# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM34/fasta_for_each_cluster/cluster_10.txt # target HMM database: merged_hmms/CBM34.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM34/CBM34_cluster_10.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: SFV39905.1|CBM34|GH13_20 [L=589] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-18 52.1 0.0 8.9e-18 51.2 0.0 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.2 0.0 8.9e-18 8.9e-18 1 114 [. 6 124 .. 6 136 .. 0.86 Alignments for each domain: == domain 1 score: 51.2 bits; conditional E-value: 8.9e-18 CBM34.hmm 1 iyHrprspfgyvydgdtlhirLrtkkddvksVtlrygdpy........wseeeelpMkkegsdelfdyweatikl.epgrlrYyF 76 i+H+++ +++ +++++r+r k++dv++++l+ygd y w + +Mk + + d+w +t++l +++rl+Y F SFV39905.1|CBM34|GH13_20 6 IFHDAQGAMVFETGVNAITLRFRSKHEDVAKAELLYGDMYdgpgskdeWH-PTVAKMKLILRSSSIDFWGVTVQLpKTRRLKYAF 89 799999999999999******************************99554.88999***************************** PP CBM34.hmm 77 eledgd.ekvyygengfsgegpedlepasyqgnvfevpy 114 l +++ e+++y+ ++++ ++ +l + f+vpy SFV39905.1|CBM34|GH13_20 90 HLIASSgEEYLYDSHKIELYTADSL----THTAPFIVPY 124 ***9999*********995555555....3344455555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (589 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.74 // Query: AWZ39823.1|CBM34|GH13_20 [L=589] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-21 62.7 0.3 4.5e-21 61.8 0.3 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.8 0.3 4.5e-21 4.5e-21 1 114 [. 6 127 .. 6 133 .. 0.92 Alignments for each domain: == domain 1 score: 61.8 bits; conditional E-value: 4.5e-21 CBM34.hmm 1 iyHrprspfgyvydgdtlhirLrtkkddvksVtlrygdpy...........wseeeelpMkkegsdelfdyweatikl.epgrlr 73 iyHrp s+++y+ ++++ +++L+tk+ d+++V+++ g p+ w+ + +M k +++ +d+we+++++ ++ l+ AWZ39823.1|CBM34|GH13_20 6 IYHRPASEMAYMANKQNYRLQLKTKHRDITRVQVIFGAPQmlvkdsgqtdvWK-YATKEMDKRLQNGIYDVWEVKLPIpVTRKLK 89 8*************************************************776.9***********************99***** PP CBM34.hmm 74 YyFeledgd.ekvyygengfsgegpedlepasyqgnvfevpy 114 Y F l d + ++++y++n ++ ++p+ ++ + f +py AWZ39823.1|CBM34|GH13_20 90 YAFHLLDREgNELLYDANLMQLYTPKAV----QEMTGFLTPY 127 *******999********9997777766....4555565665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (589 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.25 // Query: AEN79094.1|CBM34|GH13 [L=607] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-23 69.1 0.1 4.7e-23 68.2 0.1 1.4 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.2 0.1 4.7e-23 4.7e-23 1 117 [. 6 130 .. 6 133 .. 0.93 Alignments for each domain: == domain 1 score: 68.2 bits; conditional E-value: 4.7e-23 CBM34.hmm 1 iyHrprspfgyvydgdtlhirLrtkkddvksVtlrygdpy..........wseeeelpMkkegsdelfdyweatikl.epgrlrYyFe 77 i+H+p+s++gy+ ++++ +rLrt ++d +++ ++yg p ++ +l+M+k +++fdywea +++ ++r++Y F+ AEN79094.1|CBM34|GH13 6 IFHHPESEMGYLTKQNKYCVRLRTRHGDFARIRVIYGAPCaealrniegnTWAFDQLEMTKYLVNGEFDYWEALLPVsSKHRIKYAFR 93 79************************************************556*********************************** PP CBM34.hmm 78 ledgd.ekvyygengfsgegpedlepasyqgnvfevpyine 117 l d + +++ygen ++ + ++ q + f++py+n+ AEN79094.1|CBM34|GH13 94 LLDATdGEYLYGENALKIFNLQNV----AQMRGFITPYLNK 130 **9888*********996666665....7899999999986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (607 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.82 // Query: ASR41512.1|CBM34|GH13_20 [L=592] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-24 72.5 0.2 3.7e-24 71.8 0.2 1.4 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.8 0.2 3.7e-24 3.7e-24 1 116 [. 6 129 .. 6 133 .. 0.91 Alignments for each domain: == domain 1 score: 71.8 bits; conditional E-value: 3.7e-24 CBM34.hmm 1 iyHrprspfgyvydgdtlhirLrtkkddvksVtlrygdpy...........wseeeelpMkkegsdelfdyweatikl.epgrlr 73 iyHrp s+++y+++ d+++i Lr+k++d+ +V+++ygdpy w + + ++ k+ dyw++++++ + +rl ASR41512.1|CBM34|GH13_20 6 IYHRPNSEWAYMSTPDEFVINLRAKHNDLSKVEILYGDPYdktlteantskW-NYQVKELVKNLRGVSADYWQVKLSIpASRRLA 89 8**********************************************99955.599999999999999**********9****** PP CBM34.hmm 74 YyFeledgd.ekvyygengfsgegpedlepasyqgnvfevpyin 116 Y F++++++ e+++y+++++ ++++l f++py+ ASR41512.1|CBM34|GH13_20 90 YAFRIYGQEsEQFLYDDRKLAPFSETSL----HDLVAFRTPYLD 129 ******9999***********8888888....556666678775 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (592 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.20 // Query: AWZ38853.1|CBM34|GH13_20 [L=589] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-21 62.7 0.3 4.5e-21 61.8 0.3 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.8 0.3 4.5e-21 4.5e-21 1 114 [. 