. 0.83 2 ? -0.9 0.3 0.12 0.12 80 108 .. 262 292 .. 259 303 .. 0.71 Alignments for each domain: == domain 1 score: 39.2 bits; conditional E-value: 4.7e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 H++ r+p g+v +g+++++rL + + V+l++ ++ +++ M+ ++e+ i++ + +l+YyF+++ UWN70369.1|CBM34|GH13_39 2 IHNAsieqyREPVGAVTKGEEVKLRLFALEGTAVTVELVLYSED--YHKTFSMRE-----KKGFYECIIEMpeKACILWYYFRIT 79 57777788899*******************99999999887777..589****99.....457********8778899******* PP CBM34.hmm 80 dgdekvyygengfs..gegpedlepa.syqgnvfevpy 114 +g+ ++yyg++ + geg +e+ + q++v+e + UWN70369.1|CBM34|GH13_39 80 EGNYTYYYGARPGRtcGEGIRVEEDVrGFQITVYERGF 117 **********9988665655555444599999998766 PP == domain 2 score: -0.9 bits; conditional E-value: 0.12 CBM34.hmm 80 dgdekvyygengfsgegpedl.epa.syqgn 108 +g +++y+++ng ++ +++ ++ +y ++ UWN70369.1|CBM34|GH13_39 262 TGADSLYFNKNGNYKSVGAYQsQDSpYYDWY 292 4558899999999977777775555455444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (641 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.90 // Query: WFB44924.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-17 49.2 0.2 3.7e-17 49.2 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.2 0.2 3.7e-17 3.7e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -2.0 1.4 0.27 0.27 80 113 .. 263 299 .. 260 306 .. 0.56 Alignments for each domain: == domain 1 score: 49.2 bits; conditional E-value: 3.7e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++ +pM+ e+ +++ ++ i+ g ++YyF+ WFB44924.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYLIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e WFB44924.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -2.0 bits; conditional E-value: 0.27 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevp 113 +g+++ y+++ g +ge +++ + + ++ ++++++p WFB44924.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYNWYRFYDYP 299 5667788888888855555542223334444555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.32 // Query: WDC82265.1|CBM34|GH13_39 [L=567] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-10 26.5 0.6 4.1e-10 26.5 0.6 2.1 3 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.5 0.6 4.1e-10 4.1e-10 6 113 .. 14 122 .. 4 128 .. 0.84 2 ? -3.2 0.0 0.64 0.64 43 62 .. 163 182 .. 155 183 .. 0.81 3 ? -2.1 0.1 0.28 0.28 83 119 .. 264 299 .. 260 300 .. 0.62 Alignments for each domain: == domain 1 score: 26.5 bits; conditional E-value: 4.1e-10 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFele..dgd.ekvy 86 ++pfg++++g++ + + vksV+l + ++ e++p + +d+ + +t+++ g+l YyF+l+ +++ e+ y WDC82265.1|CBM34|GH13_39 14 KRPFGAIKAGQAAEFMIEVYDAYVKSVELEIYRDG----ESTPCILQMEDQHDGRYCCTYTAeSAGLLFYYFKLVlyENNsEQTY 94 78*******************************99....5666666667777789******************98654446**** PP CBM34.hmm 87 ygengfsgegpedl.epasyqgnvfevp 113 y g+ +++e++ +++syq +v++ WDC82265.1|CBM34|GH13_39 95 YYCLGLGVTQNEGElSEHSYQLTVYDRE 122 *******88888888889******9854 PP == domain 2 score: -3.2 bits; conditional E-value: 0.64 CBM34.hmm 43 eeeelpMkkegsdelfdywe 62 + +lpM+ +d+ d w WDC82265.1|CBM34|GH13_39 163 TDSDLPMYIRNKDGGIDRWD 182 45689999999999999995 PP == domain 3 score: -2.1 bits; conditional E-value: 0.28 CBM34.hmm 83 ekvyygengfsgegpedlepa.syqgnvfevpyineid 119 ++ y+++ g++g+++ ++ +++ + +i+ +d WDC82265.1|CBM34|GH13_39 264 NSRYFNAGGLYGDDEGAF--RnKESKYYSWFHFIHYPD 299 677888888884444433..325666666667777766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (567 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 87.60 // Query: WYC76675.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-14 39.4 0.2 9.4e-14 38.2 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.2 0.2 9.4e-14 9.4e-14 2 110 .. 3 115 .. 2 126 .. 0.81 Alignments for each domain: == domain 1 score: 38.2 bits; conditional E-value: 9.4e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k +d+ +++++k+ ++g+++YyFe+ + + WYC76675.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TAKFIIRRDF-GARSEFDMQK-LEDG---IFSVSVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.7777777778.79********.6777...8999999999***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epasyqgnvf 110 +k+yyg +g+ geg ++ e++ ++ WYC76675.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGILYMnEND--VRPYQ 115 4567************9999994443..33333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.43 // Query: UXC26865.1|CBM34|GH13_39 [L=610] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-14 38.6 0.9 1.8e-13 37.3 0.9 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.3 0.9 1.8e-13 1.8e-13 1 116 [. 4 130 .. 4 134 .. 0.83 Alignments for each domain: == domain 1 score: 37.3 bits; conditional E-value: 1.8e-13 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpy.wseeeelpMkkegsdelfdyweatiklepgrlrYyFele 79 iy +p ++pfg+v++g+t++i L + ++ ++V+l++ ++ +++ +pM+ + +d +++ t++ + g++ YyF++ UXC26865.1|CBM34|GH13_39 4 IYFNPwleryKQPFGAVQEGTTVKIWLSVPEQQNTKVFLIVRKEGsSVGQKIFPMEPASEDR--FHFQTTMDQGWGLYFYYFKVI 86 56777777779********************************9997789*******77777..899*****************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevpyin 116 ++ + yyg +g geg+ + e + yq ++++ p + UXC26865.1|CBM34|GH13_39 87 HESegyeTIQYYGFKGHGGEGRIYGsEREvvPYQLTCYQKPEVA 130 66546766779999999988888776555456777777777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (610 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 106.97 // Query: UBK75280.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-17 49.9 0.2 2.3e-17 49.9 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.9 0.2 2.3e-17 2.3e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.9 bits; conditional E-value: 2.3e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK75280.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK75280.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK75280.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.46 // Query: XTP22518.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-16 44.7 0.1 1.8e-15 43.8 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.8 0.1 1.8e-15 1.8e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 43.8 bits; conditional E-value: 1.8e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ XTP22518.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRITIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XTP22518.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.24 // Query: UYO63190.1|CBM34|GH13_39 [L=627] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-15 41.4 2.1 2e-14 40.4 0.1 2.4 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.4 0.1 2e-14 2e-14 3 117 .. 5 122 .. 3 125 .. 0.90 2 ? -0.6 0.3 0.098 0.098 79 110 .. 255 288 .. 253 294 .. 0.69 Alignments for each domain: == domain 1 score: 40.4 bits; conditional E-value: 2e-14 CBM34.hmm 3 Hrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeled 80 H++ rspfg+++ g+++++r+ ++ ++++ +lr+ ++ +e + pM k + + +ywe+t+++ pg+++Y F +e+ UYO63190.1|CBM34|GH13_39 5 HHSwelafRSPFGALPIGNAVTLRVYAT--EIEKLKLRTFFDN--QEVTHPMIK---SRDINYWEITLDMptIPGIFWYDFSFES 82 555588889*************999998..799**********..89*******...55588********999************ PP CBM34.hmm 81 gdekvyygengfs..gegpedl.epasyqgnvfevpyine 117 ++ + yg + + geg+ ++ +p+s q++v++ +++ UYO63190.1|CBM34|GH13_39 83 RGRAYAYGTQHDHlgGEGRIYEtKPPSFQITVYDPQRQSP 122 *********9999999***9998888*******9776665 PP == domain 2 score: -0.6 bits; conditional E-value: 0.098 CBM34.hmm 79 edgdekvyygengfsgegpedl..epasyqgnvf 110 ++gd+++y++ g + e +++ e ++y+++ f UYO63190.1|CBM34|GH13_39 255 HTGDDSLYFNRYGNYPEVGASQskESDYYPWYIF 288 578899*********5555555333336666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (627 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 93.28 // Query: WPD50125.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-15 43.3 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ WPD50125.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe WPD50125.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.61 // Query: WKY47813.1|CBM34|GH13_39 [L=628] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-10 26.9 0.0 6.3e-10 25.8 0.0 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.8 0.0 6.3e-10 6.3e-10 3 113 .. 5 118 .. 3 125 .. 0.83 Alignments for each domain: == domain 1 score: 25.8 bits; conditional E-value: 6.3e-10 CBM34.hmm 3 Hrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeled 80 H++ r pfg+v+ ++ ++ L++ ++d+ +V+l++ + e+ +pM +++ +++ ++i + epg+l+Y Fe++ WKY47813.1|CBM34|GH13_39 5 HNSfiaeyRCPFGAVPINSMVT--LKVFGSDLINVKLHTHFNG--IETVYPMPP---SDYSNFYAINIRVpeEPGLLWYDFEFNM 82 7777777788999999988765..667788999******9988..89*******...566999*99999999************* PP CBM34.hmm 81 gdekvyygen..gfsgegpedlepa.syqgnvfevp 113 +++++ yg + g+ g g+ + e+a syq++ ++ WKY47813.1|CBM34|GH13_39 83 KGKNYTYGTRpdGLGGIGQIYTEKAsSYQITIYDPQ 118 *******97622666999999955569**9999855 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (628 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.16 // Query: UKS68156.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-14 38.9 0.2 1.3e-13 37.7 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.7 0.2 1.3e-13 1.3e-13 2 110 .. 3 115 .. 2 126 .. 0.80 Alignments for each domain: == domain 1 score: 37.7 bits; conditional E-value: 1.3e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k +d+ +++++k+ ++g+++YyFe+ + + UKS68156.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TAKFIIRRDF-GARSEFDMQK-LEDG---IFSVSVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.7777777778.79********.6777...8999999999***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epasyqgnvf 110 +k+yyg +g+ geg ++ e++ ++ UKS68156.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnEND--VRPYQ 115 4567***********99998884433..33333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 106.53 // Query: XIE67836.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-13 37.8 0.2 2.8e-13 36.7 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.7 0.2 2.8e-13 2.8e-13 2 110 .. 3 115 .. 2 126 .. 0.80 Alignments for each domain: == domain 1 score: 36.7 bits; conditional E-value: 2.8e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k e + +++++k+ ++g+++YyFe+ + + XIE67836.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TAKFIIRRDF-GARSEFDMQK---LE-GGIFSVSVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.7777777778.79********...23.57999*999999***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epasyqgnvf 110 +k+yyg +g+ geg ++ e++ ++ XIE67836.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnEND--VRPYQ 115 4567***********99998884433..33333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.16 // Query: UNM60557.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-17 49.6 0.3 2.8e-17 49.6 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.6 0.3 2.8e-17 2.8e-17 1 113 [. 6 125 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.6 bits; conditional E-value: 2.8e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UNM60557.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfevp 113 +++ + yyg+n+++ geg+ +++++ +yq++v+e + UNM60557.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGNIYYDFPnYYQITVYEDN 125 ***************99999999955559999999755 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UNM60557.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.20 // Query: UBK37921.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-17 49.9 0.2 2.3e-17 49.9 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.9 0.2 2.3e-17 2.3e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.9 bits; conditional E-value: 2.3e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK37921.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK37921.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK37921.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 95.65 // Query: XLL12548.1|CBM34|GH13_21 [L=614] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-13 36.1 0.8 8.7e-13 35.1 0.8 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.1 0.8 8.7e-13 8.7e-13 14 100 .. 24 109 .. 18 123 .. 0.85 Alignments for each domain: == domain 1 score: 35.1 bits; conditional E-value: 8.7e-13 CBM34.hmm 14 dgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatiklepgrlrYyFeledgdekvyygengfsgegp 97 gd++ +++r+ k + v+++++r + e+ ++M+k + ++ y++a+i++++++++Y F l ++d+ +yy+ +g +++ p XLL12548.1|CBM34|GH13_21 24 LGDKVFVSVRMYKdSPVTHAFVRKVTNG--AEQYIEMEKGEICNDLVYYKAEIEINEPTVKYIFVLATKDTIYYYNREGYKTYIP 106 599**********777999999988866..9***********99*********************************99997777 PP CBM34.hmm 98 edl 100 ++ XLL12548.1|CBM34|GH13_21 107 DYR 109 555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (614 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 103.72 // Query: WFD90716.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-16 47.2 0.2 1.6e-16 47.2 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.2 0.2 1.6e-16 1.6e-16 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 47.2 bits; conditional E-value: 1.6e-16 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM e+ +++ ++ i+ g ++YyF+ WFD90716.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSIGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMIIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e WFD90716.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p WFD90716.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.48 // Query: WWA21399.1|CBM34|GH13_39 [L=608] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-18 52.1 0.0 1.1e-17 50.9 0.0 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 50.9 0.0 1.1e-17 1.1e-17 1 115 [. 6 127 .. 6 130 .. 0.93 Alignments for each domain: == domain 1 score: 50.9 bits; conditional E-value: 1.1e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 i+H++ r+pfg+v++g++++i++ ++kd + ++l+ d + ++++ M ke+ ++ ++++i+ + g+l YyF+l WWA21399.1|CBM34|GH13_39 6 ILHDSqsirfRRPFGAVEAGQKVKISININKDIIVAIELIKFDGT---KMNMGMNKEYLNNGEFKYSVEIDTsdALGILEYYFIL 87 6899999999***********************988888887766...9************9999******************** PP CBM34.hmm 79 edgdekvyygengfs..gegpedl.epasyqgnvfevpyi 115 dg ++vyyg+n+ + g+g+ + +p yq++v+e +i WWA21399.1|CBM34|GH13_39 88 IDGYDRVYYGNNDNHlgGVGQIYTyNPVPYQITVYEKSFI 127 ***************99999*9997777*******98876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (608 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.62 // Query: WYC64558.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-13 37.6 0.1 3.3e-13 36.5 0.1 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.5 0.1 3.3e-13 3.3e-13 2 110 .. 3 115 .. 2 128 .. 0.81 Alignments for each domain: == domain 1 score: 36.5 bits; conditional E-value: 3.3e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L++ k++v ++ ++ +++ + + e++M+k e + ++a++k+ ++g+++YyFe+ +++ WYC64558.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLQIDKENV-TAKFIIRRDF-GARSEFDMQK---LE-GGIFSASVKFdvGQGLYYYYFEISEST 84 5666666779***********************.7777777778.79********...23.679*******99***********9665 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epasyqgnvf 110 +k+yyg +g+ geg ++ e++ ++ WYC64558.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnEND--VRPYQ 115 5888***********99998884443..33333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.32 // Query: WFD87784.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-16 47.2 0.2 1.6e-16 47.2 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.2 0.2 1.6e-16 1.6e-16 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 47.2 bits; conditional E-value: 1.6e-16 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM e+ +++ ++ i+ g ++YyF+ WFD87784.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSIGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMIIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e WFD87784.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p WFD87784.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 91.27 // Query: XLV25425.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XLV25425.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XLV25425.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.94 // Query: WYC72481.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-14 38.9 0.2 1.3e-13 37.7 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.7 0.2 1.3e-13 1.3e-13 2 110 .. 3 115 .. 2 126 .. 0.80 Alignments for each domain: == domain 1 score: 37.7 bits; conditional E-value: 1.3e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k +d+ +++++k+ ++g+++YyFe+ + + WYC72481.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TAKFIIRRDF-GARSEFDMQK-LEDG---IFSVSVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.7777777778.79********.6777...8999999999***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epasyqgnvf 110 +k+yyg +g+ geg ++ e++ ++ WYC72481.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnEND--VRPYQ 115 4567***********99998884433..33333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.72 // Query: BDH83374.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-16 45.5 0.1 1e-15 44.6 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.6 0.1 1e-15 1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 44.6 bits; conditional E-value: 1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ BDH83374.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRVTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe BDH83374.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 106.97 // Query: QRZ26980.2|CBM34|GH13_39 [L=586] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-15 43.3 0.1 4.9e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 4.9e-15 4.9e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 4.9e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ QRZ26980.2|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe QRZ26980.2|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (586 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 112.13 // Query: BEU87281.1|CBM34|GH13_39|GH77 [L=1149] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-20 58.1 0.0 2.9e-19 56.0 0.0 2.2 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.0 0.0 2.9e-19 2.9e-19 3 113 .. 8 130 .. 7 137 .. 0.89 Alignments for each domain: == domain 1 score: 56.0 bits; conditional E-value: 2.9e-19 CBM34.hmm 3 Hrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsde.lfdyweatikl..epgrlr 73 H++ rsp g++++g+t+++ +r+k + ++V+lr++++ +e+ +++ + +++ +++ +i++ + g+l+ BEU87281.1|CBM34|GH13_39|GH77 8 HNSqdvffRSPVGAAEAGSTVQLGIRMKDcEPQTKVILRLWQES-AGEKLIELANVSTKNeKDCFYRTSIEMpkKGGLLW 86 777888889********************88888**********.77********99977255689******9999**** PP CBM34.hmm 74 YyFeledgd.ekvyygengfs..gegpedl.epasyqgnvfevp 113 YyF++++ d e++yyg+n ++ g g +++ p+s q++v++ BEU87281.1|CBM34|GH13_39|GH77 87 YYFIITSPDeETWYYGNNMEHlgGLGGAYDgVPPSFQITVYNKG 130 ******9999*********9999*******99999999999855 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1149 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 141.14 // Query: XTB75246.1|CBM34|GH13_39|GH77 [L=1132] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-21 63.5 0.1 2.6e-20 59.4 0.1 2.6 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.4 0.1 2.6e-20 2.6e-20 2 120 .] 6 129 .. 5 129 .. 0.89 2 ? 0.8 0.0 0.036 0.036 67 90 .. 819 843 .. 802 854 .. 0.78 Alignments for each domain: == domain 1 score: 59.4 bits; conditional E-value: 2.6e-20 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirL..rtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrl 72 yH++ +s fg+v++g++l +r+ +k+++ +tlr+++ + ++e+++pM + ++ea+i++ e ++l XTB75246.1|CBM34|GH13_39|GH77 6 YHDSrnpvyKSIFGAVRAGKKLILRIsaNIKNENTCCITLRTWKSN-EGEYKIPMAE-----KGGFYEAEITMpeEGTLL 79 9999999999****************555566667799********.88******99.....468********999999* PP CBM34.hmm 73 rYyFeledgdekvyygengfs..gegpedl.epasyqgnvfevpyineidv 120 +YyF+++ ++++vyyg+n+ + g+g + ep+syq++v++ i+++d+ XTB75246.1|CBM34|GH13_39|GH77 80 WYYFIVRYQGNTVYYGNNKHQlgGVGAVYTqEPPSYQITVYD-KGIHTPDW 129 **********************899999997777*******9.56888886 PP == domain 2 score: 0.8 bits; conditional E-value: 0.036 CBM34.hmm 67 l.epgrlrYyFeledgdekvyygen 90 l +++ ++Y F +++++ + y + XTB75246.1|CBM34|GH13_39|GH77 819 LsHNKFMQYIFHIQWQEVRQYAASK 843 3678999*********977776555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1132 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 134.49 // Query: USJ19846.