# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM32/fasta_for_each_cluster/cluster_78.txt # target HMM database: merged_hmms/CBM32.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM32/CBM32_cluster_78.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: QLG39806.1|CBM32|CBM47|GH53 [L=1453] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-44 137.5 15.4 5.7e-26 77.6 4.8 3.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 77.6 4.8 5.7e-26 5.7e-26 9 122 .. 43 163 .. 36 166 .. 0.75 2 ! 64.0 2.9 9.7e-22 9.7e-22 2 111 .. 827 937 .. 825 974 .. 0.79 Alignments for each domain: == domain 1 score: 77.6 bits; conditional E-value: 5.7e-26 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag.......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekg 82 ss++ + gg+ enavDg+ +t+Ws+++ +wltv+Lg+ +++++++ltw + + + ++ vevS+Dg+tWt+va+ + QLG39806.1|CBM32|CBM47|GH53 43 SSEDLQWGGNKENAVDGKGDTKWSASSptsidhpHWLTVNLGASYNLSGLELTWkDA-NEVVKFLVEVSEDGNTWTPVADHS 123 3455666699***************733467789********************943.56******************9876 PP CBM32.hmm 83 .nttdgttetitfd.kpvtaryvRltvtkra.tnawgasiaEl 122 n + ++++d ++ ++yv++t+ a t++w i+El QLG39806.1|CBM32|CBM47|GH53 124 aNDKAE--SQVNLDfEAEAVQYVKVTIPYYAgTDWW-PGISEL 163 242212..255666544446*******776645444.557776 PP == domain 2 score: 64.0 bits; conditional E-value: 9.7e-22 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 atass+ ++++ + ++++ a+D dp+t W +++ w +vdLg++ ++k+++ + ++ +yk+evS+D+k++++v+ QLG39806.1|CBM32|CBM47|GH53 827 ATASSS-AGTGGGKDNSPGGAIDSDPTTSWGTDEsvqSWWQVDLGATAVIRKLEMSMwSG---GIKYKIEVSNDNKNFVKVV 904 455555.4666666689***************744788******************7766...89****************9 PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtkra 111 ++++ + +t + +++ ++ary++lt+t+ + QLG39806.1|CBM32|CBM47|GH53 905 DTTSDVVvST-SpRHILPAGTEARYIKLTITAGS 937 8875444455.32556666688********6632 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1453 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 124.51 // Query: QZN74904.1|CBM32|CBM47|GH53 [L=1458] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-47 145.2 18.9 3.1e-27 81.7 5.3 3.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 81.7 5.3 3.1e-27 3.1e-27 16 122 .. 51 165 .. 38 167 .. 0.78 2 ! 68.1 5.6 5.1e-23 5.1e-23 2 121 .. 834 951 .. 832 988 .. 0.81 Alignments for each domain: == domain 1 score: 81.7 bits; conditional E-value: 3.1e-27 CBM32.hmm 16 gggaenavDgdpntrWssag.......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gt 88 +g+ e+avDgd nt+Ws+++ +wlt+dLg+p+++++ +ltw ++ +++ +y +evS+Dg++W tv+++++ d ++ QZN74904.1|CBM32|CBM47|GH53 51 EGQKEKAVDGDVNTHWSASSpssesnpHWLTIDLGAPYELSGAELTWkDK-DQVVKYLIEVSDDGNNWSTVVDQTTN-DiKQ 130 3679**************633456789********************865.88******************988652.3233 PP CBM32.hmm 89 te.titfdkpvtaryvRltvtkra.tnawgasiaEl 122 t+ + +f++ ++++yv++t+ a + +w+ i+El QZN74904.1|CBM32|CBM47|GH53 131 TVaSEEFQTRTSVQYVKVTIPYYAgA-TWWPGISEL 165 4546699987889*******655533.344556665 PP == domain 2 score: 68.1 bits; conditional E-value: 5.1e-23 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 atass++ + ++++ +++e a+D++pnt W ++ w +vdLg++ +++k+++ + ++ +yk+evS+D++++++v+ QZN74904.1|CBM32|CBM47|GH53 834 ATASSSAGTGGNQA-NSPEGAIDNNPNTSWGTDKsigSWWQVDLGQVANLRKIEMSMwSG---GIKYKIEVSNDNQNFVKVV 911 