6 127 .. 6 133 .. 0.92 Alignments for each domain: == domain 1 score: 61.8 bits; conditional E-value: 4.5e-21 CBM34.hmm 1 iyHrprspfgyvydgdtlhirLrtkkddvksVtlrygdpy...........wseeeelpMkkegsdelfdyweatikl.epgrlr 73 iyHrp s+++y+ ++++ +++L+tk+ d+++V+++ g p+ w+ + +M k +++ +d+we+++++ ++ l+ AWZ38853.1|CBM34|GH13_20 6 IYHRPASEMAYMANKQNYRLQLKTKHRDITRVQVIFGAPQmlvkdsgqtdvWK-YATKEMDKRLQNGIYDVWEVKLPIpVTRKLK 89 8*************************************************776.9***********************99***** PP CBM34.hmm 74 YyFeledgd.ekvyygengfsgegpedlepasyqgnvfevpy 114 Y F l d + ++++y++n ++ ++p+ ++ + f +py AWZ38853.1|CBM34|GH13_20 90 YAFHLLDREgNELLYDANLMQLYTPKAV----QEMTGFLTPY 127 *******999********9997777766....4555565665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (589 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.01 // Query: QIA89090.1|CBM34|GH13_20 [L=589] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-22 64.2 0.3 1.6e-21 63.3 0.3 1.5 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.3 0.3 1.6e-21 1.6e-21 1 114 [. 6 127 .. 6 133 .. 0.92 Alignments for each domain: == domain 1 score: 63.3 bits; conditional E-value: 1.6e-21 CBM34.hmm 1 iyHrprspfgyvydgdtlhirLrtkkddvksVtlrygdpy...........wseeeelpMkkegsdelfdyweatikl.epgrlr 73 iyHrp s+++y+ ++++ +++L+tk+ d+++V+++ g p+ w+ + +M k +++ +d+we+++++ +++ l+ QIA89090.1|CBM34|GH13_20 6 IYHRPASEMAYMANKQNYRLQLKTKHRDITRVQVIFGAPQmlvkdsgqtdvWK-YATKEMDKRLQNGIYDVWEVKLPIpATRKLK 89 8*************************************************776.9***********************9****** PP CBM34.hmm 74 YyFeledgd.ekvyygengfsgegpedlepasyqgnvfevpy 114 Y F l d + ++++y++n ++ ++p+ ++ + f +py QIA89090.1|CBM34|GH13_20 90 YAFHLLDREgNELLYDANLMQLYTPKAV----QEMTGFLTPY 127 *******999********9997777766....4555565665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (589 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.20 // Query: QHQ70772.1|CBM34|GH13_20 [L=589] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-22 64.6 0.2 1.1e-21 63.8 0.2 1.4 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.8 0.2 1.1e-21 1.1e-21 1 114 [. 6 127 .. 6 133 .. 0.92 Alignments for each domain: == domain 1 score: 63.8 bits; conditional E-value: 1.1e-21 CBM34.hmm 1 iyHrprspfgyvydgdtlhirLrtkkddvksVtlrygdpy...........wseeeelpMkkegsdelfdyweatikl.epgrlr 73 iyHrp s+++y+ d+++ +++L+tk+ d+++V ++ g p+ w e + +M k +++ +d+we+++++ +++ l+ QHQ70772.1|CBM34|GH13_20 6 IYHRPASEMAYMADKQNYRLQLKTKHRDITRVRVIFGAPQmlvkdsgqtdaW-EYATKEMDKRLQNGIYDVWEVKLPIpATRKLK 89 8*************************************************55.6************************9****** PP CBM34.hmm 74 YyFeledgd.ekvyygengfsgegpedlepasyqgnvfevpy 114 Y F l d + ++++y++n ++ ++p+ ++ + f +py QHQ70772.1|CBM34|GH13_20 90 YAFHLLDREgNELLYDANLMQLYTPKAV----QEMTGFLTPY 127 *******999********9997777766....4555565665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (589 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.17 // Query: QCQ04929.1|CBM34|GH13_20 [L=589] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-22 64.0 0.2 1.8e-21 63.1 0.2 1.4 1 CBM34.hmm Domain annotation for each model (and alignments): >> CBM34.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.1 0.2 1.8e-21 1.8e-21 1 114 [. 6 127 .. 6 133 .. 0.91 Alignments for each domain: == domain 1 score: 63.1 bits; conditional E-value: 1.8e-21 CBM34.hmm 1 iyHrprspfgyvydgdtlhirLrtkkddvksVtlrygdpy...........wseeeelpMkkegsdelfdyweatikl.epgrlr 73 iyHrp s+++y+ d+++ +++L+tk+ d+++V ++ g p+ w e + +M k +++ +d+we+++++ +++ l+ QCQ04929.1|CBM34|GH13_20 6 IYHRPASEMAYMADKQNYRLQLKTKHRDITRVRVIFGAPQmlvkdsgqtdaW-EYATKEMDKRLQNGIYDVWEVKLPIpATRKLK 89 8*************************************************55.6************************9****** PP CBM34.hmm 74 YyFeledgd.ekvyygengfsgegpedlepasyqgnvfevpy 114 Y F l d + ++++y++n ++ ++p+ ++ + f +py QCQ04929.1|CBM34|GH13_20 90 YAFHLLDRKgNELLYDANLMQLYTPKAV----QEMTGFLTPY 127 ******9999********9997777766....4555565665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (589 residues searched) Target model(s): 1 (120 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.48 // [ok]