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-14 38.5 0.2 1.7e-13 37.4 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.4 0.2 1.7e-13 1.7e-13 2 115 .. 3 124 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 37.4 bits; conditional E-value: 1.7e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k g + ++a++k+ ++g+++YyFe+ + + USJ19846.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TIKFIIRRDF-GARSEFDMQKLG----GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.9999999999.99********43....678*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvfevpyi 115 +k+yyg +g+ geg ++ e++ yq + f + + USJ19846.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnENDvrPYQATIFSMRDV 124 4567***********9999998766655677777766555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.11 // Query: UBL03867.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-17 49.9 0.2 2.3e-17 49.9 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.9 0.2 2.3e-17 2.3e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.9 bits; conditional E-value: 2.3e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBL03867.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBL03867.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBL03867.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.05 // Query: WFD76493.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-17 49.2 0.2 3.7e-17 49.2 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.2 0.2 3.7e-17 3.7e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -2.0 1.4 0.27 0.27 80 113 .. 263 299 .. 260 306 .. 0.56 Alignments for each domain: == domain 1 score: 49.2 bits; conditional E-value: 3.7e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++ +pM+ e+ +++ ++ i+ g ++YyF+ WFD76493.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYLIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e WFD76493.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -2.0 bits; conditional E-value: 0.27 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevp 113 +g+++ y+++ g +ge +++ + + ++ ++++++p WFD76493.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYNWYRFYDYP 299 5667788888888855555542223334444555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.71 // Query: WYC74809.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-14 39.4 0.2 9.4e-14 38.2 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.2 0.2 9.4e-14 9.4e-14 2 110 .. 3 115 .. 2 126 .. 0.81 Alignments for each domain: == domain 1 score: 38.2 bits; conditional E-value: 9.4e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k +d+ +++++k+ ++g+++YyFe+ + + WYC74809.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TAKFIIRRDF-GARSEFDMQK-LEDG---IFSVSVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.7777777778.79********.6777...8999999999***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epasyqgnvf 110 +k+yyg +g+ geg ++ e++ ++ WYC74809.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGILYMnEND--VRPYQ 115 4567************9999994443..33333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.17 // Query: USS00774.1|CBM34|GH13_39 [L=608] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-14 39.6 0.2 3.4e-14 39.6 0.2 1.8 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.6 0.2 3.4e-14 3.4e-14 1 111 [. 6 124 .. 6 131 .. 0.89 2 ? -4.1 0.5 1 1 87 87 .. 291 291 .. 264 311 .. 0.51 Alignments for each domain: == domain 1 score: 39.6 bits; conditional E-value: 3.4e-14 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsde.lfdyweatikl..epgrlrYyFe 77 i+H++ r pfg+v+ g ++ +++ +k + V l+ + e el Mk++ +++ + + + ++i+ g+++YyF+ USS00774.1|CBM34|GH13_39 6 IFHNSwdikyRAPFGAVEVGRNVSLSIISNKYVISYVHLIFFNGE---ELELLMKRIDEEKfEKYTFNIEIDTskLRGLVNYYFK 87 79************************************9999966...9*******9999944555666666698899******* PP CBM34.hmm 78 ledgdekvyygengfs..gegpedl.epasyqgnvfe 111 + ++e++yyg+n++ g+g + +p+ yq++v++ USS00774.1|CBM34|GH13_39 88 IIYNNEVFYYGNNEEGlgGKGSLYImNPKPYQITVYK 124 *************999989999999889999999997 PP == domain 2 score: -4.1 bits; conditional E-value: 1 CBM34.hmm 87 y 87 y USS00774.1|CBM34|GH13_39 291 Y 291 1 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (608 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.05 // Query: UPO97336.1|CBM34|GH13_29 [L=645] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-13 35.8 0.2 1.6e-12 34.2 0.0 2.0 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.2 0.0 1.6e-12 1.6e-12 6 112 .. 23 138 .. 13 146 .. 0.82 2 ? -3.4 0.1 0.73 0.73 80 112 .. 387 419 .. 385 425 .. 0.58 Alignments for each domain: == domain 1 score: 34.2 bits; conditional E-value: 1.6e-12 CBM34.hmm 6 rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegs....delfdyweatikl..epgrlrYyFeledgd. 82 + pfg+ ++g++++ + t+k ++ ++ l++++ e el+M eg+ d+++ +w+ +++ +++ Y+F+++ g+ UPO97336.1|CBM34|GH13_29 23 KTPFGATPCGENITFNIFTQKnINCLNISLIIKNGK---ELELKMLPEGEkkigDHDYIVWSLNFTTpsLAKTIFYHFKIVIGNd 104 78******************9655668888888866...9*******9996665668999*****999999*********95555 PP CBM34.hmm 83 .ekvyygengfs..gegpedlepa.syqgnvfev 112 +++yyg+n + g g+ +++++ +yq++ + UPO97336.1|CBM34|GH13_29 105 nTVFYYGNNSLAlgGIGDIYENFPiDYQITLYYK 138 8999******999888888886666888887754 PP == domain 2 score: -3.4 bits; conditional E-value: 0.73 CBM34.hmm 80 dgdekvyygengfsgegpedlepasyqgnvfev 112 d ++kv yg+++++ +g++ ++ +y+ + + + UPO97336.1|CBM34|GH13_29 387 DASNKVSYGQRREYFNGKQLDSAMNYPLRTYLL 419 566888899988884444333233665555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (645 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 94.56 // Query: URL09520.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-16 44.8 0.1 1.7e-15 43.8 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.8 0.1 1.7e-15 1.7e-15 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 43.8 bits; conditional E-value: 1.7e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k s + ++ ti++ epg++ Y+Fe++ URL09520.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTKDSSGD----FRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********88888....********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe URL09520.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.72 // Query: CAJ1223428.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-16 45.5 0.1 1e-15 44.6 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.6 0.1 1e-15 1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 44.6 bits; conditional E-value: 1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFe 77 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe CAJ1223428.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRVTIPFdeEPGLYFYHFE 79 7777888889********************999.9*********.99********...44.5569****************** PP CBM34.hmm 78 ledgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++++ ++ +yg +g+ geg + e++ yq +vfe CAJ1223428.1|CBM34|GH13_39 80 IVESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 *9766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 103.39 // Query: XJT44745.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XJT44745.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XJT44745.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.75 // Query: WKG35682.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-15 41.6 0.1 1.6e-14 40.6 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.6 0.1 1.6e-14 1.6e-14 2 114 .. 3 123 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 40.6 bits; conditional E-value: 1.6e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ WKG35682.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLSFTTDQPSV-LVTCVIRRDF-GKRYEFSMSK---DS-GGDFRITIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevpy 114 +++ ++ +yg +g+ geg + e++ yq +vfe WKG35682.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKED 123 766677799*********999888755544566777766554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.02 // Query: XLO95765.1|CBM34|GH13_39 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-11 31.3 1.9 2.7e-11 30.3 1.9 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.3 1.9 2.7e-11 2.7e-11 6 110 .. 13 114 .. 3 123 .. 0.79 Alignments for each domain: == domain 1 score: 30.3 bits; conditional E-value: 2.7e-11 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFeledgdekvyyge 89 +spfg++++++t++ r+++ + v+ ++l++ + ++ +pMkk+ + + +++++++ + g++ YyFe++++++ yy+e XLO95765.1|CBM34|GH13_39 13 KSPFGAIKARTTVTWRVKID-EPVDYINLWLTKAE-ETPVPYPMKKTDE----QTYQVQVTIgTSGLYHYYFEIKQSNQISYYQE 91 89*****************9.799*********99.8899******444....66***********************9999998 PP CBM34.hmm 90 ngfs.gegpedlepa.syqgnvf 110 ge +++++ +yq +++ XLO95765.1|CBM34|GH13_39 92 ALGGeGELVTSNQNLaQYQLTCY 114 65542333333334446666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 96.96 // Query: BDC00363.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-17 47.9 0.3 9.1e-17 47.9 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.9 0.3 9.1e-17 9.1e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 47.9 bits; conditional E-value: 9.1e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ ++L +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ BDC00363.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSIGSKVSLSLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECVIYKGIIDTtdSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e BDC00363.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p BDC00363.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.44 // Query: WLD82906.1|CBM34|GH13_39|GH77 [L=1149] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-16 45.2 0.1 4.7e-15 42.4 0.0 2.5 3 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.4 0.0 4.7e-15 4.7e-15 3 112 .. 9 128 .. 7 135 .. 0.88 2 ? -2.5 0.0 0.39 0.39 28 66 .. 454 504 .. 451 511 .. 0.70 3 ? -2.7 0.0 0.43 0.43 73 93 .. 844 864 .. 840 873 .. 0.85 Alignments for each domain: == domain 1 score: 42.4 bits; conditional E-value: 4.7e-15 CBM34.hmm 3 Hrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrY 74 H++ rs g++++g++l++ +r+ + + +V +r+++++ +e +p++ ++++ ++++a ++l +++Y WLD82906.1|CBM34|GH13_39|GH77 9 HNSqniyfRSIVGAAEAGSRLRLGIRIRTyEPIHQVLVRLWQDQ-TGERLIPLETRDTQGEQKFYTAWFELpdYGCLVWY 87 7777777788999********9999999989*************.77************************9444568** PP CBM34.hmm 75 yFeledgdekvyygengfs..gegpedl.epasyqgnvfev 112 yF+++ ++ +++yg+n + g+g + pasyq++ ++ WLD82906.1|CBM34|GH13_39|GH77 88 YFIITMESGTYFYGNNPEMlgGVGALSTaAPASYQITIYNK 128 ****************9999999999998888999999974 PP == domain 2 score: -2.5 bits; conditional E-value: 0.39 CBM34.hmm 28 dvk.sVtlrygdpy.....wseeeelpMkkegsdel......fdyweatik 66 dv+ +t++ g py e+ +l M+ e+ d + w++t++ WLD82906.1|CBM34|GH13_39|GH77 454 DVQrAITVLAGVPYyegmpAIEQSRLRMTDEQFDLGsrrllmATLWQMTYP 504 555357888899999999877889999999777653344455777777776 PP == domain 3 score: -2.7 bits; conditional E-value: 0.43 CBM34.hmm 73 rYyFeledgdekvyygengfs 93 +Y+F +++ ++y +++g++ WLD82906.1|CBM34|GH13_39|GH77 844 QYVFHTQWDRLHAYATKKGIK 864 7*********99999999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1149 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 132.25 // Query: UUR81124.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-17 49.8 0.3 2.4e-17 49.8 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.8 0.3 2.4e-17 2.4e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.8 bits; conditional E-value: 2.4e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UUR81124.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UUR81124.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UUR81124.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 104.10 // Query: BDH80982.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.3 0.1 2.1e-14 40.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.3 0.1 2.1e-14 2.1e-14 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 40.3 bits; conditional E-value: 2.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ e g++ Y+Fe++ BDH80982.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMNLSFTTDRPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRVTIPFdeESGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe BDH80982.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.50 // Query: UBK97756.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-17 47.9 0.3 9.1e-17 47.9 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.9 0.3 9.1e-17 9.1e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 47.9 bits; conditional E-value: 9.1e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ ++L +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK97756.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSIGSKVSLSLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECVIYKGIIDTtdSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK97756.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK97756.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.89 // Query: UFH64934.1|CBM34|GH13_39 [L=603] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-18 53.8 1.2 1.3e-18 53.8 1.2 2.6 3 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.8 1.2 1.3e-18 1.3e-18 2 115 .. 5 125 .. 4 129 .. 0.94 2 ? -0.6 0.4 0.099 0.099 72 97 .. 289 314 .. 279 326 .. 0.80 3 ? -2.5 0.0 0.37 0.37 71 82 .. 570 581 .. 568 587 .. 0.76 Alignments for each domain: == domain 1 score: 53.8 bits; conditional E-value: 1.3e-18 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 +H++ r+pfg+v++g+++ i L t+ +V+l + + +++e++ M e + +l+ ++a++ e g+++YyF +e UFH64934.1|CBM34|GH13_39 5 FHNSqskgyRNPFGAVKKGTKVEIILETEV--FSKVELNLTFFN-ERKENIVMNYENMGGLGARYKAEVYTenELGLINYYFTIE 86 899999999*******************95..7799******99.88************************9************* PP CBM34.hmm 80 dgdekvyygengfs..gegpedl.epasyqgnvfevpyi 115 ++d+k++yg+n++ geg+ + +p++yq++v+e yi UFH64934.1|CBM34|GH13_39 87 NNDNKYFYGNNDEAlgGEGKIYTeNPKQYQITVYEDQYI 125 ***************999999997888*******98887 PP == domain 2 score: -0.6 bits; conditional E-value: 0.099 CBM34.hmm 72 lrYyFeledgdekvyygengfsgegp 97 +Y+F+ +d +++ g++++ ++++ UFH64934.1|CBM34|GH13_39 289 KWYRFRKFPNDYECWWGDKNLPDVEE 314 59*********999999998876555 PP == domain 3 score: -2.5 bits; conditional E-value: 0.37 CBM34.hmm 71 rlrYyFeledgd 82 +lrY+F+l ++ UFH64934.1|CBM34|GH13_39 570 LLRYQFKLDLKG 581 689****98555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (603 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.55 // Query: XTP12863.1|CBM34|GH13_39 [L=610] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-16 47.6 0.1 1.2e-16 47.6 0.1 1.9 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.6 0.1 1.2e-16 1.2e-16 2 111 .. 7 123 .. 6 130 .. 0.91 2 ? -2.7 0.7 0.44 0.44 83 112 .. 266 295 .. 261 306 .. 0.55 Alignments for each domain: == domain 1 score: 47.6 bits; conditional E-value: 1.2e-16 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 +H++ r+pfg+v++g+++++++ ++k+ v ++l+ d + + ++ M+ke+ + ++ ++++i+ + g l YyF+l XTP12863.1|CBM34|GH13_39 7 MHDSqsivyRKPFGAVEEGQKVKLSIDIEKEIVVAIELLQFDGT---KVNMGMEKEYLNSGNYRYSIEIDTedALGVLGYYFILI 88 799999999************************99999999977...9************************9************ PP CBM34.hmm 80 dgdekvyygengfs..gegpedl.epasyqgnvfe 111 dg ++vyyg+n+++ g g+ + +p yq++ ++ XTP12863.1|CBM34|GH13_39 89 DGYDRVYYGNNDEHlgGIGQIYTyNPVPYQITIYK 123 **************999999888666688888876 PP == domain 2 score: -2.7 bits; conditional E-value: 0.44 CBM34.hmm 83 ekvyygengfsgegpedlepasyqgnvfev 112 ++ y+++ g ++e ++++p+s+ +n +++ XTP12863.1|CBM34|GH13_39 266 DSRYFNKAGNYDEIGAYQSPNSKYHNWYKF 295 677888888885555555333333333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (610 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.11 // Query: USI61321.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ USI61321.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe USI61321.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.02 // Query: XJU60162.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XJU60162.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XJU60162.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 103.42 // Query: WYC92751.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-14 38.6 0.3 1.6e-13 37.5 0.3 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.5 0.3 1.6e-13 1.6e-13 2 113 .. 3 122 .. 2 129 .. 0.83 Alignments for each domain: == domain 1 score: 37.5 bits; conditional E-value: 1.6e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k e + ++a++k+ ++g+++YyFe+ + + WYC92751.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TIKFIIRRDF-GARSEFDMQK---LE-GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.9999999999.99********...23.679*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +k+yyg +g+ geg ++ e++ yq + f + WYC92751.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnENDvrPYQATIFSMR 122 4567***********99999886665556666666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.94 // Query: XBO62235.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-15 43.5 0.1 4.3e-15 42.5 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.5 0.1 4.3e-15 4.3e-15 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 42.5 bits; conditional E-value: 4.3e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XBO62235.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XBO62235.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.21 // Query: WYC66551.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-13 37.6 0.1 3.3e-13 36.5 0.1 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.5 0.1 3.3e-13 3.3e-13 2 110 .. 3 115 .. 2 128 .. 0.81 Alignments for each domain: == domain 1 score: 36.5 bits; conditional E-value: 3.3e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L++ k++v ++ ++ +++ + + e++M+k e + ++a++k+ ++g+++YyFe+ +++ WYC66551.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLQIDKENV-TAKFIIRRDF-GARSEFDMQK---LE-GGIFSASVKFdvGQGLYYYYFEISEST 84 5666666779***********************.7777777778.79********...23.679*******99***********9665 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epasyqgnvf 110 +k+yyg +g+ geg ++ e++ ++ WYC66551.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnEND--VRPYQ 115 5888***********99998884443..33333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 101.87 // Query: URN84732.1|CBM34|GH13_39 [L=195] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-15 44.3 0.1 1.7e-15 43.8 0.1 1.2 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.8 0.1 1.7e-15 1.7e-15 3 117 .. 5 122 .. 3 125 .. 0.90 Alignments for each domain: == domain 1 score: 43.8 bits; conditional E-value: 1.7e-15 CBM34.hmm 3 Hrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeled 80 H++ rspfg+++ g+++++r+ ++ ++++ +lr+ ++ +e + pM k + + +ywe+t+++ pg+++Y F +e+ URN84732.1|CBM34|GH13_39 5 HHSwelafRSPFGALPIGNAVTLRVYAT--EIEKLKLRTFFDN--QEVTHPMIK---SRDINYWEITLDMptIPGIFWYDFSFES 82 555688889*************999998..799**********..89*******...55588********999************ PP CBM34.hmm 81 gdekvyygengfs..gegpedl.epasyqgnvfevpyine 117 ++ + yg + + geg+ ++ +p+s q++v++ +++ URN84732.1|CBM34|GH13_39 83 RGRAYAYGTQHDHlgGEGRIYEtKPPSFQITVYDPQRQSP 122 *********9999999***9998888*******9777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (195 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 42.72 // Query: XBB58630.1|CBM34|GH13_39 [L=669] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (669 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 507.52 // Query: WDT39627.