67777776777777.99***************734778******************7766...89****************9 PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtkratnawgasiaE 121 ++++ + +t + +++ +++ry+R+t+t+ +w + E QZN74904.1|CBM32|CBM47|GH53 912 DTTSDVVvST-ApSHVLPEGTEGRYIRVTITA--GPTW-VGFME 951 8875444455.33778888889********65..2223.44444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1458 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 131.57 // Query: QKS55644.1|CBM32|CBM47|GH53 [L=1458] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-41 125.5 17.2 1.3e-22 66.7 5.2 3.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.7 5.2 1.3e-22 1.3e-22 8 107 .. 42 146 .. 35 178 .. 0.76 2 ! 64.1 2.8 8.9e-22 8.9e-22 2 121 .. 832 951 .. 829 975 .. 0.80 3 ? -3.7 0.0 0.85 0.85 61 82 .. 1116 1138 .. 1105 1168 .. 0.61 Alignments for each domain: == domain 1 score: 66.7 bits; conditional E-value: 1.3e-22 CBM32.hmm 8 essssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 +s+++++g ++ + +vDgd+nt+Ws++ g +w++vdLg+++++++ ++ w + + +y+ve+S D ++W tva+ QKS55644.1|CBM32|CBM47|GH53 42 SSEYKEWG-SDKTHLVDGDINTHWSTTaGvtadkpEWVIVDLGETYKLSGAEIRWrdN---TNVKYTVETSADQQEWSTVAD 119 33455555.89***************742456789********************843...479****************98 PP CBM32.hmm 81 kgnttdgt..te.titfdkpvtaryvRltv 107 + + + ++ + tf+k+ ++ry+Rl++ QKS55644.1|CBM32|CBM47|GH53 120 QRENA--DaiQVaDLTFEKN-DVRYIRLNI 146 76422..2334447788843.68*****99 PP == domain 2 score: 64.1 bits; conditional E-value: 8.9e-22 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWtt 77 atass+ ++++ + +++++ a+D+dp+t W +++ +w tvdL+++ +++k+++ + ++ +y++ vS+D+++++t QKS55644.1|CBM32|CBM47|GH53 832 ATASSS-EGNGGGKDNSPAGAIDNDPTTSWGTGQgkgenTWWTVDLEQVANLRKIEMSMwSG---GIKYRIDVSDDNEHFKT 909 455665.4666666689***************73356789******************7766...89*************** PP CBM32.hmm 78 vaekgnttd.gtte.titfdkpvtaryvRltvtkratnawgasiaE 121 v+++++ + +t + +++ +++ryvR+t+t+ + +w + E QKS55644.1|CBM32|CBM47|GH53 910 VVDTTSDVVvST-SpSHVLPEGTEGRYVRVTITAGS--SW-VGFME 951 *98875444455.33778888889********6532..34.44444 PP == domain 3 score: -3.7 bits; conditional E-value: 0.85 CBM32.hmm 61 ikdykvevStD.gktWttvaekg 82 k +++++S+ ++W++ ae++ QKS55644.1|CBM32|CBM47|GH53 1116 SKAVTLQISSSqLSSWVKSAEVQ 1138 57778888854147888776643 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1458 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 131.81 // Query: QOS79802.1|CBM32|CBM47|GH53 [L=1452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-44 135.8 16.1 2.3e-24 72.5 5.7 2.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.5 5.7 2.3e-24 2.3e-24 11 123 .. 46 164 .. 36 165 .. 0.78 2 ! 67.6 2.7 7.4e-23 7.4e-23 2 111 .. 827 937 .. 825 973 .. 0.78 Alignments for each domain: == domain 1 score: 72.5 bits; conditional E-value: 2.3e-24 CBM32.hmm 11 ssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekg.n 83 + ++g g+ enavDg+ +t+Ws++ + +wl vdLg +++++ +ltw + +++ ++ vevS Dg++Wt+va+++ n QOS79802.1|CBM32|CBM47|GH53 46 DLKWG-GNKENAVDGKGDTKWSADraTsvdqpHWLMVDLGDSYQLSGAELTWkDA-NQVVKFLVEVSADGTNWTKVADQTsN 125 33344.89***************644256789********************844.67******************998734 PP CBM32.hmm 84 ttdgtteti.tfd.kpvtaryvRltvtkra.tnawgasiaEla 123 +t ++i ++d ++ +++v++t+ a t +w+ i+E++ QOS79802.1|CBM32|CBM47|GH53 126 ET---AQSIaNLDfQAGAVQFVKVTIPYYAgT-DWWPGISEFQ 164 