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-17 49.6 0.3 2.7e-17 49.6 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.6 0.3 2.7e-17 2.7e-17 1 113 [. 6 125 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.6 bits; conditional E-value: 2.7e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ WDT39627.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSIGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfevp 113 +++ + yyg+n+++ geg+ +++++ +yq++v+e + WDT39627.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYEDN 125 ***************99999999955559999999755 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p WDT39627.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.36 // Query: UTY54757.1|CBM34|GH13_39 [L=610] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-16 47.0 0.1 1.7e-16 47.0 0.1 1.9 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.0 0.1 1.7e-16 1.7e-16 2 112 .. 7 124 .. 6 130 .. 0.91 2 ? -2.7 0.7 0.44 0.44 83 112 .. 266 295 .. 261 306 .. 0.55 Alignments for each domain: == domain 1 score: 47.0 bits; conditional E-value: 1.7e-16 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 +H++ r+pfg+v++g+++++++ ++k+ v ++l+ d + + ++ M+ke+ + ++ ++++i+ + g l YyF+l UTY54757.1|CBM34|GH13_39 7 MHDSqsivyRRPFGAVEEGQKVKLSIDIEKEIVVAIELLQFDGT---KVNMGMEKEYLNSGNYRYSIEIDTedALGVLGYYFILI 88 799999999************************99999999977...9************************9************ PP CBM34.hmm 80 dgdekvyygengfs..gegpedl.epasyqgnvfev 112 dg ++vyyg+n+++ g g+ + +p yq++ ++ UTY54757.1|CBM34|GH13_39 89 DGYDRVYYGNNDEHlgGIGQIYTyNPVPYQITIYKK 124 **************9999999986666888888874 PP == domain 2 score: -2.7 bits; conditional E-value: 0.44 CBM34.hmm 83 ekvyygengfsgegpedlepasyqgnvfev 112 ++ y+++ g ++e ++++p+s+ +n +++ UTY54757.1|CBM34|GH13_39 266 DSRYFNKAGNYDEIGAYQSPNSKYHNWYKF 295 677888888885555555333333333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (610 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.34 // Query: UBK66342.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-17 49.2 0.2 3.7e-17 49.2 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.2 0.2 3.7e-17 3.7e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -2.0 1.4 0.27 0.27 80 113 .. 263 299 .. 260 306 .. 0.56 Alignments for each domain: == domain 1 score: 49.2 bits; conditional E-value: 3.7e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++ +pM+ e+ +++ ++ i+ g ++YyF+ UBK66342.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYLIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK66342.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -2.0 bits; conditional E-value: 0.27 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevp 113 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK66342.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYNWYRFYDYP 299 5667788888888855555542223334444555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.86 // Query: UYX12424.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-10 26.7 1.2 7.1e-10 25.7 1.2 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.7 1.2 7.1e-10 7.1e-10 6 110 .. 13 113 .. 5 125 .. 0.78 Alignments for each domain: == domain 1 score: 25.7 bits; conditional E-value: 7.1e-10 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFeledgdekvyyge 89 ++pfg+ +++++++ + + ++++++tl++ +++ ++ +pM+ + + +++e ++k+ g+++YyF+++++d+ ++++ UYX12424.1|CBM34|GH13_39 13 KQPFGATQANTSVKWAVEVD-EEIQEITLWLTKNN-ESPVAYPMTFNDE---SKMYETSVKIsSSGLYYYYFNIKQNDQFYFLER 92 789***********999999.79************.779*******555...55*********************9987666655 PP CBM34.hmm 90 ngfs.gegpedlepasyqgnvf 110 ++ g+g+ ++ + + +++ UYX12424.1|CBM34|GH13_39 93 SQDGfGDGEITQ-DGRDIRTFQ 113 443334444333.334444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 103.49 // Query: XEQ95346.1|CBM34|GH13_39|GH77 [L=1171] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-21 63.2 0.0 3.8e-21 62.1 0.0 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.1 0.0 3.8e-21 3.8e-21 1 111 [. 6 131 .. 6 140 .. 0.89 Alignments for each domain: == domain 1 score: 62.1 bits; conditional E-value: 3.8e-21 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkdd......vksVtlrygdpywseeeelpMkkegsdelfdyweatikl.. 67 i+H++ rspfg++ + +++++rL t + + + + lr++++ +e l+M+ +++++ +ea++++ XEQ95346.1|CBM34|GH13_39|GH77 6 IFHDShnkdfRSPFGAAACYTEITLRLLTVNTKrqgelpAETADLRLWQEG-AGEILLDMQLVREEQGRRLYEASFTApg 84 78999999*******************76664445667799**********.77************************** PP CBM34.hmm 68 epgrlrYyFeledgdekvyygengfs..gegpedl.epasyqgnvfe 111 +pg ++YyF+++ g++++yyg+n ++ g+g+ + p+syq++ + XEQ95346.1|CBM34|GH13_39|GH77 85 NPGVIWYYFIIRRGEQTFYYGNNAAElgGVGQLLSyPPPSYQISTYL 131 **************************999999988666699998885 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1171 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.41 // Query: XNN45178.1|CBM34|GH13_39 [L=593] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (593 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 410.14 // Query: WKF73847.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.3 0.1 2.1e-14 40.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.3 0.1 2.1e-14 2.1e-14 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 40.3 bits; conditional E-value: 2.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ e g++ Y+Fe++ WKF73847.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMNLSFTTDRPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRVTIPFdeESGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe WKF73847.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.58 // Query: UBK77883.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-17 49.8 0.3 2.4e-17 49.8 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.8 0.3 2.4e-17 2.4e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.8 bits; conditional E-value: 2.4e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK77883.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK77883.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK77883.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.63 // Query: XER04711.1|CBM34|GH13_39|GH77 [L=1173] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-21 63.5 0.4 4.7e-21 61.8 0.0 2.2 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.8 0.0 4.7e-21 4.7e-21 1 111 [. 6 131 .. 6 140 .. 0.89 2 ? -3.3 0.5 0.68 0.68 80 106 .. 273 301 .. 272 315 .. 0.58 Alignments for each domain: == domain 1 score: 61.8 bits; conditional E-value: 4.7e-21 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkdd......vksVtlrygdpywseeeelpMkkegsdelfdyweatikl.. 67 i+H++ rspfg++++ +++++rL ++ + v++V lr++++ +e+ + M+ ++ + ++a i+ XER04711.1|CBM34|GH13_39|GH77 6 ILHDShnkdfRSPFGAASCHSEIKLRLMIAAPQhqgltpVTEVRLRLWQDG-IGETLINMHHIEASYGQHLYQAVITTpd 84 5688888899*****************777744467777************.88***********************99* PP CBM34.hmm 68 epgrlrYyFeledgdekvyygengfs..gegpedl.epasyqgnvfe 111 +pg l+YyF+++ g++ +yyg+n+ + g g+ ++ p+syq++ + XER04711.1|CBM34|GH13_39|GH77 85 TPGVLWYYFIVNRGGKIFYYGNNQDEkgGLGQIQDyPPPSYQISTYL 131 ************************99999999999666699998875 PP == domain 2 score: -3.3 bits; conditional E-value: 0.68 CBM34.hmm 80 dgdekvyygengfsgegpedl..epasyq 106 +g++++y++++g + e +++ e ++y XER04711.1|CBM34|GH13_39|GH77 273 TGSDSIYFNAEGTYPEVGAYQskESPYYS 301 56788999999999555544423333332 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1173 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 145.14 // Query: WVJ00796.1|CBM34|GH13_29 [L=645] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-11 29.6 0.0 1.4e-10 28.0 0.0 1.9 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.0 0.0 1.4e-10 1.4e-10 6 112 .. 23 138 .. 13 146 .. 0.81 Alignments for each domain: == domain 1 score: 28.0 bits; conditional E-value: 1.4e-10 CBM34.hmm 6 rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegs....delfdyweatikl..epgrlrYyFeledgd. 82 + pfg+ ++g++++ + t+k ++ ++l++++ e++M e++ d+++ +w+ +++ +++ Y+F++ g+ WVJ00796.1|CBM34|GH13_29 23 KTPFGATPCGENIKFNILTQKnINCLGINLIIKNGK---ILEFKMLPEAEkkigDHDYIVWSLNFTTpsLAKTIFYHFKISIGNe 104 78*******************656669999999987...677777777774444778999*****999999**********6665 PP CBM34.hmm 83 .ekvyygengfs..gegpedlepa.syqgnvfev 112 + +yyg+n + g g+ +++++ +yq++ + WVJ00796.1|CBM34|GH13_29 105 nTIFYYGNNSLAlgGRGDIYENFPiDYQITLYYK 138 788999***9999888888886666888887754 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (645 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 108.93 // Query: WYC68552.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-13 37.6 0.1 3.3e-13 36.5 0.1 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.5 0.1 3.3e-13 3.3e-13 2 110 .. 3 115 .. 2 128 .. 0.81 Alignments for each domain: == domain 1 score: 36.5 bits; conditional E-value: 3.3e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L++ k++v ++ ++ +++ + + e++M+k e + ++a++k+ ++g+++YyFe+ +++ WYC68552.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLQIDKENV-TAKFIIRRDF-GARSEFDMQK---LE-GGIFSASVKFdvGQGLYYYYFEISEST 84 5666666779***********************.7777777778.79********...23.679*******99***********9665 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epasyqgnvf 110 +k+yyg +g+ geg ++ e++ ++ WYC68552.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnEND--VRPYQ 115 5888***********99998884443..33333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.67 // Query: UBK47079.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-17 49.9 0.2 2.3e-17 49.9 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.9 0.2 2.3e-17 2.3e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.9 bits; conditional E-value: 2.3e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK47079.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK47079.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK47079.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.01 // Query: CAA7602780.1|CBM34|GH13_39 [L=809] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-19 57.2 0.0 3.3e-19 55.8 0.0 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 55.8 0.0 3.3e-19 3.3e-19 2 113 .. 6 173 .. 5 178 .. 0.94 Alignments for each domain: == domain 1 score: 55.8 bits; conditional E-value: 3.3e-19 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdel..................... 57 yH++ r+pfg+v++g++++ rL+t v+ ++lr++ +e+ +pM+ ++++ + CAA7602780.1|CBM34|GH13_39 6 YHDShnlfyRNPFGAVPCGSRVRFRLKTRSmFPVEACYLRLWLGE--REKLVPMSPAAEKSEaaaagewvteaeeaaaeaaga 86 8999999*9**********************************99..9********88877667889999999999999999* PP CBM34.hmm 58 ..........................fdyweatikl..epgrlrYyFeledgdekvyygengfs..gegpedl.epasyqgnv 109 ++ea +++ epg+l+YyF++++g++++yyg+n+ + geg ep+syq +v CAA7602780.1|CBM34|GH13_39 87 ergerpvhveepaaeaeepaveagapWAVFEAVYEVreEPGLLWYYFRVRAGGREFYYGNNEDKlgGEGALWAgEPPSYQLTV 169 *************************************************************999999***9999999****** PP CBM34.hmm 110 fevp 113 ++ CAA7602780.1|CBM34|GH13_39 170 YRPM 173 9865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (809 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 108.09 // Query: WZL23046.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.7e-14 38.3 0.2 1.9e-13 37.2 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.2 0.2 1.9e-13 1.9e-13 2 113 .. 3 122 .. 2 129 .. 0.83 Alignments for each domain: == domain 1 score: 37.2 bits; conditional E-value: 1.9e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k g + ++a++k+ ++g+++YyFe+ + + WZL23046.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TIKFIIRRDF-GARSEFDMQKLG----GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.9999999999.99********43....678*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +k+yyg +g+ geg ++ e++ yq + f + WZL23046.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnENDvrPYQATIFSMR 122 4567***********99999886665556666666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.33 // Query: WEA13192.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-13 37.8 0.2 2.8e-13 36.7 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.7 0.2 2.8e-13 2.8e-13 2 110 .. 3 115 .. 2 126 .. 0.80 Alignments for each domain: == domain 1 score: 36.7 bits; conditional E-value: 2.8e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k e + +++++k+ ++g+++YyFe+ + + WEA13192.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TAKFIIRRDF-GARSEFDMQK---LE-GGIFSVSVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.7777777778.79********...23.57999*999999***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epasyqgnvf 110 +k+yyg +g+ geg ++ e++ ++ WEA13192.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnEND--VRPYQ 115 4567***********99998884433..33333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.81 // Query: XQO13210.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XQO13210.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XQO13210.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.62 // Query: WYC85577.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-14 38.7 0.2 1.5e-13 37.5 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.5 0.2 1.5e-13 1.5e-13 2 108 .. 3 117 .. 2 128 .. 0.80 Alignments for each domain: == domain 1 score: 37.5 bits; conditional E-value: 1.5e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k e + ++a++k+ ++g+++YyFe+ + + WYC85577.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLQTDKENV-TAKFIIRRDF-GARSEFDMQK---LE-GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.7777777778.79********...23.679*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgn 108 +k+yyg +g+ geg ++ e++ yq + WYC85577.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnEDDvrPYQAT 117 4567***********999988844442233333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.53 // Query: XBO63832.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-15 43.5 0.1 4.3e-15 42.5 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.5 0.1 4.3e-15 4.3e-15 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 42.5 bits; conditional E-value: 4.3e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XBO63832.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XBO63832.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.91 // Query: XOW13309.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-16 44.7 0.1 1.8e-15 43.8 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.8 0.1 1.8e-15 1.8e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 43.8 bits; conditional E-value: 1.8e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ XOW13309.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRITIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XOW13309.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.26 // Query: XSB60503.1|CBM34|GH13_39 [L=610] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-16 47.0 0.1 1.7e-16 47.0 0.1 1.9 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.0 0.1 1.7e-16 1.7e-16 2 112 .. 7 124 .. 6 130 .. 0.91 2 ? -2.7 0.7 0.44 0.44 83 112 .. 266 295 .. 261 306 .. 0.55 Alignments for each domain: == domain 1 score: 47.0 bits; conditional E-value: 1.7e-16 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 +H++ r+pfg+v++g+++++++ ++k+ v ++l+ d + + ++ M+ke+ + ++ ++++i+ + g l YyF+l XSB60503.1|CBM34|GH13_39 7 MHDSqsivyRRPFGAVEEGQKVKLSIDIEKEIVVAIELLQFDGT---KVNMGMEKEYLNSGNYRYSIEIDTedALGVLGYYFILI 88 799999999************************99999999977...9************************9************ PP CBM34.hmm 80 dgdekvyygengfs..gegpedl.epasyqgnvfev 112 dg ++vyyg+n+++ g g+ + +p yq++ ++ XSB60503.1|CBM34|GH13_39 89 DGYDRVYYGNNDEHlgGIGQIYTyNPVPYQITIYKK 124 **************9999999986666888888874 PP == domain 2 score: -2.7 bits; conditional E-value: 0.44 CBM34.hmm 83 ekvyygengfsgegpedlepasyqgnvfev 112 ++ y+++ g ++e ++++p+s+ +n +++ XSB60503.1|CBM34|GH13_39 266 DSRYFNKAGNYDEIGAYQSPNSKYHNWYKF 295 677888888885555555333333333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (610 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.70 // Query: XQO24255.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XQO24255.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XQO24255.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.04 // Query: UCS90894.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-16 45.5 0.1 1e-15 44.6 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.6 0.1 1e-15 1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 44.6 bits; conditional E-value: 1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ UCS90894.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRVTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe UCS90894.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.93 // Query: XUT98860.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XUT98860.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XUT98860.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.44 // Query: UBK41001.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-17 49.6 0.3 2.7e-17 49.6 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.6 0.3 2.7e-17 2.7e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.6 bits; conditional E-value: 2.7e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK41001.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSIGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK41001.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK41001.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 93.26 // Query: XEQ91365.1|CBM34|GH13_39|GH77 [L=1191] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-21 63.2 0.1 5.7e-21 61.5 0.0 2.0 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.5 0.0 5.7e-21 5.7e-21 1 113 [. 6 133 .. 6 140 .. 0.90 2 ? -2.6 0.2 0.41 0.41 80 105 .. 273 300 .. 271 315 .. 0.61 Alignments for each domain: == domain 1 score: 61.5 bits; conditional E-value: 5.7e-21 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkdd......vksVtlrygdpywseeeelpMkkegsdelfdyweatikl.. 67 i+H++ rspfg++++ ++++++L ++ ++ V lr++++ +e+ ++M+ ++ ++ + +ea i++ XEQ91365.1|CBM34|GH13_39|GH77 6 ILHDShnvdfRSPFGAASCHSEITLKLLIATPHhygvppLDAVLLRTWQDG-TGETMIDMRLAQDHGGQKLYEAVITApd 84 6789999999*****************888744478888************.77************************** PP CBM34.hmm 68 epgrlrYyFeledgdekvyygengfs..gegpedl.epasyqgnvfevp 113 pg ++YyF +++g++++yyg+n ++ g+g ++ p+syq++ ++ XEQ91365.1|CBM34|GH13_39|GH77 85 SPGVIWYYFVVRQGGQTFYYGNNAEEtgGVGHIYDsPPPSYQISTYIPG 133 **************************9999999996666**99999744 PP == domain 2 score: -2.6 bits; conditional E-value: 0.41 CBM34.hmm 80 dgdekvyygengfs.gegpedl.epasy 105 +g++++y+++ng + ++g ++ e ++y XEQ91365.1|CBM34|GH13_39|GH77 273 TGSDSIYFNQNGTYdSVGACQSrESPYY 300 6779999999999954444444333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1191 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.74 // Query: BDW47803.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-14 38.5 0.2 1.7e-13 37.4 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.4 0.2 1.7e-13 1.7e-13 2 113 .. 3 122 .. 2 129 .. 0.83 Alignments for each domain: == domain 1 score: 37.4 bits; conditional E-value: 1.7e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k g + ++a++k+ ++g+++YyFe+ + + BDW47803.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TIKFIIRRDF-GARSEFDMQKLG----GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.9999999999.99********43....678*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +k+yyg +g+ geg ++ e++ yq + f + BDW47803.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnENDvhPYQATIFSMR 122 4567***********99999986555445666666554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 112.08 // Query: UBK44030.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-17 48.4 0.3 6.6e-17 48.4 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 48.4 0.3 6.6e-17 6.6e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 48.4 bits; conditional E-value: 6.6e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL + ++ +V++ + + + ++++++pMk e+ +++ ++ i+ g ++YyF+ UBK44030.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECR--ECGEVFIEVIKFD-GSRYSIPMKIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89***************************9..68889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ g+g+ +++++ +yq++v+e UBK44030.1|CBM34|GH13_39 88 IKDGFTQYYGNNDEClgGKGKIYYDFPnYYQITVYED 124 ***************9888888885555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK44030.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.95 // Query: WJV34076.1|CBM34|GH13_39 [L=610] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-16 47.0 0.1 1.7e-16 47.0 0.1 1.9 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.0 0.1 1.7e-16 1.7e-16 2 112 .. 7 124 .. 6 130 .. 0.91 2 ? -2.7 0.7 0.44 0.44 83 112 .. 266 295 .. 261 306 .. 0.55 Alignments for each domain: == domain 1 score: 47.0 bits; conditional E-value: 1.7e-16 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 +H++ r+pfg+v++g+++++++ ++k+ v ++l+ d + + ++ M+ke+ + ++ ++++i+ + g l YyF+l WJV34076.1|CBM34|GH13_39 7 MHDSqsivyRRPFGAVEEGQKVKLSIDIEKEIVVAIELLQFDGT---KVNMGMEKEYLNSGNYRYSIEIDTedALGVLGYYFILI 88 799999999************************99999999977...9************************9************ PP CBM34.hmm 80 dgdekvyygengfs..gegpedl.epasyqgnvfev 112 dg ++vyyg+n+++ g g+ + +p yq++ ++ WJV34076.1|CBM34|GH13_39 89 DGYDRVYYGNNDEHlgGIGQIYTyNPVPYQITIYKK 124 **************9999999986666888888874 PP == domain 2 score: -2.7 bits; conditional E-value: 0.44 CBM34.hmm 83 ekvyygengfsgegpedlepasyqgnvfev 112 ++ y+++ g ++e ++++p+s+ +n +++ WJV34076.1|CBM34|GH13_39 266 DSRYFNKAGNYDEIGAYQSPNSKYHNWYKF 295 677888888885555555333333333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (610 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 91.85 // Query: XBK21806.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-16 45.3 0.1 1.1e-15 44.4 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.4 0.1 1.1e-15 1.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 44.4 bits; conditional E-value: 1.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ XBK21806.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRVTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XBK21806.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 99.79 // Query: XHU74798.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XHU74798.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XHU74798.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.43 // Query: WEA56016.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-16 45.5 0.1 1e-15 44.6 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.6 0.1 1e-15 1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 44.6 bits; conditional E-value: 1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ WEA56016.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRVTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe WEA56016.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.40 // Query: XFO64010.1|CBM34|GH13_39|GH77 [L=1166] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-21 61.6 1.1 2.1e-20 59.7 0.0 2.5 3 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.7 0.0 2.1e-20 2.1e-20 3 112 .. 8 132 .. 6 140 .. 0.87 2 ? -3.4 0.3 0.72 0.72 81 106 .. 272 299 .. 270 314 .. 0.53 3 ? -0.9 0.1 0.12 0.12 52 93 .. 829 873 .. 806 890 .. 0.82 Alignments for each domain: == domain 1 score: 59.7 bits; conditional E-value: 2.1e-20 CBM34.hmm 3 Hrp.....rspfgyvydgdtlhirLrtkkdd......vksVtlrygdpywseeeelpMkkegsdelfdyweatikl..ep 69 H++ rspfg+v++ +++++r+ ++ + v+ V+lr++++ +e+ ++M+ +++++ +ea +++ p XFO64010.1|CBM34|GH13_39|GH77 8 HDShnadfRSPFGAVSCHTEITLRMLIAAPQhpafilVDAVQLRLWQDG-LGETIIDMRVSEKQQDRCLYEAVFSApaVP 86 66666699*****************999866699**9************.67***********************9999* PP CBM34.hmm 70 grlrYyFeledgdekvyygengfs..gegpedl.epasyqgnvfev 112 g l+YyF++++g++ +yyg+ng++ g+g p+syq++ + XFO64010.1|CBM34|GH13_39|GH77 87 GVLWYYFIVRQGGQIFYYGNNGEEtgGVGYLAAsPPPSYQISTYLP 132 ************************8877777775555999988854 PP == domain 2 score: -3.4 bits; conditional E-value: 0.72 CBM34.hmm 81 gdekvyygengfsgegpedl..epasyq 106 g++++y++++g +g +++ e ++y XFO64010.1|CBM34|GH13_39|GH77 272 GSDSIYFNKEGTYGAVGAYQspESPYYS 299 6677888888888555555522222222 PP == domain 3 score: -0.9 bits; conditional E-value: 0.12 CBM34.hmm 52 egsdelfdyweatikl...epgrlrYyFeledgdekvyygengfs 93 ++++ + dy++ ++ ++ l+ F ++++ ++y g +g++ XFO64010.1|CBM34|GH13_39|GH77 829 QREEAALDYYRQELAEeiaYQRFLQFAFWQQWQEVRIYAGRQGIR 873 4556679999999998888889999*************9999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1166 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 129.49 // Query: XKT77353.1|CBM34|GH13_39 [L=639] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-19 56.9 1.0 1.6e-19 56.9 1.0 1.9 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.9 1.0 1.6e-19 1.6e-19 1 120 [] 6 136 .. 6 136 .. 0.94 2 ? -3.3 0.3 0.7 0.7 82 108 .. 269 297 .. 266 310 .. 0.47 Alignments for each domain: == domain 1 score: 56.9 bits; conditional E-value: 1.6e-19 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFe 77 +yH++ r+pfg++++g+ +++++ + v +V+l+y + ++ e++ +M ++++ +eati + p++++Y+Fe XKT77353.1|CBM34|GH13_39 6 MYHNSfeesyREPFGAAPKGSPVTLKIDISDrYRVSHVILHYILDRTDDEKTKEMDLCSQEHQQVSYEATIRMpeRPQLIWYFFE 90 59*************************9999899************999***********99***********999********* PP CBM34.hmm 78 ledgdekvyygengfs..gegpedl.epasyqgnvfevpyineidv 120 + +d++++yg ++ + geg+ ++ p+s q++v++ y +++++ XKT77353.1|CBM34|GH13_39 91 IILEDQTLFYGREKSYesGEGKVYDhIPPSWQITVYDPSYKTPDWW 136 ************99998899999996677********888877765 PP == domain 2 score: -3.3 bits; conditional E-value: 0.7 CBM34.hmm 82 dekvyygengfsgegpedl.epa.syqgn 108 ++++y++ +g ++ +++ ++ +y ++ XKT77353.1|CBM34|GH13_39 269 SNSIYFNREGKYDSLGAYQsKNSpYYSWY 297 56666666666644333332222222222 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (639 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.09 // Query: WLS67988.1|CBM34|GH13_39 [L=610] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-16 47.0 0.1 1.7e-16 47.0 0.1 1.9 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.0 0.1 1.7e-16 1.7e-16 2 112 .. 7 124 .. 6 130 .. 0.91 2 ? -2.7 0.7 0.44 0.44 83 112 .. 266 295 .. 261 306 .. 0.55 Alignments for each domain: == domain 1 score: 47.0 bits; conditional E-value: 1.7e-16 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 +H++ r+pfg+v++g+++++++ ++k+ v ++l+ d + + ++ M+ke+ + ++ ++++i+ + g l YyF+l WLS67988.1|CBM34|GH13_39 7 MHDSqsivyRRPFGAVEEGQKVKLSIDIEKEIVVAIELLQFDGT---KVNMGMEKEYLNSGNYRYSIEIDTedALGVLGYYFILI 88 799999999************************99999999977...9************************9************ PP CBM34.hmm 80 dgdekvyygengfs..gegpedl.epasyqgnvfev 112 dg ++vyyg+n+++ g g+ + +p yq++ ++ WLS67988.1|CBM34|GH13_39 89 DGYDRVYYGNNDEHlgGIGQIYTyNPVPYQITIYKK 124 **************9999999986666888888874 PP == domain 2 score: -2.7 bits; conditional E-value: 0.44 CBM34.hmm 83 ekvyygengfsgegpedlepasyqgnvfev 112 ++ y+++ g ++e ++++p+s+ +n +++ WLS67988.1|CBM34|GH13_39 266 DSRYFNKAGNYDEIGAYQSPNSKYHNWYKF 295 677888888885555555333333333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (610 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.17 // Query: WGV30055.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-14 40.7 0.1 3.1e-14 39.7 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.7 0.1 3.1e-14 3.1e-14 2 112 .. 3 121 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 39.7 bits; conditional E-value: 3.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M + d + +++ti++ epg++ Y+Fe++ WGV30055.1|CBM34|GH13_39 3 YYNPwnldnKQPFGAIKVGNSMSLSFTTDQPSV-LVTCVIRRDF-GKRYEFSMNR---DS-GGDFRVTIPFdeEPGLYFYHFEIV 81 6777777779********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfev 112 +++ ++ +yg +g+ geg + e++ yq +vfe WGV30055.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEK 121 766677799*********9998887554444566666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.51 // Query: XGU75402.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-16 45.5 0.1 1e-15 44.6 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.6 0.1 1e-15 1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 44.6 bits; conditional E-value: 1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ XGU75402.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRVTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XGU75402.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 99.99 // Query: BFZ33591.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-14 38.3 0.2 1.9e-13 37.2 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.2 0.2 1.9e-13 1.9e-13 2 113 .. 3 122 .. 2 129 .. 0.83 Alignments for each domain: == domain 1 score: 37.2 bits; conditional E-value: 1.9e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k g + ++a++k+ ++g+++YyFe+ + + BFZ33591.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TIKFIIRRDF-GARSEFDMQKLG----GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.9999999999.99********43....678*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +k+yyg +g+ geg ++ e++ yq + f + BFZ33591.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnENDvrPYQATIFSMR 122 4567***********99999886665556666666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.16 // Query: UBK94754.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-17 49.9 0.2 2.3e-17 49.9 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.9 0.2 2.3e-17 2.3e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.9 bits; conditional E-value: 2.3e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK94754.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK94754.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK94754.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 91.18 // Query: XOO32335.1|CBM34|GH13_39 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-14 39.1 3.7 5.1e-14 39.1 3.7 2.4 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.1 3.7 5.1e-14 5.1e-14 2 113 .. 6 125 .. 5 132 .. 0.82 2 ? -1.2 1.8 0.15 0.15 80 113 .. 262 298 .. 259 305 .. 0.61 Alignments for each domain: == domain 1 score: 39.1 bits; conditional E-value: 5.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsde..lfdyweatikl.epgrlrYyFel 78 H++ r+pfg+v++g+++ i++ +k + +V+l+++ + e+ +M e++++ + +y+ + ++ +g+++Y+F++ XOO32335.1|CBM34|GH13_39 6 KHDSrescyRKPFGAVPKGKKVYISITSNK--LLEVYLHLQYFN-YDEKYAKMNVETKENetYLYYYNIDLSQnYTGLINYFFRI 87 5888888999****************9997..5599****9999.568888888877766236777788888799********** PP CBM34.hmm 79 edgd.ekvyygengfs..gegpedl.epasyqgnvfevp 113 + +d + +yyg+n geg+ ++ +p yq++v+e p XOO32335.1|CBM34|GH13_39 88 KLNDdSYIYYGNNSDGlgGEGQVYYnNPVTYQITVYE-P 125 *999788999998776779999999666699999997.4 PP == domain 2 score: -1.2 bits; conditional E-value: 0.15 CBM34.hmm 80 dgdekvyygengfsgegpedl.epa..syqgnvfevp 113 +gd+++y+++ g + + +++ ++ ++ ++++e+p XOO32335.1|CBM34|GH13_39 262 TGDDSIYFNKYGNYNSTGAYQsKDSpyYKWYTFQEYP 298 6789999999999944444443333334445555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.45 // Query: WZL28797.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-14 38.5 0.2 1.7e-13 37.4 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.4 0.2 1.7e-13 1.7e-13 2 113 .. 3 122 .. 2 129 .. 0.83 Alignments for each domain: == domain 1 score: 37.4 bits; conditional E-value: 1.7e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k g + ++a++k+ ++g+++YyFe+ + + WZL28797.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TIKFIIRRDF-GARSEFDMQKLG----GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.9999999999.99********43....678*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +k+yyg +g+ geg ++ e++ yq + f + WZL28797.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnENDvhPYQATIFSMR 122 4567***********99999986555445666666554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.81 // Query: UBK34920.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-17 49.9 0.2 2.3e-17 49.9 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.9 0.2 2.3e-17 2.3e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.9 bits; conditional E-value: 2.3e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK34920.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK34920.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK34920.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.66 // Query: USI67472.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-14 38.7 0.2 1.5e-13 37.5 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.5 0.2 1.5e-13 1.5e-13 2 110 .. 3 115 .. 2 128 .. 0.80 Alignments for each domain: == domain 1 score: 37.5 bits; conditional E-value: 1.5e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k e + ++a++k+ ++g+++YyFe+ + + USI67472.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLQTDKENV-TAKFIIRRDF-GARSEFDMQK---LE-GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.7777777778.79********...23.679*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epasyqgnvf 110 +k+yyg +g+ geg ++ e++ ++ USI67472.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnEND--VRPYQ 115 4567***********99998884443..33333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.04 // Query: WMM06852.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-15 44.3 0.1 2.6e-15 43.2 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.2 0.1 2.6e-15 2.6e-15 2 111 .. 3 120 .. 2 128 .. 0.84 Alignments for each domain: == domain 1 score: 43.2 bits; conditional E-value: 2.6e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ WMM06852.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRITIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfe 111 +++ ++ +yg +g+ geg + e++ yq +vfe WMM06852.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFE 120 766677799*********999888744443345555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.05 // Query: XBC54754.1|CBM34|GH13_39 [L=669] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (669 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 520.69 // Query: UBS42809.1|CBM34|GH13_39 [L=641] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-14 39.2 0.2 4.7e-14 39.2 0.2 2.2 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.2 0.2 4.7e-14 4.7e-14 2 114 .. 2 117 .. 1 123 [. 0.83 2 ? -0.9 0.3 0.12 0.12 80 108 .. 262 292 .. 259 303 .. 0.71 Alignments for each domain: == domain 1 score: 39.2 bits; conditional E-value: 4.7e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 H++ r+p g+v +g+++++rL + + V+l++ ++ +++ M+ ++e+ i++ + +l+YyF+++ UBS42809.1|CBM34|GH13_39 2 IHNAsieqyREPVGAVTKGEEVKLRLFALEGTAVTVELVLYSED--YHKTFSMRE-----KKGFYECIIEMpeKACILWYYFRIT 79 57777788899*******************99999999887777..589****99.....457********8778899******* PP CBM34.hmm 80 dgdekvyygengfs..gegpedlepa.syqgnvfevpy 114 +g+ ++yyg++ + geg +e+ + q++v+e + UBS42809.1|CBM34|GH13_39 80 EGNYTYYYGARPGRtcGEGIRVEEDVrGFQITVYERGF 117 **********9988665655555444599999998766 PP == domain 2 score: -0.9 bits; conditional E-value: 0.12 CBM34.hmm 80 dgdekvyygengfsgegpedl.epa.syqgn 108 +g +++y+++ng ++ +++ ++ +y ++ UBS42809.1|CBM34|GH13_39 262 TGADSLYFNKNGNYKSVGAYQsQDSpYYDWY 292 4558899999999977777775555455444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (641 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.41 // Query: XIE82297.1|CBM34|GH13_39 [L=611] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-10 28.3 0.1 2.8e-10 27.0 0.1 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.0 0.1 2.8e-10 2.8e-10 5 90 .. 8 97 .. 4 128 .. 0.78 Alignments for each domain: == domain 1 score: 27.0 bits; conditional E-value: 2.8e-10 CBM34.hmm 5 p.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFeledgd.ek 84 + ++pfg++++g++++ ++r+ ++v++V + + + + +++ +p+++ +d + d ++ +ik+ + g++ YyF+++ ++ XIE82297.1|CBM34|GH13_39 8 AwqlefKQPFGALQAGNNVQFSVRVDCQNVTQVAVGVTKLD-ENTVFYPLTQ-DED-ESDKYTGEIKItTSGLYHYYFRVRRENdAA 91 45555689******************************999.6799999999.333.48**********************888366 PP CBM34.hmm 85 vyygen 90 +y+g XIE82297.1|CBM34|GH13_39 92 LYLGHL 97 665554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (611 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.76 // Query: WXA37451.1|CBM34|GH13_39|GH77 [L=1171] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-21 63.2 0.0 3.8e-21 62.1 0.0 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.1 0.0 3.8e-21 3.8e-21 1 111 [. 6 131 .. 6 140 .. 0.89 Alignments for each domain: == domain 1 score: 62.1 bits; conditional E-value: 3.8e-21 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkdd......vksVtlrygdpywseeeelpMkkegsdelfdyweatikl.. 67 i+H++ rspfg++ + +++++rL t + + + + lr++++ +e l+M+ +++++ +ea++++ WXA37451.1|CBM34|GH13_39|GH77 6 IFHDShnkdfRSPFGAAACYTEITLRLLTVNTKrqgelpAETADLRLWQEG-AGEILLDMQLVREEQGRRLYEASFTApg 84 78999999*******************76664445667799**********.77************************** PP CBM34.hmm 68 epgrlrYyFeledgdekvyygengfs..gegpedl.epasyqgnvfe 111 +pg ++YyF+++ g++++yyg+n ++ g+g+ + p+syq++ + WXA37451.1|CBM34|GH13_39|GH77 85 NPGVIWYYFIIRRGEQTFYYGNNAAElgGVGQLLSyPPPSYQISTYL 131 **************************999999988666699998885 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1171 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 144.58 // Query: XLD74692.1|CBM34|GH13_29 [L=645] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-11 29.6 0.0 1.4e-10 28.0 0.0 1.9 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.0 0.0 1.4e-10 1.4e-10 6 112 .. 23 138 .. 13 146 .. 0.81 Alignments for each domain: == domain 1 score: 28.0 bits; conditional E-value: 1.4e-10 CBM34.hmm 6 rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegs....delfdyweatikl..epgrlrYyFeledgd. 82 + pfg+ ++g++++ + t+k ++ ++l++++ e++M e++ d+++ +w+ +++ +++ Y+F++ g+ XLD74692.1|CBM34|GH13_29 23 KTPFGATPCGENIKFNILTQKnINCLGINLIIKNGK---ILEFKMLPEAEkkigDHDYIVWSLNFTTpsLAKTIFYHFKISIGNe 104 78*******************656669999999987...677777777774444778999*****999999**********6665 PP CBM34.hmm 83 .ekvyygengfs..gegpedlepa.syqgnvfev 112 + +yyg+n + g g+ +++++ +yq++ + XLD74692.1|CBM34|GH13_29 105 nTIFYYGNNSLAlgGRGDIYENFPiDYQITLYYK 138 788999***9999888888886666888887754 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (645 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 106.08 // Query: UXV68888.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ UXV68888.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe UXV68888.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.59 // Query: WBM78100.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.2 0.1 2.1e-14 40.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.3 0.1 2.1e-14 2.1e-14 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 40.3 bits; conditional E-value: 2.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ e g++ Y+Fe++ WBM78100.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMNLSFTTDRPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRVTIPFdeESGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe WBM78100.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.57 // Query: WYC86852.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-14 38.9 0.2 1.3e-13 37.7 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.7 0.2 1.3e-13 1.3e-13 2 110 .. 3 115 .. 2 126 .. 0.80 Alignments for each domain: == domain 1 score: 37.7 bits; conditional E-value: 1.3e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k +d+ +++++k+ ++g+++YyFe+ + + WYC86852.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TAKFIIRRDF-GARSEFDMQK-LEDG---IFSVSVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.7777777778.79********.6777...8999999999***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epasyqgnvf 110 +k+yyg +g+ geg ++ e++ ++ WYC86852.