32...24677888878878*******776645.4446788885 PP == domain 2 score: 67.6 bits; conditional E-value: 7.4e-23 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 atass++ +++ ++ +++ a+D +pnt W +++ w +vdLg++ ++k+++ + ++ +yk+evS+D+k++++v+ QOS79802.1|CBM32|CBM47|GH53 827 ATASSSA-GTGGGEANSPGGAIDSNPNTSWGTDQsvgSWWQVDLGATAVIRKLEMSMwSG---GIKYKIEVSDDNKNFVKVV 904 4566665.455555589***************845789******************7766...89****************9 PP CBM32.hmm 80 ekgnttd.gttetitfdkpvtaryvRltvtkra 111 ++++ + +t+ + +++ ++ary+Rltvt+ + QOS79802.1|CBM32|CBM47|GH53 905 DTTSDVVvSTNPRHILPAGTEARYIRLTVTAGS 937 887544445534556666788********6632 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1452 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.22 // Query: AWV34857.1|CBM32|GH53 [L=1159] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-22 65.7 7.2 2.8e-22 65.7 7.2 3.0 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.7 7.2 2.8e-22 2.8e-22 10 120 .. 51 164 .. 45 169 .. 0.79 2 ? -2.3 0.1 0.31 0.31 52 82 .. 220 255 .. 212 278 .. 0.61 3 ? -4.1 0.0 1 1 60 74 .. 896 910 .. 876 921 .. 0.75 4 ? -1.1 0.0 0.13 0.13 46 79 .. 948 985 .. 944 1026 .. 0.73 Alignments for each domain: == domain 1 score: 65.7 bits; conditional E-value: 2.8e-22 CBM32.hmm 10 sssaaggggaenavDgdp.ntrWssag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 s+ ag ++a navD d+ nt+W +++ +wl+vdL++++++++ ++ w a+ ++i++y++evS D k Wttv++k++ ++ +t+ AWV34857.1|CBM32|GH53 51 DSELAG-YEAGNAVDSDEwNTHWTANDgsfpHWLEVDLQGAYDLSGATVIWnAW-SYINQYTIEVSRDHKVWTTVVDKSQSSSvEQTQ 136 455667.9********9868*****844689********************654.88******************9886433223334 PP CBM32.hmm 91 titfd.kpvtaryvRltvtkratnawgasia 120 + f+ ++ yvR++ t+ + ++w a+i+ AWV34857.1|CBM32|GH53 137 YNAFKlR--NVSYVRVNLTGINGGKW-AAIN 164 6688854..56*******77665567.5565 PP == domain 2 score: -2.3 bits; conditional E-value: 0.31 CBM32.hmm 52 vltw.....aen.grikdykvevStDgktWttvaekg 82 ++ w a + +r+ +++v++S g+ + va+++ AWV34857.1|CBM32|GH53 220 QVAWdvippA-EySRPGTFTVSGSISGTVQKAVAKVT 255 5566543331.34899999999999996544444443 PP == domain 3 score: -4.1 bits; conditional E-value: 1 CBM32.hmm 60 rikdykvevStDgkt 74 + y++ S Dg++ AWV34857.1|CBM32|GH53 896 DYPAYNIHLSVDGTS 910 556789999999965 PP == domain 4 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 46 ttvdkvvltw.aen..grikdykvevS.tDgktWttva 79 +++v++++ ae+ +++++++++ +t+++ AWV34857.1|CBM32|GH53 948 EVIKAVRYNPtAEQivFNPSHFSIYAAgYAEVGYTDLK 985 67999999997554479999**9998722334466664 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1159 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 135.09 // Query: ANY66126.1|CBM32|CBM47|GH53 [L=1509] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-45 138.6 12.2 2.1e-25 75.8 3.5 3.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.8 3.5 2.1e-25 2.1e-25 13 121 .. 51 162 .. 40 167 .. 0.74 2 ? -2.5 0.0 0.37 0.37 100 108 .. 293 302 .. 266 338 .. 0.60 3 ! 66.4 1.0 1.7e-22 1.7e-22 3 111 .. 826 934 .. 823 964 .. 