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnEND--VRPYQ 115 4567***********99998884433..33333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.03 // Query: XKE09604.1|CBM34|GH13_29 [L=645] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-11 29.6 0.0 1.4e-10 28.0 0.0 1.9 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.0 0.0 1.4e-10 1.4e-10 6 112 .. 23 138 .. 13 146 .. 0.81 Alignments for each domain: == domain 1 score: 28.0 bits; conditional E-value: 1.4e-10 CBM34.hmm 6 rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegs....delfdyweatikl..epgrlrYyFeledgd. 82 + pfg+ ++g++++ + t+k ++ ++l++++ e++M e++ d+++ +w+ +++ +++ Y+F++ g+ XKE09604.1|CBM34|GH13_29 23 KTPFGATPCGENIKFNILTQKnINCLGINLIIKNGK---ILEFKMLPEAEkkigDHDYIVWSLNFTTpsLAKTIFYHFKISIGNe 104 78*******************656669999999987...677777777774444778999*****999999**********6665 PP CBM34.hmm 83 .ekvyygengfs..gegpedlepa.syqgnvfev 112 + +yyg+n + g g+ +++++ +yq++ + XKE09604.1|CBM34|GH13_29 105 nTIFYYGNNSLAlgGRGDIYENFPiDYQITLYYK 138 788999***9999888888886666888887754 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (645 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.16 // Query: BFU39085.1|CBM34|GH13_39|GH77 [L=1211] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-20 59.7 2.9 5.4e-20 58.3 0.0 3.0 3 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.3 0.0 5.4e-20 5.4e-20 3 114 .. 8 158 .. 6 162 .. 0.91 2 ? -3.9 0.3 1 1 71 87 .. 323 339 .. 315 360 .. 0.67 3 ? -0.1 0.0 0.071 0.071 69 93 .. 914 938 .. 892 953 .. 0.81 Alignments for each domain: == domain 1 score: 58.3 bits; conditional E-value: 5.4e-20 CBM34.hmm 3 Hrp....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdel..................... 57 H + r+pfg+v +g++++irL+t v++++lr++++ ++e+ +pM+ + +++ BFU39085.1|CBM34|GH13_39|GH77 8 HSQnrvyREPFGAVVCGQKVVIRLQTS-ATVEQCWLRVWETESEREKLIPMHIQNQSDFdpctgtlnqgillkrgsdsid 86 444788899******************.69************999********88877668889999999999999999* PP CBM34.hmm 58 ..........fdyweatikl..epgrlrYyFeledgdekvyygengfs..gegpedl.epasyqgnvfevpy 114 ++e +++ pg+++YyF ++ +++++yyg+n+++ g g+ + +p+s q++v++ + BFU39085.1|CBM34|GH13_39|GH77 87 seddwdlessSIWFEGEFNTpaLPGLIWYYFVFKVEGQQFYYGNNEEQlgGIGQVKGeQPPSWQITVYNPMQ 158 *********9999*****99999**************************999999998888*******8655 PP == domain 2 score: -3.9 bits; conditional E-value: 1 CBM34.hmm 71 rlrYyFeledgdekvyy 87 +Y+F+ +++ k + BFU39085.1|CBM34|GH13_39|GH77 323 YAWYRFKPGTHEYKSWW 339 57999998777744443 PP == domain 3 score: -0.1 bits; conditional E-value: 0.071 CBM34.hmm 69 pgrlrYyFeledgdekvyygengfs 93 ++ l+Y+F +++++ k y ++++ BFU39085.1|CBM34|GH13_39|GH77 914 QRFLQYTFYVQWQELKSYAASKNIK 938 6779*********977776666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1211 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 129.34 // Query: XBG94776.1|CBM34|GH13_39 [L=611] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-09 23.1 0.1 1.1e-08 21.8 0.1 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.8 0.1 1.1e-08 1.1e-08 5 100 .. 8 107 .. 4 128 .. 0.77 Alignments for each domain: == domain 1 score: 21.8 bits; conditional E-value: 1.1e-08 CBM34.hmm 5 p.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFeledgd. 82 + ++pfg++++g++++ ++++ ++v++V + + + + +++ +p+++ + + ++ +ik+ + g++ YyF+++ ++ XBG94776.1|CBM34|GH13_39 8 AwqlefKQPFGALQAGNNVQFSVKVDCQNVTQVAVGVTKLD-ENTVFYPLTQDENEP--GKYTGEIKItTSGLYHYYFRVRRENd 89 45555689******************************999.779999999977777..899******99***********8774 PP CBM34.hmm 83 ekvyygengfsgegpedl 100 +y+g + +++++ XBG94776.1|CBM34|GH13_39 90 AALYLGHLHGGTGKETTD 107 666666655554444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (611 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.38 // Query: EHG18778.1|CBM34|GH13_39|GH77 [L=1149] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-16 46.6 0.1 2.4e-16 46.6 0.1 2.5 4 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.6 0.1 2.4e-16 2.4e-16 3 119 .. 9 134 .. 7 135 .. 0.87 2 ? -4.0 0.6 1 1 82 117 .. 268 304 .. 265 308 .. 0.49 3 ? -2.4 0.0 0.35 0.35 28 66 .. 454 504 .. 451 511 .. 0.67 4 ? -3.3 0.0 0.67 0.67 73 93 .. 844 864 .. 840 876 .. 0.80 Alignments for each domain: == domain 1 score: 46.6 bits; conditional E-value: 2.4e-16 CBM34.hmm 3 Hrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrY 74 H++ rs g++++g++l++ +r+ + +++V +r+++++ +e +p++ ++++ ++++a ++l +++Y EHG18778.1|CBM34|GH13_39|GH77 9 HNSqniyyRSIVGAAEAGSRLRLGIRIRTyETIQQVLVRLWQDQ-TGERLIPLETRDTQGEQKFYTAWFNLpdYGCLVWY 87 6666677788999********9999999989*************.77************************9444468** PP CBM34.hmm 75 yFeledgdekvyygengfs..gegpedl.epasyqgnvfevpyineid 119 yF +++++ +++yg+n + g+g ++ p syq++ ++ +++d EHG18778.1|CBM34|GH13_39|GH77 88 YFVITTESGTYFYGNNAEMlgGVGALSMeAPSSYQITIYNK-GAHTPD 134 *****************9999999999955559**999974.455555 PP == domain 2 score: -4.0 bits; conditional E-value: 1 CBM34.hmm 82 dekvyygengfsgegpedl.epa.syqgnvfevpyine 117 ++++y++ + ++ +++ ++ +y ++ f+ +y ne EHG18778.1|CBM34|GH13_39|GH77 268 SNSIYFNRQHQYRSIGAYQsKESpYYSWYHFR-NYPNE 304 56667776666644444443333244444443.55554 PP == domain 3 score: -2.4 bits; conditional E-value: 0.35 CBM34.hmm 28 dvk.sVtlrygdpy.....wseeeelpMkkegsdel......fdyweatik 66 dv+ +t++ g py e+ ++ M+ e+ d + w++t++ EHG18778.1|CBM34|GH13_39|GH77 454 DVQrAITVLAGVPYyegmpAIEQSRVRMTDEQFDLGmrrllmATLWQMTYP 504 555357888899998998867778888888766553344444667777766 PP == domain 4 score: -3.3 bits; conditional E-value: 0.67 CBM34.hmm 73 rYyFeledgdekvyygengfs 93 +Y F l+++ + y ++g++ EHG18778.1|CBM34|GH13_39|GH77 844 QYIFHLQWNRLHDYARKKGIE 864 7*******9988888777776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1149 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 128.49 // Query: WMM19352.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-15 44.3 0.1 2.6e-15 43.2 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.2 0.1 2.6e-15 2.6e-15 2 111 .. 3 120 .. 2 128 .. 0.84 Alignments for each domain: == domain 1 score: 43.2 bits; conditional E-value: 2.6e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ WMM19352.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRITIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfe 111 +++ ++ +yg +g+ geg + e++ yq +vfe WMM19352.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFE 120 766677799*********999888744443345555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.68 // Query: UOQ45022.1|CBM34|GH13_39 [L=638] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.5e-20 57.5 4.5 9.5e-20 57.5 4.5 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 57.5 4.5 9.5e-20 9.5e-20 1 120 [] 6 136 .. 6 136 .. 0.94 2 ? -0.3 0.9 0.078 0.078 80 113 .. 267 303 .. 264 310 .. 0.63 Alignments for each domain: == domain 1 score: 57.5 bits; conditional E-value: 9.5e-20 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFe 77 iyH++ r+pfg++++g+++ +++ + + +v +V l+y + +ee + +M +++++ +e ti++ ep++++YyFe UOQ45022.1|CBM34|GH13_39 6 IYHNSfdlkyREPFGAAPKGSNVFLTIDIHHqYQVSRVVLHYIFDSVDEEHTKEMDLYSEEHQHHSFETTITVpeEPQLVWYYFE 90 89*****************************99*************999************************************ PP CBM34.hmm 78 ledgdekvyygengfs..gegpedl.epasyqgnvfevpyineidv 120 +++++ ++yyg ++++ geg ++ p+s q++v++ y +++++ UOQ45022.1|CBM34|GH13_39 91 INTEEATYYYGRENIEesGEGLIYSqVPPSWQITVYDDEYKTPKWW 136 ****************7777777885566*******9999888776 PP == domain 2 score: -0.3 bits; conditional E-value: 0.078 CBM34.hmm 80 dgdekvyygengfsgegpedl..epasyq.gnvfevp 113 +g++++y++++g+++ +++ e ++y+ ++++++p UOQ45022.1|CBM34|GH13_39 267 TGSNSIYFNQKGEYDSLGAYQskESPYYPwYTFYNYP 303 677999********55555543334455514455555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (638 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.70 // Query: XOE05346.1|CBM34|GH13_39 [L=623] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-12 34.1 1.4 3.6e-12 33.1 1.4 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.1 1.4 3.6e-12 3.6e-12 6 116 .. 14 124 .. 4 131 .. 0.86 Alignments for each domain: == domain 1 score: 33.1 bits; conditional E-value: 3.6e-12 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatiklepgrlrYyFeledgd.ekvyyge 89 + pfg+v+++ ++++ + +d+ +V+l++ +++ + e+++ M+k+++ + +e ++ ++g++ Y+Fe++++ ++v+ + XOE05346.1|CBM34|GH13_39 14 KHPFGAVKENGLARLSIEVIAEDILQVYLVMHKDH-QPEQRIFMEKQEE--GLYSYEYFFNQGKGLYFYHFEVHTKVnDQVFIEY 95 78********************************9.88********444..35778888899************99989999999 PP CBM34.hmm 90 ngfsgegpedl.epa.syqgnvfevpyin 116 g+s++g e++ ++ + + +++++y++ XOE05346.1|CBM34|GH13_39 96 YGASEQGGEGRlYDRpATIWDFQITCYQS 124 99998888888888879999999988875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (623 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.37 // Query: XER10006.1|CBM34|GH13_39|GH77 [L=1168] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-19 54.6 0.0 1.5e-18 53.7 0.0 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.7 0.0 1.5e-18 1.5e-18 2 112 .. 7 128 .. 6 136 .. 0.88 Alignments for each domain: == domain 1 score: 53.7 bits; conditional E-value: 1.5e-18 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkdd..vksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrl 72 +H++ rspfg+v + +++++ + ++ + + V lr++++ +e+ l+M +++ + y+ea i++ pg + XER10006.1|CBM34|GH13_39|GH77 7 LHDShdadfRSPFGAVACHSKIRLAISLTSEApwAEAVLLRLWREG-VGETVLDMPFVREAYGCRYYEAVITApaSPGVI 85 677777799*********999999886666443489**********.77************************9****** PP CBM34.hmm 73 rYyFeledgdekvyygengfs..gegpedl.epasyqgnvfev 112 +YyF+++ ++ +yyg+n + g+g+ ++ p+syq++ + XER10006.1|CBM34|GH13_39|GH77 86 WYYFIVRRNGLMYYYGNNAAAtgGVGQITDyPPPSYQISTYLP 128 *********************99*******6666999998854 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1168 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 139.02 // Query: WYC79984.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-14 38.5 0.2 1.7e-13 37.4 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.4 0.2 1.7e-13 1.7e-13 2 115 .. 3 124 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 37.4 bits; conditional E-value: 1.7e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k g + ++a++k+ ++g+++YyFe+ + + WYC79984.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TIKFIIRRDF-GARSEFDMQKLG----GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.9999999999.99********43....678*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvfevpyi 115 +k+yyg +g+ geg ++ e++ yq + f + + WYC79984.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnENDvrPYQATIFSMRDV 124 4567***********9999998766655677777766555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.16 // Query: WLR48641.1|CBM34|GH13_39 [L=639] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-20 58.0 1.4 6.9e-20 58.0 1.4 1.9 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.0 1.4 6.9e-20 6.9e-20 1 120 [] 6 136 .. 6 136 .. 0.94 2 ? -3.5 0.3 0.78 0.78 81 108 .. 268 297 .. 266 309 .. 0.49 Alignments for each domain: == domain 1 score: 58.0 bits; conditional E-value: 6.9e-20 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFe 77 +yH++ r+pfg++++g+ +++++ + v +V+l+y + ++ e++ +M ++++ +eati + +p++++Y+Fe WLR48641.1|CBM34|GH13_39 6 MYHNSfeesyREPFGAAPKGSPVTLKIDLSDrYRVSHVILHYILDRTDDEKTKEMDLCSQEHQQVSYEATIRMpeTPQLIWYFFE 90 59*************************9998899************999***********99*********************** PP CBM34.hmm 78 ledgdekvyygengfs..gegpedl.epasyqgnvfevpyineidv 120 ++ +d++++yg ++ + geg+ ++ p+s q++v++ y +++++ WLR48641.1|CBM34|GH13_39 91 ITLEDQTLFYGREKSYesGEGKVYDhIPPSWQITVYDSSYKTPDWW 136 ************99998899999996677********999888776 PP == domain 2 score: -3.5 bits; conditional E-value: 0.78 CBM34.hmm 81 gdekvyygengfsgegpedl.epa.syqgn 108 g++++y++ +g ++ +++ ++ +y ++ WLR48641.1|CBM34|GH13_39 268 GSNSIYFNREGKYDSLGAYQsKNSpYYSWY 297 556677777777744444442222233322 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (639 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.60 // Query: BDC90432.1|CBM34|GH13_39|GH77 [L=1168] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-13 37.3 0.0 3.7e-13 36.3 0.0 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.3 0.0 3.7e-13 3.7e-13 2 116 .. 4 128 .. 3 132 .. 0.90 Alignments for each domain: == domain 1 score: 36.3 bits; conditional E-value: 3.7e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsde.lfdyweatikl.epgrlrY 74 +H++ r+p g++ g +++++ ++ d +++t+r++ + ++e pM+ e+ e + ++++ + g+l+Y BDC90432.1|CBM34|GH13_39|GH77 4 FHDSrgsryRNPGGAALVGGVVTLKIDVWDDPGTQATIRTWVDG-EGEAFWPMELEERAEdGRLTFAGQLPCeALGILWY 82 7999999999**********************************.789999***98886635788999************ PP CBM34.hmm 75 yFeledgd.ekvyygengfs..gegpedl.epasyqgnvfevpyin 116 F le++d + yyg+++ + g+g++++ p+s q++v++ ++ BDC90432.1|CBM34|GH13_39|GH77 83 AFLLEGSDgVVRYYGAREGRtgGVGQMYDyMPPSFQITVYHQREVT 128 *****9999********99999*******88889999999866555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1168 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 139.13 // Query: WEV45039.1|CBM34|GH13_39 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 471.21 // Query: XOD65201.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-13 37.6 0.1 3.3e-13 36.5 0.1 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.5 0.1 3.3e-13 3.3e-13 2 110 .. 3 115 .. 2 128 .. 0.81 Alignments for each domain: == domain 1 score: 36.5 bits; conditional E-value: 3.3e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L++ k++v ++ ++ +++ + + e++M+k e + ++a++k+ ++g+++YyFe+ +++ XOD65201.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLQIDKENV-TAKFIIRRDF-GARSEFDMQK---LE-GGIFSASVKFdvGQGLYYYYFEISEST 84 5666666779***********************.7777777778.79********...23.679*******99***********9665 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epasyqgnvf 110 +k+yyg +g+ geg ++ e++ ++ XOD65201.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnEND--VRPYQ 115 5888***********99998884443..33333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.39 // Query: UBK83602.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-17 49.3 0.3 3.5e-17 49.3 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.3 0.3 3.5e-17 3.5e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -2.0 1.4 0.27 0.27 80 113 .. 263 299 .. 260 306 .. 0.56 Alignments for each domain: == domain 1 score: 49.3 bits; conditional E-value: 3.5e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++ +pM+ e+ +++ ++ i+ g ++YyF+ UBK83602.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYLIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK83602.1|CBM34|GH13_39 88 IKDEFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -2.0 bits; conditional E-value: 0.27 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevp 113 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK83602.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYNWYRFYDYP 299 5667788888888855555542223334444555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 91.81 // Query: WEV22207.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-17 49.8 0.3 2.4e-17 49.8 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.8 0.3 2.4e-17 2.4e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.8 bits; conditional E-value: 2.4e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ WEV22207.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e WEV22207.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p WEV22207.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.13 // Query: BDW51710.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-14 39.2 0.2 1e-13 38.1 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.1 0.2 1e-13 1e-13 2 110 .. 3 119 .. 2 128 .. 0.80 Alignments for each domain: == domain 1 score: 38.1 bits; conditional E-value: 1e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k +d+ +++++k+ ++g+++YyFe+ + + BDW51710.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TAKFIIRRDF-GARSEFDMQK-LEDG---IFSVSVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.7777777778.79********.6777...8999999999***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvf 110 +k+yyg +g+ geg ++ e++ yq + f BDW51710.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnENDvrPYQATIF 119 4567***********99999885444333444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.09 // Query: UYX10350.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-17 49.6 0.3 2.8e-17 49.6 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.6 0.3 2.8e-17 2.8e-17 1 113 [. 6 125 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.6 bits; conditional E-value: 2.8e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UYX10350.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfevp 113 +++ + yyg+n+++ geg+ +++++ +yq++v+e + UYX10350.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGNIYYDFPnYYQITVYEDN 125 ***************99999999955559999999755 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UYX10350.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 90.98 // Query: URW74292.1|CBM34|GH13_39 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-11 31.3 1.9 2.7e-11 30.3 1.9 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.3 1.9 2.7e-11 2.7e-11 6 110 .. 13 114 .. 3 123 .. 0.79 Alignments for each domain: == domain 1 score: 30.3 bits; conditional E-value: 2.7e-11 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFeledgdekvyyge 89 +spfg++++++t++ r+++ + v+ ++l++ + ++ +pMkk+ + + +++++++ + g++ YyFe++++++ yy+e URW74292.1|CBM34|GH13_39 13 KSPFGAIKARTTVTWRVKID-EPVDYINLWLTKAE-ETPVPYPMKKTDE----QTYQVQVTIgTSGLYHYYFEIKQSNQISYYQE 91 89*****************9.799*********99.8899******444....66***********************9999998 PP CBM34.hmm 90 ngfs.gegpedlepa.syqgnvf 110 ge +++++ +yq +++ URW74292.1|CBM34|GH13_39 92 ALGGeGELVTSNQNLaQYQLTCY 114 65542333333334446666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 107.91 // Query: WEV19141.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-17 48.2 0.3 7.7e-17 48.2 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 48.2 0.3 7.7e-17 7.7e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 48.2 bits; conditional E-value: 7.7e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL ++ ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ WEV19141.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSIGSKVSLRLECE--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89***************************9..68889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e WEV19141.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p WEV19141.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.39 // Query: XFC11496.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-16 45.5 0.1 1e-15 44.6 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.6 0.1 1e-15 1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 44.6 bits; conditional E-value: 1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ XFC11496.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRVTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XFC11496.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.80 // Query: UUR86967.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-17 49.4 0.3 3.2e-17 49.4 0.3 2.1 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.4 0.3 3.2e-17 3.2e-17 1 113 [. 6 125 .. 6 130 .. 0.92 2 ? -3.5 1.2 0.76 0.76 84 114 .. 267 300 .. 262 306 .. 0.47 Alignments for each domain: == domain 1 score: 49.4 bits; conditional E-value: 3.2e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UUR86967.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfevp 113 +++ + yyg+n+++ geg+ +++++ +yq++v+e + UUR86967.1|CBM34|GH13_39 88 IKDGFTNYYGNNDEClgGEGKIYYDFPnYYQITVYEDN 125 ***************99999999955559999999755 PP == domain 2 score: -3.5 bits; conditional E-value: 0.76 CBM34.hmm 84 kvyygengfsgegpedl..epa.syqgnvfevpy 114 + y+++ + +ge +++ + + ++ ++++++p UUR86967.1|CBM34|GH13_39 267 SRYFNKYRNYGELGAYEskYSKyYKWYRFYDYPN 300 5555555555333333322233344455566554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.97 // Query: XCJ16280.1|CBM34|GH13_39 [L=624] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-10 28.1 0.2 3.1e-10 26.8 0.2 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.8 0.2 3.1e-10 3.1e-10 2 100 .. 7 116 .. 6 133 .. 0.74 Alignments for each domain: == domain 1 score: 26.8 bits; conditional E-value: 3.1e-10 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y ++ r+pfg v+ g+++h + + +v++V+l+++++ + ++Mk ++ ++++++ + g++ Y+F++e XCJ16280.1|CBM34|GH13_39 7 YFNSwsetyRKPFGTVQIGQSVHFAIDVPLAEVEHVFLVIKKDG-LDFQHVEMKLDSENP--FRFQISFSTdaPAGLYFYHFQIE 88 66666667799*********************************.56********88888..67888888899***********8 PP CBM34.hmm 80 ..dgd....ekvyygengfs...gegpedl 100 + + ++vyy ++ + geg+e + XCJ16280.1|CBM34|GH13_39 89 yrN-EkgtrKTVYY-AKSADnfgGEGRELD 116 541.2346445555.444441334444433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (624 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.96 // Query: XOW16497.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XOW16497.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XOW16497.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 96.79 // Query: XOW18501.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-15 44.3 0.1 2.4e-15 43.4 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.4 0.1 2.4e-15 2.4e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 43.4 bits; conditional E-value: 2.4e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t++ +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XOW18501.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATAQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XOW18501.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.67 // Query: XQO22168.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XQO22168.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XQO22168.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.51 // Query: URW70491.1|CBM34|GH13_39 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-11 31.3 1.9 2.7e-11 30.3 1.9 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.3 1.9 2.7e-11 2.7e-11 6 110 .. 13 114 .. 3 123 .. 0.79 Alignments for each domain: == domain 1 score: 30.3 bits; conditional E-value: 2.7e-11 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFeledgdekvyyge 89 +spfg++++++t++ r+++ + v+ ++l++ + ++ +pMkk+ + + +++++++ + g++ YyFe++++++ yy+e URW70491.1|CBM34|GH13_39 13 KSPFGAIKARTTVTWRVKID-EPVDYINLWLTKAE-ETPVPYPMKKTDE----QTYQVQVTIgTSGLYHYYFEIKQSNQISYYQE 91 89*****************9.799*********99.8899******444....66***********************9999998 PP CBM34.hmm 90 ngfs.gegpedlepa.syqgnvf 110 ge +++++ +yq +++ URW70491.1|CBM34|GH13_39 92 ALGGeGELVTSNQNLaQYQLTCY 114 65542333333334446666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.43 // Query: UYC93101.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-17 49.2 0.2 3.7e-17 49.2 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.2 0.2 3.7e-17 3.7e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -2.0 1.4 0.27 0.27 80 113 .. 263 299 .. 260 306 .. 0.56 Alignments for each domain: == domain 1 score: 49.2 bits; conditional E-value: 3.7e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++ +pM+ e+ +++ ++ i+ g ++YyF+ UYC93101.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYLIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UYC93101.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -2.0 bits; conditional E-value: 0.27 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevp 113 +g+++ y+++ g +ge +++ + + ++ ++++++p UYC93101.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYNWYRFYDYP 299 5667788888888855555542223334444555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.22 // Query: XHM45054.1|CBM34|GH13_39 [L=610] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-12 32.1 0.9 1.7e-11 30.9 0.9 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.9 0.9 1.7e-11 1.7e-11 1 117 [. 4 131 .. 4 134 .. 0.82 Alignments for each domain: == domain 1 score: 30.9 bits; conditional E-value: 1.7e-11 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpy.wseeeelpMkkegsdelfdyweatiklepgrlrYyFele 79 iy +p ++pfg+v++g ++ + L + + ++V+l++ ++ s++ +pM+ ++++ +++ t++ + g++ YyF+++ XHM45054.1|CBM34|GH13_39 4 IYFNPwieryKQPFGAVQEGMKIDLWLSVPEPENTQVFLIVRKEGsSSGQRVFPMEAVAEER--FHFQTTMNQGWGLYFYYFKVV 86 57777777779********************************99988899******88887..899*****************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevpyine 117 ++ + yyg ++ geg+ + e++ yq ++++ p + + XHM45054.1|CBM34|GH13_39 87 RETngyeTIQYYGFKDQGGEGKIYGsEQEvlPYQLTCYQKPEVAP 131 555458666788877777777766654444688888888887665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (610 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.14 // Query: XLD83381.1|CBM34|GH13_29 [L=645] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-11 29.6 0.0 1.4e-10 28.0 0.0 1.9 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.0 0.0 1.4e-10 1.4e-10 6 112 .. 23 138 .. 13 146 .. 0.81 Alignments for each domain: == domain 1 score: 28.0 bits; conditional E-value: 1.4e-10 CBM34.hmm 6 rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegs....delfdyweatikl..epgrlrYyFeledgd. 82 + pfg+ ++g++++ + t+k ++ ++l++++ e++M e++ d+++ +w+ +++ +++ Y+F++ g+ XLD83381.1|CBM34|GH13_29 23 KTPFGATPCGENIKFNILTQKnINCLGINLIIKNGK---ILEFKMLPEAEkkigDHDYIVWSLNFTTpsLAKTIFYHFKISIGNe 104 78*******************656669999999987...677777777774444778999*****999999**********6665 PP CBM34.hmm 83 .ekvyygengfs..gegpedlepa.syqgnvfev 112 + +yyg+n + g g+ +++++ +yq++ + XLD83381.1|CBM34|GH13_29 105 nTIFYYGNNSLAlgGRGDIYENFPiDYQITLYYK 138 788999***9999888888886666888887754 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (645 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.24 // Query: UBK86076.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-17 50.7 0.4 1.2e-17 50.7 0.4 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 50.7 0.4 1.2e-17 1.2e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 50.7 bits; conditional E-value: 1.2e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ ++f ++ i+ g ++YyF+ UBK86076.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNEFIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK86076.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK86076.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.00 // Query: WOF41468.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-16 45.6 0.1 1e-15 44.6 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.6 0.1 1e-15 1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 44.6 bits; conditional E-value: 1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ WOF41468.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRVTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe WOF41468.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.53 // Query: XON33176.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-14 38.5 0.2 1.7e-13 37.4 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.4 0.2 1.7e-13 1.7e-13 2 115 .. 3 124 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 37.4 bits; conditional E-value: 1.7e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k g + ++a++k+ ++g+++YyFe+ + + XON33176.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TIKFIIRRDF-GARSEFDMQKLG----GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.9999999999.99********43....678*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvfevpyi 115 +k+yyg +g+ geg ++ e++ yq + f + + XON33176.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnENDvrPYQATIFSMRDV 124 4567***********9999998766655677777766555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.32 // Query: WMM00998.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.2 0.1 2.1e-14 40.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.3 0.1 2.1e-14 2.1e-14 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 40.3 bits; conditional E-value: 2.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ e g++ Y+Fe++ WMM00998.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMNLSFTTDRPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRVTIPFdeESGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe WMM00998.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 91.95 // Query: UBK80719.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-17 49.9 0.2 2.3e-17 49.9 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.9 0.2 2.3e-17 2.3e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.9 bits; conditional E-value: 2.3e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK80719.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK80719.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK80719.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.93 // Query: UBK63592.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-17 48.2 0.3 7.7e-17 48.2 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 48.2 0.3 7.7e-17 7.7e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -2.1 1.5 0.3 0.3 81 114 .. 264 300 .. 261 311 .. 0.59 Alignments for each domain: == domain 1 score: 48.2 bits; conditional E-value: 7.7e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL ++ ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK63592.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSIGSKVSLRLECE--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89***************************9..68889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK63592.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -2.1 bits; conditional E-value: 0.3 CBM34.hmm 81 gdekvyygengfsgegpedl..epa.syqgnvfevpy 114 g+++ y+++ g +ge +++ + + ++ ++++++p UBK63592.1|CBM34|GH13_39 264 GSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 5677788777777554444422334344455666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.75 // Query: UBK26422.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-17 50.7 0.2 1.2e-17 50.7 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 50.7 0.2 1.2e-17 1.2e-17 1 114 [. 6 126 .. 6 130 .. 0.93 2 ? -2.0 1.4 0.27 0.27 80 113 .. 263 299 .. 260 306 .. 0.56 Alignments for each domain: == domain 1 score: 50.7 bits; conditional E-value: 1.2e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK26422.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfevpy 114 +++ + yyg+n+++ geg+ +++++ +yq++v+e + UBK26422.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYENNK 126 ***************999999999555599999998765 PP == domain 2 score: -2.0 bits; conditional E-value: 0.27 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevp 113 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK26422.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYNWYRFYDYP 299 5667788888888855555542223334444555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 103.78 // Query: WFD97855.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-17 49.2 0.2 3.7e-17 49.2 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.2 0.2 3.7e-17 3.7e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -2.0 1.4 0.27 0.27 80 113 .. 263 299 .. 260 306 .. 0.56 Alignments for each domain: == domain 1 score: 49.2 bits; conditional E-value: 3.7e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++ +pM+ e+ +++ ++ i+ g ++YyF+ WFD97855.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYLIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e WFD97855.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -2.0 bits; conditional E-value: 0.27 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevp 113 +g+++ y+++ g +ge +++ + + ++ ++++++p WFD97855.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYNWYRFYDYP 299 5667788888888855555542223334444555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.05 // Query: USI64997.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-14 38.7 0.2 1.5e-13 37.5 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.5 0.2 1.5e-13 1.5e-13 2 110 .. 3 115 .. 2 128 .. 0.80 Alignments for each domain: == domain 1 score: 37.5 bits; conditional E-value: 1.5e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k e + ++a++k+ ++g+++YyFe+ + + USI64997.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLQTDKENV-TAKFIIRRDF-GARSEFDMQK---LE-GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.7777777778.79********...23.679*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epasyqgnvf 110 +k+yyg +g+ geg ++ e++ ++ USI64997.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnEND--VRPYQ 115 4567***********99998884443..33333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.72 // Query: QYH54795.1|CBM34|GH13_39 [L=613] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-13 38.0 0.2 2.6e-13 36.8 0.2 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.8 0.2 2.6e-13 2.6e-13 6 119 .. 14 133 .. 4 134 .. 0.83 Alignments for each domain: == domain 1 score: 36.8 bits; conditional E-value: 2.6e-13 CBM34.hmm 6 rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFele..dgd...e 83 ++pfg+v++++ ++i Lr+ + + sV+l++ ++ + ++e++p++ ++ ++at+++ + g+++YyF+++ d QYH54795.1|CBM34|GH13_39 14 KKPFGAVQAKQPVTINLRLVIeQPLLSVELMVHPDRQMTSENYPLHLVAA----GIYQATFTPtKAGLYYYYFKIViqH-DdqqA 93 89****************99978899**********9999*******665....57******************98531.24345 PP CBM34.hmm 84 kvyyg..engfsgegpedl.epa.syqgnvfevpyineid 119 +++yg ++gf g+g+ + ++ syq ++++ p +++++ QYH54795.1|CBM34|GH13_39 94 VYFYGaaDDGFGGPGRLTTiDNLkSYQLTCYQKPAVSPEW 133 556653368888******999999********99988766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (613 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.92 // Query: UMU17804.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-15 44.3 0.1 2.6e-15 43.2 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.2 0.1 2.6e-15 2.6e-15 2 111 .. 3 120 .. 2 128 .. 0.84 Alignments for each domain: == domain 1 score: 43.2 bits; conditional E-value: 2.6e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ UMU17804.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRITIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfe 111 +++ ++ +yg +g+ geg + e++ yq +vfe UMU17804.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFE 120 766677799*********999888744443345555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.15 // Query: UZP10014.1|CBM34|GH13_39 [L=604] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-18 53.7 0.1 1.5e-18 53.7 0.1 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.7 0.1 1.5e-18 1.5e-18 6 111 .. 16 123 .. 6 130 .. 0.90 2 ? -1.4 2.0 0.18 0.18 81 119 .. 264 305 .. 260 306 .. 0.60 Alignments for each domain: == domain 1 score: 53.7 bits; conditional E-value: 1.5e-18 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgdekvyyg 88 ++pfg+v+ g+ +++++ ++kd + V l + d + +e+ l+Mkke+ ++ ++ ++++i+ + g+lrYyF+l dg +++yyg UZP10014.1|CBM34|GH13_39 16 KKPFGAVEIGQVIKLSIIVNKDLL--VALELTDFN-NESSLLEMKKEYLSDGNYKYSVEIDTsnKSGLLRYYFILIDGYKRIYYG 97 89******************9998..*******99.89***********999********************************* PP CBM34.hmm 89 engfs..gegpedl.epasyqgnvfe 111 +n+++ geg+ ++ +p y+++v+e UZP10014.1|CBM34|GH13_39 98 NNDEKlgGEGQVYNnDPVPYEITVYE 123 *****999999999555588888876 PP == domain 2 score: -1.4 bits; conditional E-value: 0.18 CBM34.hmm 81 gdekvyygengfsgegpedl..epa.syqgnvfevpyineid 119 g+++ y+++ g ++e +++ + + ++ +++ ++py+ +++ UZP10014.1|CBM34|GH13_39 264 GSDSRYFNKYGNYDEVGAYQspNSKyYNWYKFITYPYQYQSW 305 568899999999966665553334433344555667766555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (604 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 93.87 // Query: XQO27292.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.2 0.1 2.1e-14 40.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.3 0.1 2.1e-14 2.1e-14 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 40.3 bits; conditional E-value: 2.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ e g++ Y+Fe++ XQO27292.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMNLSFTTDRPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRVTIPFdeESGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XQO27292.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.48 // Query: XIG52874.1|CBM34|GH13_39|GH77 [L=1129] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-19 54.6 0.0 1.9e-18 53.3 0.0 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.3 0.0 1.9e-18 1.9e-18 2 119 .. 6 128 .. 5 129 .. 0.83 Alignments for each domain: == domain 1 score: 53.3 bits; conditional E-value: 1.9e-18 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvk..sVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrl 72 yH++ rs+fg+v++g++l++rL + + ++t+r+++ + +e +pM+ ++d + at ++ + +l XIG52874.1|CBM34|GH13_39|GH77 6 YHDShdshyRSRFGAVPSGSELTLRLSVSGRPASscKATVRLWQSN-AGESLVPMTA-----AGDTFAATWQVpqKGCLL 79 7888888*******************9999665534899*******.77*******9.....445566666664355789 PP CBM34.hmm 73 rYyFeledgdekvyygengfs..gegpedl.epasyqgnvfevpyineid 119 +YyF++e++++++yyg+n+ + g+g ++ p+ q++v++ + +++d XIG52874.1|CBM34|GH13_39|GH77 80 WYYFIVEWDGKRLYYGNNQDHlgGVGALYDtVPPAFQITVYDKN-AHTPD 128 *******************9999*******888899****9965.45555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1129 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 139.46 // Query: UUR84046.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-17 49.8 0.3 2.4e-17 49.8 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.8 0.3 2.4e-17 2.4e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.8 bits; conditional E-value: 2.4e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UUR84046.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UUR84046.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UUR84046.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.36 // Query: XGB72221.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XGB72221.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XGB72221.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.90 // Query: XGW90868.1|CBM34|GH13_39 [L=610] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-16 47.0 0.1 1.7e-16 47.0 0.1 1.9 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.0 0.1 1.7e-16 1.7e-16 2 112 .. 7 124 .. 6 130 .. 0.91 2 ? -2.7 0.7 0.44 0.44 83 112 .. 266 295 .. 261 306 .. 0.55 Alignments for each domain: == domain 1 score: 47.0 bits; conditional E-value: 1.7e-16 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 +H++ r+pfg+v++g+++++++ ++k+ v ++l+ d + + ++ M+ke+ + ++ ++++i+ + g l YyF+l XGW90868.1|CBM34|GH13_39 7 MHDSqsivyRRPFGAVEEGQKVKLSIDIEKEIVVAIELLQFDGT---KVNMGMEKEYLNSGNYRYSIEIDTedALGVLGYYFILI 88 799999999************************99999999977...9************************9************ PP CBM34.hmm 80 dgdekvyygengfs..gegpedl.epasyqgnvfev 112 dg ++vyyg+n+++ g g+ + +p yq++ ++ XGW90868.1|CBM34|GH13_39 89 DGYDRVYYGNNDEHlgGIGQIYTyNPVPYQITIYKK 124 **************9999999986666888888874 PP == domain 2 score: -2.7 bits; conditional E-value: 0.44 CBM34.hmm 83 ekvyygengfsgegpedlepasyqgnvfev 112 ++ y+++ g ++e ++++p+s+ +n +++ XGW90868.1|CBM34|GH13_39 266 DSRYFNKAGNYDEIGAYQSPNSKYHNWYKF 295 677888888885555555333333333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (610 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.46 // Query: QRZ26980.1|CBM34|GH13_39 [L=586] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-15 43.3 0.1 4.9e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 4.9e-15 4.9e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 4.9e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ QRZ26980.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe QRZ26980.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (586 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.80 // Query: XNI42560.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.2 0.1 2.1e-14 40.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.3 0.1 2.1e-14 2.1e-14 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 40.3 bits; conditional E-value: 2.1e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +++ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ e g++ Y+Fe++ XNI42560.