0.78 Alignments for each domain: == domain 1 score: 75.8 bits; conditional E-value: 2.1e-25 CBM32.hmm 13 aaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekg.nttdgt 88 ++ g++ e+avDg+p+t Ws+a+ +wl vdLg+++++++v++tw e + i +y vevS D+ +Wt++a+k+ n + ANY66126.1|CBM32|CBM47|GH53 51 QW-GQPKEYAVDGNPDTAWSAASavsptHWLKVDLGSEYDLSGVEITWKE-DEIVKYIVEVSPDDVNWTVAADKSaNA--AK 128 34.489***************8446789*******************943.56****************998876342..22 PP CBM32.hmm 89 te..titfdkpvtaryvRltvtkra.tnawgasiaE 121 ++ + f+ + + ryvR+t++ a +++w i E ANY66126.1|CBM32|CBM47|GH53 129 QQtaSLAFE-ADSMRYVRVTISFYAgSGWW-PGIKE 162 231355666.4468*******444433333.44555 PP == domain 2 score: -2.5 bits; conditional E-value: 0.37 CBM32.hmm 100 aryvRltv.t 108 + yvRl+v + ANY66126.1|CBM32|CBM47|GH53 293 VNYVRLRVwN 302 4566666521 PP == domain 3 score: 66.4 bits; conditional E-value: 1.7e-22 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltwaen.grikdykvevStDgktWttvae 80 ++ss++++s+ + +++e avD +++t W ++ g w vdLg++ v+kvvl+ + + +ykve+S+Dg t++t+a+ ANY66126.1|CBM32|CBM47|GH53 826 ATSSSNAGSGGGKANAPEGAVDQNEGTSWGTDkGagSWWMVDLGQASLVKKVVLN---KwAGVVHYKVEISDDGATFRTAAD 904 4566666777777799***************743678******************...3356******************87 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkra 111 +++ ++ ++ +++++ t+ry+++t+t+ + ANY66126.1|CBM32|CBM47|GH53 905 TQTLAMPS-DSHKLTDNNTGRYLKVTITEGQ 934 65554454.57799966679*******7732 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1509 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.73 // Query: APO46445.1|CBM32|CBM47|GH53 [L=1458] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-42 130.7 17.0 6.4e-23 67.8 5.9 3.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.2 3.2 9.5e-23 9.5e-23 10 107 .. 46 148 .. 37 174 .. 0.76 2 ! 67.8 5.9 6.4e-23 6.4e-23 2 121 .. 834 951 .. 832 984 .. 0.82 Alignments for each domain: == domain 1 score: 67.2 bits; conditional E-value: 9.5e-23 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgn 83 ++ ++g ++ e +vDg+ +t+W+++ g qw+ +dLg+++++++ ++tw + +++ +y ve+S D + Wt+v+++++ APO46445.1|CBM32|CBM47|GH53 46 EYLEWG-SKKEHLVDGKSDTHWAAKaGvtteqpQWVMIDLGEAYNLSGAEITWrE--NTVVKYMVETSADQQAWTKVVDQSE 124 344444.899**************641446789********************63..46******************98865 PP CBM32.hmm 84 ttdgtte..titfdkpvtaryvRltv 107 d++ + + tf+++ ++ry+Rl++ APO46445.1|CBM32|CBM47|GH53 125 NADPK-QiaDLTFEQN-DVRYIRLNI 148 33344.2236677754.68******9 PP == domain 2 score: 67.8 bits; conditional E-value: 6.4e-23 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 atass++ + ++++ +++e a+D++pnt W +++ w +vdLg++ +++k+++ + ++ +y++evS+D+k++++v+ APO46445.1|CBM32|CBM47|GH53 834 ATASSSAGTGGNQA-NSPEGAIDNNPNTSWGTDQskdSWWQVDLGQVANLRKIEMSMwSG---GIKYTIEVSNDNKNFVKVV 911 67777776777777.99***************745789******************7766...89****************9 PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtkratna.wgasiaE 121 ++++ + +t + +++ +++ry+R+t+++ + w + E APO46445.1|CBM32|CBM47|GH53 912 DTTSDVVvST-ApSHVLPEGTEGRYIRVTIKT---GPtW-VGFME 951 8875444455.33778888889********22...2214.44444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1458 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 145.60 // Query: WJM06245.1|CBM32|CBM47|GH53 [L=1461] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-47 145.3 18.3 4.6e-27 81.2 5.4 2.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 81.2 5.4 4.6e-27 4.6e-27 16 123 .. 51 166 .. 38 167 .. 0.79 2 ! 68.7 5.0 3.2e-23 3.2e-23 2 121 .. 836 953 .. 834 986 .. 0.82 Alignments for each domain: == domain 1 score: 81.2 bits; conditional E-value: 4.6e-27 CBM32.hmm 16 gggaenavDgdpntrWssag.......