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMNLSFTTDRPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRVTIPFdeESGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XNI42560.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 91.88 // Query: UBK29176.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-17 49.8 0.3 2.4e-17 49.8 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.8 0.3 2.4e-17 2.4e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.8 bits; conditional E-value: 2.4e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK29176.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK29176.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK29176.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.19 // Query: UYY84238.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-10 26.7 1.2 7.1e-10 25.7 1.2 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.7 1.2 7.1e-10 7.1e-10 6 110 .. 13 113 .. 5 125 .. 0.78 Alignments for each domain: == domain 1 score: 25.7 bits; conditional E-value: 7.1e-10 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFeledgdekvyyge 89 ++pfg+ +++++++ + + ++++++tl++ +++ ++ +pM+ + + +++e ++k+ g+++YyF+++++d+ ++++ UYY84238.1|CBM34|GH13_39 13 KQPFGATQANTSVKWAVEVD-EEIQEITLWLTKNN-ESPVAYPMTFNDE---SKMYETSVKIsSSGLYYYYFNIKQNDQFYFLER 92 789***********999999.79************.779*******555...55*********************9987666655 PP CBM34.hmm 90 ngfs.gegpedlepasyqgnvf 110 ++ g+g+ ++ + + +++ UYY84238.1|CBM34|GH13_39 93 SQDGfGDGEITQ-DGRDIRTFQ 113 443334444333.334444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.16 // Query: USI48790.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-16 45.5 0.1 1e-15 44.6 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.6 0.1 1e-15 1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 44.6 bits; conditional E-value: 1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ USI48790.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRVTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe USI48790.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.74 // Query: UZD42259.1|CBM34|GH13_39|GH77 [L=1149] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-17 50.1 0.5 2.6e-16 46.5 0.0 2.9 3 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.5 0.0 2.6e-16 2.6e-16 6 113 .. 16 129 .. 7 136 .. 0.81 2 ? -1.9 0.7 0.24 0.24 80 115 .. 266 304 .. 264 309 .. 0.70 3 ? -0.7 0.0 0.11 0.11 7 40 .. 581 614 .. 576 634 .. 0.83 Alignments for each domain: == domain 1 score: 46.5 bits; conditional E-value: 2.6e-16 CBM34.hmm 6 rspfgyvydgd..tlhirLrtkkddvksVtlrygdpywseeeelpMkkegsde.lfdyweatikl..epgrlrYyFeled 80 rsp g +++ + +l ir+rt+ d+v +V+lr++++ +e ++++ + ++ + ++ a i+l + +l+YyF++ + UZD42259.1|CBM34|GH13_39|GH77 16 RSPVGPAEASSfvQLGIRIRTQ-DEVSKVILRLWREG-AGERLIELETKSAEGvQDRFYAARIDLpdTGCLLWYYFIVAT 93 5555555554411556777777.9*************.67******999888867889*******9777789******** PP CBM34.hmm 81 gdekvyygengfs..gegpedl.epasyqgnvfevp 113 ++ ++yyg+n+++ g+g ++ p+s q++vf+ UZD42259.1|CBM34|GH13_39|GH77 94 SSGTWYYGNNNEHlgGMGGIYDnAPPSFQITVFNKG 129 **********************7777******9854 PP == domain 2 score: -1.9 bits; conditional E-value: 0.24 CBM34.hmm 80 dgdekvyygengfs.gegpedl.epa.syqgnvfevpyi 115 +g++++y++ +g + + g ++ e + + +n++++py UZD42259.1|CBM34|GH13_39|GH77 266 TGSDSIYFNREGNYdSLGAFQSqESPyYSWYNFHKYPYE 304 677899999999996555556655666667888888884 PP == domain 3 score: -0.7 bits; conditional E-value: 0.11 CBM34.hmm 7 spfgyvydgdtlhirLrtkkddvksVtlrygdpy 40 ++fg++ +++++++ + + + ++V+l +gd UZD42259.1|CBM34|GH13_39|GH77 581 DEFGAPAKNEAFVVVINRSRTQEEKVMLKVGDFL 614 789*************9999999999*9999965 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1149 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 129.09 // Query: UUW66077.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-17 49.8 0.3 2.4e-17 49.8 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.8 0.3 2.4e-17 2.4e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.8 bits; conditional E-value: 2.4e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UUW66077.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UUW66077.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UUW66077.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 88.95 // Query: WBP98917.1|CBM34|GH13_39 [L=610] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-16 47.0 0.1 1.7e-16 47.0 0.1 1.9 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.0 0.1 1.7e-16 1.7e-16 2 112 .. 7 124 .. 6 130 .. 0.91 2 ? -2.7 0.7 0.44 0.44 83 112 .. 266 295 .. 261 306 .. 0.55 Alignments for each domain: == domain 1 score: 47.0 bits; conditional E-value: 1.7e-16 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 +H++ r+pfg+v++g+++++++ ++k+ v ++l+ d + + ++ M+ke+ + ++ ++++i+ + g l YyF+l WBP98917.1|CBM34|GH13_39 7 MHDSqsivyRRPFGAVEEGQKVKLSIDIEKEIVVAIELLQFDGT---KVNMGMEKEYLNSGNYRYSIEIDTedALGVLGYYFILI 88 799999999************************99999999977...9************************9************ PP CBM34.hmm 80 dgdekvyygengfs..gegpedl.epasyqgnvfev 112 dg ++vyyg+n+++ g g+ + +p yq++ ++ WBP98917.1|CBM34|GH13_39 89 DGYDRVYYGNNDEHlgGIGQIYTyNPVPYQITIYKK 124 **************9999999986666888888874 PP == domain 2 score: -2.7 bits; conditional E-value: 0.44 CBM34.hmm 83 ekvyygengfsgegpedlepasyqgnvfev 112 ++ y+++ g ++e ++++p+s+ +n +++ WBP98917.1|CBM34|GH13_39 266 DSRYFNKAGNYDEIGAYQSPNSKYHNWYKF 295 677888888885555555333333333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (610 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 93.78 // Query: WFD85038.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-17 49.2 0.2 3.7e-17 49.2 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.2 0.2 3.7e-17 3.7e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -2.0 1.4 0.27 0.27 80 113 .. 263 299 .. 260 306 .. 0.56 Alignments for each domain: == domain 1 score: 49.2 bits; conditional E-value: 3.7e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++ +pM+ e+ +++ ++ i+ g ++YyF+ WFD85038.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYLIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e WFD85038.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -2.0 bits; conditional E-value: 0.27 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevp 113 +g+++ y+++ g +ge +++ + + ++ ++++++p WFD85038.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYNWYRFYDYP 299 5667788888888855555542223334444555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.02 // Query: UQU60669.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-13 37.6 0.1 3.3e-13 36.5 0.1 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.5 0.1 3.3e-13 3.3e-13 2 110 .. 3 115 .. 2 128 .. 0.81 Alignments for each domain: == domain 1 score: 36.5 bits; conditional E-value: 3.3e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L++ k++v ++ ++ +++ + + e++M+k e + ++a++k+ ++g+++YyFe+ +++ UQU60669.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLQIDKENV-TAKFIIRRDF-GARSEFDMQK---LE-GGIFSASVKFdvGQGLYYYYFEISEST 84 5666666779***********************.7777777778.79********...23.679*******99***********9665 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epasyqgnvf 110 +k+yyg +g+ geg ++ e++ ++ UQU60669.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnEND--VRPYQ 115 5888***********99998884443..33333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 105.06 // Query: UXK05558.1|CBM34|GH13_39 [L=610] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-14 38.6 0.9 1.8e-13 37.3 0.9 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.3 0.9 1.8e-13 1.8e-13 1 116 [. 4 130 .. 4 134 .. 0.83 Alignments for each domain: == domain 1 score: 37.3 bits; conditional E-value: 1.8e-13 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpy.wseeeelpMkkegsdelfdyweatiklepgrlrYyFele 79 iy +p ++pfg+v++g+t++i L + ++ ++V+l++ ++ +++ +pM+ + +d +++ t++ + g++ YyF++ UXK05558.1|CBM34|GH13_39 4 IYFNPwleryKQPFGAVQEGTTVKIWLSVPEQQNTKVFLIVRKEGsSVGQKIFPMEPASEDR--FHFQTTMDQGWGLYFYYFKVI 86 56777777779********************************9997789*******77777..899*****************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevpyin 116 ++ + yyg +g geg+ + e + yq ++++ p + UXK05558.1|CBM34|GH13_39 87 HESegyeTIQYYGFKGHGGEGRIYGsEREvvPYQLTCYQKPEVA 130 66546766779999999988888776555456777777777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (610 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.25 // Query: BDX25341.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-14 38.3 0.2 1.9e-13 37.2 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.2 0.2 1.9e-13 1.9e-13 2 113 .. 3 122 .. 2 129 .. 0.83 Alignments for each domain: == domain 1 score: 37.2 bits; conditional E-value: 1.9e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k g + ++a++k+ ++g+++YyFe+ + + BDX25341.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TIKFIIRRDF-GARSEFDMQKLG----GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.9999999999.99********43....678*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +k+yyg +g+ geg ++ e++ yq + f + BDX25341.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnENDvrPYQATIFSMR 122 4567***********99999886665556666666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.45 // Query: BDM76442.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-14 39.2 0.2 1e-13 38.1 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.1 0.2 1e-13 1e-13 2 110 .. 3 119 .. 2 128 .. 0.80 Alignments for each domain: == domain 1 score: 38.1 bits; conditional E-value: 1e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k +d+ +++++k+ ++g+++YyFe+ + + BDM76442.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TAKFIIRRDF-GARSEFDMQK-LEDG---IFSVSVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.7777777778.79********.6777...8999999999***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvf 110 +k+yyg +g+ geg ++ e++ yq + f BDM76442.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnENDvrPYQATIF 119 4567***********99999885444333444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.68 // Query: USI63663.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ USI63663.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe USI63663.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.84 // Query: XUU01204.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XUU01204.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XUU01204.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.19 // Query: UBK88888.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-17 49.6 0.3 2.7e-17 49.6 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.6 0.3 2.7e-17 2.7e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.6 bits; conditional E-value: 2.7e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK88888.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSIGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK88888.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK88888.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.03 // Query: UYZ34869.1|CBM34|GH13_39 [L=608] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-18 52.1 0.0 1.1e-17 50.9 0.0 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 50.9 0.0 1.1e-17 1.1e-17 1 115 [. 6 127 .. 6 130 .. 0.93 Alignments for each domain: == domain 1 score: 50.9 bits; conditional E-value: 1.1e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 i+H++ r+pfg+v++g++++i++ ++kd + ++l+ d + ++++ M ke+ ++ ++++i+ + g+l YyF+l UYZ34869.1|CBM34|GH13_39 6 ILHDSqsirfRRPFGAVEAGQKVKISININKDIIVAIELIKFDGT---KMNMGMNKEYLNNGEFKYSVEIDTsdALGILEYYFIL 87 6899999999***********************988888887766...9************9999******************** PP CBM34.hmm 79 edgdekvyygengfs..gegpedl.epasyqgnvfevpyi 115 dg ++vyyg+n+ + g+g+ + +p yq++v+e +i UYZ34869.1|CBM34|GH13_39 88 IDGYDRVYYGNNDNHlgGVGQIYTyNPVPYQITVYEKSFI 127 ***************99999*9997777*******98876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (608 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.19 // Query: WIW70840.1|CBM34|GH13_39|GH77 [L=1146] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-18 53.4 0.0 5.1e-18 52.0 0.0 1.8 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 52.0 0.0 5.1e-18 5.1e-18 1 111 [. 7 127 .. 7 135 .. 0.91 Alignments for each domain: == domain 1 score: 52.0 bits; conditional E-value: 5.1e-18 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrl 72 i H++ r+ fg+v+++++l+i++++ ++++V+lr+++++ +e+ ++M+k+ ++ +++ti + + +l WIW70840.1|CBM34|GH13_39|GH77 7 IIHNSqmsgfRNIFGAVKANSELKISIHIPEiYKPTNVILRLWQDN-IGETLVKMQKVDILGDDLKFQCTIAMpsKGCLL 85 6799999999999*********************************.88************************8666789 PP CBM34.hmm 73 rYyFeledgdekvyygengfs..gegpedl.epasyqgnvfe 111 +YyF +++ +++++yg+n geg ++ +p+s q++v++ WIW70840.1|CBM34|GH13_39|GH77 86 WYYFVIVNAEKTIFYGNNAQNlgGEGAVYEqQPPSFQITVYN 127 ******************9999899999997777*9*99997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1146 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.04 // Query: UZE44776.1|CBM34|GH13_39|GH77 [L=1149] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-18 51.9 0.3 1.1e-16 47.6 0.0 3.0 3 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.6 0.0 1.1e-16 1.1e-16 3 113 .. 8 129 .. 7 136 .. 0.82 2 ? -1.9 0.7 0.24 0.24 80 115 .. 266 304 .. 264 309 .. 0.70 3 ? -0.1 0.0 0.071 0.071 7 40 .. 581 614 .. 576 636 .. 0.81 Alignments for each domain: == domain 1 score: 47.6 bits; conditional E-value: 1.1e-16 CBM34.hmm 3 Hrp.....rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegsde.lfdyweatikl..epgrlr 73 H++ rsp g +++ +++++ +r+ d+v +V+lr++++ +e ++++ + ++ + ++ a i+l + +l+ UZE44776.1|CBM34|GH13_39|GH77 8 HNSqdvfyRSPVGPAEASSSVQLGIRIRTqDEVSKVILRLWREG-AGERLIELEAKSAEGvQDRFYVARIDLpdTGCLLW 86 5555556667777777766666555555549*************.67*******99998867889999****9777789* PP CBM34.hmm 74 YyFeledgdekvyygengfs..gegpedl.epasyqgnvfevp 113 YyF++++++ ++yyg+n+++ g+g ++ p+s q++vf+ UZE44776.1|CBM34|GH13_39|GH77 87 YYFIVVTSSGTWYYGNNNEHlgGMGGIYDnAPPSFQITVFNKG 129 *****************************7777******9865 PP == domain 2 score: -1.9 bits; conditional E-value: 0.24 CBM34.hmm 80 dgdekvyygengfs.gegpedl.epa.syqgnvfevpyi 115 +g++++y++ +g + + g ++ e + + +n++++py UZE44776.1|CBM34|GH13_39|GH77 266 TGSDSIYFNREGNYdSLGAFQSqESPyYSWYNFHKYPYE 304 677899999999996555556655666667888888884 PP == domain 3 score: -0.1 bits; conditional E-value: 0.071 CBM34.hmm 7 spfgyvydgdtlhirLrtkkddvksVtlrygdpy 40 ++fg++ +++++++ + + + ++V+l +gd UZE44776.1|CBM34|GH13_39|GH77 581 DEFGAPAKNEAFVVIINRSRTQEEKVMLNVGDFL 614 789*************99999999******9965 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1149 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 128.74 // Query: WYY97527.1|CBM34|GH13_39 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-11 31.3 1.9 2.7e-11 30.3 1.9 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.3 1.9 2.7e-11 2.7e-11 6 110 .. 13 114 .. 3 123 .. 0.79 Alignments for each domain: == domain 1 score: 30.3 bits; conditional E-value: 2.7e-11 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFeledgdekvyyge 89 +spfg++++++t++ r+++ + v+ ++l++ + ++ +pMkk+ + + +++++++ + g++ YyFe++++++ yy+e WYY97527.1|CBM34|GH13_39 13 KSPFGAIKARTTVTWRVKID-EPVDYINLWLTKAE-ETPVPYPMKKTDE----QTYQVQVTIgTSGLYHYYFEIKQSNQISYYQE 91 89*****************9.799*********99.8899******444....66***********************9999998 PP CBM34.hmm 90 ngfs.gegpedlepa.syqgnvf 110 ge +++++ +yq +++ WYY97527.1|CBM34|GH13_39 92 ALGGeGELVTSNQNLaQYQLTCY 114 65542333333334446666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.24 // Query: WEV08530.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-17 49.8 0.3 2.4e-17 49.8 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.8 0.3 2.4e-17 2.4e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.8 bits; conditional E-value: 2.4e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ WEV08530.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e WEV08530.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p WEV08530.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.31 // Query: WCM70130.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-17 49.6 0.3 2.7e-17 49.6 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.6 0.3 2.7e-17 2.7e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.6 bits; conditional E-value: 2.7e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ WCM70130.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSIGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e WCM70130.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p WCM70130.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 93.14 // Query: WAO21605.1|CBM34|GH13_39 [L=602] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (602 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 481.22 // Query: WKY44339.1|CBM34|GH13_39 [L=628] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-13 36.7 0.1 7.6e-13 35.3 0.1 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.3 0.1 7.6e-13 7.6e-13 3 117 .. 5 121 .. 3 124 .. 0.82 Alignments for each domain: == domain 1 score: 35.3 bits; conditional E-value: 7.6e-13 CBM34.hmm 3 Hrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeled 80 H++ r pfg+v+ ++ +++++ + d+ +V+lr+ ++ e++++M+ +++ +++ ++i++ epg+l+Y Fe+++ WKY44339.1|CBM34|GH13_39 5 HNSfvseyRCPFGAVPVNSMVTLKV--FGADLLNVKLRTYFND--IETSYAMTP---SDYSNFYAIKIQVpnEPGLLWYDFEFNT 82 7777777788999999999877655..555888********99..7********...56699*******999************* PP CBM34.hmm 81 gdekvyygen..gfsgegpedlepa.syqgnvfevpyine 117 ++++++yg + g+ g g+ + e+a syq++ ++ ++ WKY44339.1|CBM34|GH13_39 83 KGKTYIYGSKpdGLGGIGQIYTEKAsSYQITIYDPK-RKT 121 *******9862256699999995666*****99844.444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (628 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 105.51 // Query: XIH94018.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-15 44.3 0.1 2.6e-15 43.2 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.2 0.1 2.6e-15 2.6e-15 2 111 .. 3 120 .. 2 128 .. 0.84 Alignments for each domain: == domain 1 score: 43.2 bits; conditional E-value: 2.6e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ XIH94018.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRITIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfe 111 +++ ++ +yg +g+ geg + e++ yq +vfe XIH94018.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFE 120 766677799*********999888744443345555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 103.34 // Query: UBK74049.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-17 49.9 0.2 2.3e-17 49.9 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.9 0.2 2.3e-17 2.3e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.9 bits; conditional E-value: 2.3e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK74049.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK74049.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK74049.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.09 // Query: WGO86039.1|CBM34|GH13_39 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-11 31.0 1.8 3.8e-11 29.8 1.8 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.8 1.8 3.8e-11 3.8e-11 6 110 .. 13 114 .. 3 123 .. 0.79 Alignments for each domain: == domain 1 score: 29.8 bits; conditional E-value: 3.8e-11 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFeledgdekvyyge 89 +spfg++++++t++ r+++ + v+ ++l++ + ++ +pMkk+ + + + +++++ + g++ YyFe++++++ yy+e WGO86039.1|CBM34|GH13_39 13 KSPFGAIKARTTVTWRVKID-EPVDYINLWLTKAE-ETPVLYPMKKTDE----QTYHVQVTIgTSGLYHYYFEIKQSNQISYYQE 91 89*****************9.799*********99.889*******444....66***********************9999998 PP CBM34.hmm 90 ngfs.gegpedlepa.syqgnvf 110 ge +++++ +yq +++ WGO86039.1|CBM34|GH13_39 92 ALGGeGELVTSNQNLaQYQLTCY 114 65542333333334446666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.71 // Query: UQZ24596.1|CBM34|GH13_39 [L=586] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-06 13.0 0.2 5.9e-06 13.0 0.2 2.0 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 13.0 0.2 5.9e-06 5.9e-06 61 111 .. 4 57 .. 2 65 .. 0.84 2 ? -2.9 0.2 0.53 0.53 72 77 .. 226 231 .. 197 253 .. 0.53 Alignments for each domain: == domain 1 score: 13.0 bits; conditional E-value: 5.9e-06 CBM34.hmm 61 weatiklepgrlrYyFeledgdekvyygengfs..gegpedl.epasyqgnvfe 111 ++ t++ +pg l+Y F e ++ +++yg ++ + geg+ ++ p+syq++ ++ UQZ24596.1|CBM34|GH13_39 4 YTLTLPDQPGVLWYDFCYEHEGHSYCYGTQNDTlgGEGQIYEaFPPSYQITLYD 57 5556666*****************9999998888899999995555***99997 PP == domain 2 score: -2.9 bits; conditional E-value: 0.53 CBM34.hmm 72 lrYyFe 77 +Y+F+ UQZ24596.1|CBM34|GH13_39 226 SWYRFN 231 234333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (586 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 105.05 // Query: UBK71514.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-17 49.9 0.2 2.3e-17 49.9 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.9 0.2 2.3e-17 2.3e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.9 bits; conditional E-value: 2.3e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK71514.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK71514.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK71514.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.56 // Query: UBL06896.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-17 49.2 0.2 3.7e-17 49.2 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.2 0.2 3.7e-17 3.7e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -2.0 1.4 0.27 0.27 80 113 .. 263 299 .. 260 306 .. 0.56 Alignments for each domain: == domain 1 score: 49.2 bits; conditional E-value: 3.7e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++ +pM+ e+ +++ ++ i+ g ++YyF+ UBL06896.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYLIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBL06896.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -2.0 bits; conditional E-value: 0.27 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevp 113 +g+++ y+++ g +ge +++ + + ++ ++++++p UBL06896.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYNWYRFYDYP 299 5667788888888855555542223334444555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.44 // Query: UBK31928.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-17 49.9 0.2 2.3e-17 49.9 0.2 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.9 0.2 2.3e-17 2.3e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.9 bits; conditional E-value: 2.3e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK31928.1|CBM34|GH13_39 6 IYHDSqgtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK31928.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK31928.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.81 // Query: WYC70483.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-14 38.9 0.1 1.4e-13 37.7 0.1 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.7 0.1 1.4e-13 1.4e-13 2 110 .. 3 119 .. 2 128 .. 0.80 Alignments for each domain: == domain 1 score: 37.7 bits; conditional E-value: 1.4e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k e + ++a++k+ ++g+++YyFe+ + + WYC70483.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLQTDKENV-TAKFIIRRDF-GARSEFDMQK---LE-GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.7777777778.79********...23.679*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvf 110 +k+yyg +g+ geg ++ e++ yq + f WYC70483.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnENDvrPYQATIF 119 4567***********99999885444333444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 100.54 // Query: USQ63597.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-17 49.8 0.3 2.4e-17 49.8 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.8 0.3 2.4e-17 2.4e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.8 bits; conditional E-value: 2.4e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ USQ63597.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e USQ63597.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p USQ63597.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 90.24 // Query: XBO59636.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-15 43.5 0.1 4.3e-15 42.5 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.5 0.1 4.3e-15 4.3e-15 2 113 .. 3 122 .. 2 129 .. 0.85 Alignments for each domain: == domain 1 score: 42.5 bits; conditional E-value: 4.3e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XBO59636.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGNFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.667********************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XBO59636.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.46 // Query: UBK49901.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-17 49.8 0.3 2.4e-17 49.8 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.8 0.3 2.4e-17 2.4e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.9 1.3 0.26 0.26 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 49.8 bits; conditional E-value: 2.4e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ UBK49901.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSVGSKVSLRLECK--ECGEVFIEVIKFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..57889**999998.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e UBK49901.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.9 bits; conditional E-value: 0.26 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p UBK49901.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.86 // Query: XUU65635.1|CBM34|GH13_29 [L=645] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-14 39.8 0.8 7.4e-14 38.5 0.0 2.0 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.5 0.0 7.4e-14 7.4e-14 6 114 .. 23 136 .. 13 145 .. 0.83 2 ? -3.4 0.2 0.74 0.74 81 113 .. 279 306 .. 277 313 .. 0.56 Alignments for each domain: == domain 1 score: 38.5 bits; conditional E-value: 7.4e-14 CBM34.hmm 6 rspfgyvydgdtlhirLrtkk.ddvksVtlrygdpywseeeelpMkkegs....delfdyweatikl..epgrlrYyFeledgd. 82 +spfg++++g+ ++ + t k ++ +V l + + e+e++M+++g+ d ++ +w+ ++++ + +++ Y+F+l g+ XUU65635.1|CBM34|GH13_29 23 KSPFGAIPCGEGVTFNFFTDKsINCLNVSLFLINGK---ETEYKMTQIGEekigDRDYIVWSLNFTApkPAKTIFYHFKLFVGNe 104 89*******************87777*******977...9*********95555558***********************96555 PP CBM34.hmm 83 .ekvyygengfs..gegpedlepasyqgnvfevpy 114 + +yyg+n + g g+ ++ +y++n++++ + XUU65635.1|CBM34|GH13_29 105 nSIFYYGNNSLAlgGIGEIYE---NYPINYQITLF 136 7899******99999999888...56666655544 PP == domain 2 score: -3.4 bits; conditional E-value: 0.74 CBM34.hmm 81 gdekvyygengfsgegpedlepasyqgnvfevp 113 g+e++y++e s+ +p + ++++++p XUU65635.1|CBM34|GH13_29 279 GKESLYFKEASKSKASPFYP-----WYRFQNYP 306 66778888877776666655.....23333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (645 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.37 // Query: BDW49753.1|CBM34|GH13 [L=605] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-14 38.3 0.2 1.9e-13 37.2 0.2 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.2 0.2 1.9e-13 1.9e-13 2 113 .. 3 122 .. 2 129 .. 0.83 Alignments for each domain: == domain 1 score: 37.2 bits; conditional E-value: 1.9e-13 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgd 82 y+++ ++pfg+++ g+ +++ L+t k++v ++ ++ +++ + + e++M+k g + ++a++k+ ++g+++YyFe+ + + BDW49753.1|CBM34|GH13 3 YYNSwdadfKQPFGAIQVGQIMKVNLKTDKENV-TIKFIIRRDF-GARSEFDMQKLG----GGIFSASVKFdvGQGLYYYYFEISEPT 84 5666666779***********************.9999999999.99********43....678*******99***********8544 PP CBM34.hmm 83 ....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +k+yyg +g+ geg ++ e++ yq + f + BDW49753.1|CBM34|GH13 85 dwgiKKFYYGCSGLGGEGVLYMnENDvrPYQATIFSMR 122 4567***********99999886665556666666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (605 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.56 // Query: XTK92597.1|CBM34|GH13_39 [L=609] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-11 30.0 0.9 1.1e-10 28.3 0.9 1.9 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.3 0.9 1.1e-10 1.1e-10 1 115 [. 4 129 .. 4 134 .. 0.83 Alignments for each domain: == domain 1 score: 28.3 bits; conditional E-value: 1.1e-10 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpy.wseeeelpMkkegsdelfdyweatiklepgrlrYyFele 79 iy +p ++pfg+v++++t++i L + +++l++ ++ + +++ +pMk + +d y+e ++ + g++ YyF+++ XTK92597.1|CBM34|GH13_39 4 IYFNPwleryKQPFGAVQEETTVKIWLSGPEPETSKAYLVVHKEGsNVGQKVFPMKAVSEDR--FYFETPMDQGWGLYFYYFKIV 86 56777777779*****************************9999887789*******88888..899*****************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevpyi 115 ++ + +yg ng geg+ + e + yq ++++ p + XTK92597.1|CBM34|GH13_39 87 HQSagyeTIQFYGFNGQGGEGKIYGsEHDvvPYQLTCYQKPEV 129 7766676778999999998888877554446666666666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (609 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 93.81 // Query: WFB96269.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-16 45.5 0.1 1e-15 44.6 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.6 0.1 1e-15 1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 44.6 bits; conditional E-value: 1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + +++ti++ epg++ Y+Fe++ WFB96269.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFTTDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRVTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.5569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe WFB96269.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.22 // Query: XFO70115.1|CBM34|GH13_39|GH77 [L=1162] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-21 62.6 0.0 5.9e-21 61.4 0.0 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.4 0.0 5.9e-21 5.9e-21 2 111 .. 7 124 .. 6 132 .. 0.91 Alignments for each domain: == domain 1 score: 61.4 bits; conditional E-value: 5.9e-21 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrY 74 +H++ rspfg+v++ +++++ L ++ v+ + lr++++ +e+ + M+ +++ + ++ea++k+ pg l+Y XFO70115.1|CBM34|GH13_39|GH77 7 LHDShntgfRSPFGAVSCHTEVTLCLEAA-APVQTAVLRLWQEG-FGETLINMQLAETLPAKLVYEASFKVppVPGVLWY 84 6777777**********************.69**********99.56***********************9999****** PP CBM34.hmm 75 yFeledgdekvyygengfs..gegpedl.epasyqgnvfe 111 yF++++++++vyyg+n ++ g+g+ ++ p+syq++ + XFO70115.1|CBM34|GH13_39|GH77 85 YFIIYQDGQTVYYGNNPAEtgGVGQLTStPPPSYQISTYL 124 *******************999****99777799999884 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1162 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 146.72 // Query: URZ87701.1|CBM34|GH13_39 [L=606] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (606 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 233.59 // Query: XCC62981.1|CBM34|GH13_39 [L=668] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-15 41.8 0.6 2.5e-14 40.1 0.0 2.1 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.1 0.0 2.5e-14 2.5e-14 2 118 .. 11 132 .. 10 134 .. 0.87 2 ? -1.6 0.5 0.2 0.2 68 85 .. 297 314 .. 271 330 .. 0.55 Alignments for each domain: == domain 1 score: 40.1 bits; conditional E-value: 2.5e-14 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 +H++ r p g+v +g++++++L + d k+++l++ + ee+++M++ +e + +w+a++++ pg+++Y F++ XCC62981.1|CBM34|GH13_39 11 MHDSaeeiyRVPLGAVAAGTAVRLSLAAYELDFKKAYLILMTDG--MEESVEMRQ---TE-NGFWQAEYTApdIPGLVWYWFRIC 89 68888889899*******************************99..89******9...44.78********999*********98 PP CBM34.hmm 80 dgd.ekvyygengfs..gegpedl.epasyqgnvfevpyinei 118 ++ ++yyg++ + g+g+ ++ p+ q +v++ + +++ XCC62981.1|CBM34|GH13_39 90 LDEnCSIYYGARSGYtsGTGEVYRnPPPPFQLTVYDGAFTTPD 132 5555********9998888888885555999999987765544 PP == domain 2 score: -1.6 bits; conditional E-value: 0.2 CBM34.hmm 68 epgrlrYyFeledgdekv 85 p +Y+F + ++ k+ XCC62981.1|CBM34|GH13_39 297 SPYYSWYRFTDYPNEYKC 314 333345555555555444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (668 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.57 // Query: WWV68858.1|CBM34|GH13_39|GH77 [L=1166] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-20 57.6 0.0 2.9e-19 56.0 0.0 1.9 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.0 0.0 2.9e-19 2.9e-19 2 110 .. 7 130 .. 6 137 .. 0.88 2 ? -3.4 0.4 0.72 0.72 81 108 .. 272 302 .. 270 314 .. 0.53 Alignments for each domain: == domain 1 score: 56.0 bits; conditional E-value: 2.9e-19 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkdd......vksVtlrygdpywseeeelpMkkegsdelfdyweatikl..e 68 +H++ rspfg+v++++++++rL +++ + v+ V+lr++++ +e+ ++M+ +++++ +ea + + WWV68858.1|CBM34|GH13_39|GH77 7 LHDShntdfRSPFGAVSCRTEITLRLLIAGPQqpasilVDAVQLRLWQDG-LGETIIDMRVSKKQQDRCLYEAVFLVpaV 85 677777799*****************999955599999************.67********************988778* PP CBM34.hmm 69 pgrlrYyFeledgdekvyygengfs..gegpedl.epasyqgnvf 110 pg l+YyF++++g++ yyg+n+++ g+g p+syq++ + WWV68858.1|CBM34|GH13_39|GH77 86 PGVLWYYFIVRQGGQISYYGNNTEEtgGVGHIAAsPPPSYQISTY 130 ************************987777777744457777655 PP == domain 2 score: -3.4 bits; conditional E-value: 0.72 CBM34.hmm 81 gdekvyygengfsgegpedl..epa.syqgn 108 g++++y++++g +g +++ e + + ++ WWV68858.1|CBM34|GH13_39|GH77 272 GSDSIYFNKEGTYGAVGAYQsrESPyYSWYK 302 6678888888888555544422233222233 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1166 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 136.10 // Query: XCH09081.1|CBM34|GH13_39 [L=600] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-15 43.2 0.1 5.1e-15 42.3 0.1 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.3 0.1 5.1e-15 5.1e-15 2 113 .. 3 122 .. 2 129 .. 0.84 Alignments for each domain: == domain 1 score: 42.3 bits; conditional E-value: 5.1e-15 CBM34.hmm 2 yHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFele 79 y++p ++pfg+++ g+++ +r+ t + +v Vt+++ +++ ++++e+ M+k d + ++ ti++ epg++ Y+Fe++ XCH09081.1|CBM34|GH13_39 3 YYNPwnldyKQPFGAIKVGNSMSLRFATDQPSV-LVTCVIRRDF-GKRYEFSMTK---DS-GGDFRLTIPFdeEPGLYFYHFEIV 81 7777888889********************999.9*********.99********...44.4569*******************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevp 113 +++ ++ +yg +g+ geg + e++ yq +vfe XCH09081.1|CBM34|GH13_39 82 ESSdlgeTRRFYGCSGIGGEGLLYTdENDvkPYQLTVFEKE 122 766677799*********99988875554456666666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (600 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.69 // Query: WEV16166.1|CBM34|GH13_39 [L=567] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-17 50.1 0.3 1.9e-17 50.1 0.3 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 50.1 0.3 1.9e-17 1.9e-17 1 112 [. 6 124 .. 6 130 .. 0.92 2 ? -1.8 1.3 0.24 0.24 80 114 .. 263 300 .. 260 306 .. 0.57 Alignments for each domain: == domain 1 score: 50.1 bits; conditional E-value: 1.9e-17 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFel 78 iyH++ r+pfg+v+ g+++ +rL +k ++ +V++ + + + ++++++pM+ e+ +++ ++ i+ g ++YyF+ WEV16166.1|CBM34|GH13_39 6 IYHDSqdtfyREPFGAVSIGSKVSLRLECK--ECGEVFIEVINFD-GSRYSIPMTIEERRNECIIYKGIIDTtnSLGVINYYFKY 87 89****************************..68889***99999.89************************999********** PP CBM34.hmm 79 edgdekvyygengfs..gegpedlepa.syqgnvfev 112 +++ + yyg+n+++ geg+ +++++ +yq++v+e WEV16166.1|CBM34|GH13_39 88 IKDGFTKYYGNNDEClgGEGKIYYDFPnYYQITVYED 124 ***************9999999995555999999975 PP == domain 2 score: -1.8 bits; conditional E-value: 0.24 CBM34.hmm 80 dgdekvyygengfsgegpedl..epa.syqgnvfevpy 114 +g+++ y+++ g +ge +++ + + ++ ++++++p WEV16166.1|CBM34|GH13_39 263 TGSDSRYFNKYGNYGELGAYEskYSKyYKWYRFYDYPN 300 56677888888888555544433334344555666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (567 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 90.77 // Query: XAQ49036.1|CBM34|GH13_39 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-11 31.4 1.9 2.7e-11 30.3 1.9 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.3 1.9 2.7e-11 2.7e-11 6 110 .. 13 114 .. 3 123 .. 0.79 Alignments for each domain: == domain 1 score: 30.3 bits; conditional E-value: 2.7e-11 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFeledgdekvyyge 89 +spfg++++++t++ r+++ + v+ ++l++ + ++ +pMkk+ + + +++++++ + g++ YyFe++++++ yy+e XAQ49036.1|CBM34|GH13_39 13 KSPFGAIKARTTVTWRVKID-EPVDYINLWLTKAE-ETPVPYPMKKTDE----QTYQVQVTIgTSGLYHYYFEIKQSNQISYYQE 91 89*****************9.799*********99.8899******444....66***********************9999998 PP CBM34.hmm 90 ngfs.gegpedlepa.syqgnvf 110 ge +++++ +yq +++ XAQ49036.1|CBM34|GH13_39 92 ALGGeGELVTSNQNLaQYQLTCY 114 65542333333334446666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.28 // Query: UZP03275.1|CBM34|GH13_39 [L=604] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-18 53.7 0.1 1.5e-18 53.7 0.1 2.3 2 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.7 0.1 1.5e-18 1.5e-18 6 111 .. 16 123 .. 6 130 .. 0.90 2 ? -1.4 2.0 0.18 0.18 81 119 .. 264 305 .. 260 306 .. 0.60 Alignments for each domain: == domain 1 score: 53.7 bits; conditional E-value: 1.5e-18 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl..epgrlrYyFeledgdekvyyg 88 ++pfg+v+ g+ +++++ ++kd + V l + d + +e+ l+Mkke+ ++ ++ ++++i+ + g+lrYyF+l dg +++yyg UZP03275.1|CBM34|GH13_39 16 KKPFGAVEIGQVIKLSIIVNKDLL--VALELTDFN-NESSLLEMKKEYLSDGNYKYSVEIDTsnKSGLLRYYFILIDGYKRIYYG 97 89******************9998..*******99.89***********999********************************* PP CBM34.hmm 89 engfs..gegpedl.epasyqgnvfe 111 +n+++ geg+ ++ +p y+++v+e UZP03275.1|CBM34|GH13_39 98 NNDEKlgGEGQVYNnDPVPYEITVYE 123 *****999999999555588888876 PP == domain 2 score: -1.4 bits; conditional E-value: 0.18 CBM34.hmm 81 gdekvyygengfsgegpedl..epa.syqgnvfevpyineid 119 g+++ y+++ g ++e +++ + + ++ +++ ++py+ +++ UZP03275.1|CBM34|GH13_39 264 GSDSRYFNKYGNYDEVGAYQspNSKyYNWYKFITYPYQYQSW 305 568899999999966665553334433344555667766555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (604 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.38 // Query: UXJ96940.1|CBM34|GH13_39 [L=610] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-14 38.6 0.9 1.8e-13 37.3 0.9 1.7 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.3 0.9 1.8e-13 1.8e-13 1 116 [. 4 130 .. 4 134 .. 0.83 Alignments for each domain: == domain 1 score: 37.3 bits; conditional E-value: 1.8e-13 CBM34.hmm 1 iyHrp.....rspfgyvydgdtlhirLrtkkddvksVtlrygdpy.wseeeelpMkkegsdelfdyweatiklepgrlrYyFele 79 iy +p ++pfg+v++g+t++i L + ++ ++V+l++ ++ +++ +pM+ + +d +++ t++ + g++ YyF++ UXJ96940.1|CBM34|GH13_39 4 IYFNPwleryKQPFGAVQEGTTVKIWLSVPEQQNTKVFLIVRKEGsSVGQKIFPMEPASEDR--FHFQTTMDQGWGLYFYYFKVI 86 56777777779********************************9997789*******77777..899*****************9 PP CBM34.hmm 80 dgd....ekvyygengfsgegpedl.epa..syqgnvfevpyin 116 ++ + yyg +g geg+ + e + yq ++++ p + UXJ96940.1|CBM34|GH13_39 87 HESegyeTIQYYGFKGHGGEGRIYGsEREvvPYQLTCYQKPEVA 130 66546766779999999988888776555456777777777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (610 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.54 // Query: XWV02589.1|CBM34|GH13_39 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-11 31.3 1.9 2.7e-11 30.3 1.9 1.6 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.3 1.9 2.7e-11 2.7e-11 6 110 .. 13 114 .. 3 123 .. 0.79 Alignments for each domain: == domain 1 score: 30.3 bits; conditional E-value: 2.7e-11 CBM34.hmm 6 rspfgyvydgdtlhirLrtkkddvksVtlrygdpywseeeelpMkkegsdelfdyweatikl.epgrlrYyFeledgdekvyyge 89 +spfg++++++t++ r+++ + v+ ++l++ + ++ +pMkk+ + + +++++++ + g++ YyFe++++++ yy+e XWV02589.1|CBM34|GH13_39 13 KSPFGAIKARTTVTWRVKID-EPVDYINLWLTKAE-ETPVPYPMKKTDE----QTYQVQVTIgTSGLYHYYFEIKQSNQISYYQE 91 89*****************9.799*********99.8899******444....66***********************9999998 PP CBM34.hmm 90 ngfs.gegpedlepa.syqgnvf 110 ge +++++ +yq +++ XWV02589.1|CBM34|GH13_39 92 ALGGeGELVTSNQNLaQYQLTCY 114 65542333333334446666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.74 // [ok]