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgtt 89 +g+ e+avDgd nt+Ws+++ +wlt+dLg+p+++++ +ltw ++ +++ +y +evS+Dg++W tv+++++ + ++t WJM06245.1|CBM32|CBM47|GH53 51 EGQKEKAVDGDVNTHWSASSpssesnpHWLTIDLGAPYELSGAELTWkDK-DQVIKYLIEVSDDGNNWSTVVDQTTNEIKQT 131 3679**************633456789********************865.88******************98875322333 PP CBM32.hmm 90 e.titfdkpvtaryvRltvtkra.tnawgasiaEla 123 + + +f++ ++++yv++t+ a + +w+ i+E++ WJM06245.1|CBM32|CBM47|GH53 132 VaSEEFQTSTSVQYVKVTIPYYAgA-TWWPGISEFK 166 546699988899*******665533.4546688875 PP == domain 2 score: 68.7 bits; conditional E-value: 3.2e-23 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 atass++ + ++++ +++e a+D++pnt W +++ w +vdLg++ +++k+++ + ++ +y++evS+D+k++++v+ WJM06245.1|CBM32|CBM47|GH53 836 ATASSSAGTGGNQA-NSPEGAIDNNPNTSWGTDQskdSWWQVDLGQVANLRKIEMSMwSG---GIKYTIEVSNDNKNFVKVV 913 67777776777777.99***************745789******************7766...89****************9 PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtkratna.wgasiaE 121 ++++ + +t + +++ +++ry+R+t+++ + w + E WJM06245.1|CBM32|CBM47|GH53 914 DTTSDVVvST-ApSHVLPEGTEGRYIRVTIKT---GPtW-VGFME 953 8875444455.33778888889********22...2214.44444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1461 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 149.64 // Query: WFA86346.1|CBM32|CBM47|GH53 [L=1458] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-42 129.2 17.3 6.4e-23 67.8 5.9 2.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.0 3.5 2.3e-22 2.3e-22 7 107 .. 43 148 .. 37 175 .. 0.76 2 ! 67.8 5.9 6.4e-23 6.4e-23 2 121 .. 834 951 .. 832 984 .. 0.82 Alignments for each domain: == domain 1 score: 66.0 bits; conditional E-value: 2.3e-22 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvae 80 + ++ + +++ e +vDg+ +t+W+++ g qw+ +dLg+ +++++ ++tw + +++ +y ve+S D + Wt va+ WFA86346.1|CBM32|CBM47|GH53 43 VS-TEYLEHWSKKEHLVDGKSDTHWAAKaGvtteqpQWVMIDLGEDYNLSGAEITWrE--NTVVKYMVETSADQQAWTNVAD 121 43.3334445889**************641446789********************63..46******************99 PP CBM32.hmm 81 kgnttdgtte..titfdkpvtaryvRltv 107 +++ d++ + + tf++ ++ry+Rl++ WFA86346.1|CBM32|CBM47|GH53 122 QNENADPK-QiaDLTFQQ-NDVRYIRLNI 148 86433344.223667774.468******9 PP == domain 2 score: 67.8 bits; conditional E-value: 6.4e-23 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 atass++ + ++++ +++e a+D++pnt W +++ w +vdLg++ +++k+++ + ++ +y++evS+D+k++++v+ WFA86346.1|CBM32|CBM47|GH53 834 ATASSSAGTGGNQA-NSPEGAIDNNPNTSWGTDQskdSWWQVDLGQVANLRKIEMSMwSG---GIKYTIEVSNDNKNFVKVV 911 67777776777777.99***************745789******************7766...89****************9 PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtkratna.wgasiaE 121 ++++ + +t + +++ +++ry+R+t+++ + w + E WFA86346.1|CBM32|CBM47|GH53 912 DTTSDVVvST-ApSHVLPEGTEGRYIRVTIKT---GPtW-VGFME 951 8875444455.33778888889********22...2214.44444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1458 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 153.33 // Query: XWN45671.1|CBM32|CBM47|GH53 [L=1458] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-47 145.2 18.9 3.1e-27 81.7 5.3 3.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 81.7 5.3 3.1e-27 3.1e-27 16 122 .. 51 165 .. 38 167 .. 0.78 2 ! 68.1 5.6 5.1e-23 5.1e-23 2 121 .. 834 951 .. 832 988 .. 0.81 Alignments for each domain: == domain 1 score: 81.7 bits; conditional E-value: 3.1e-27 CBM32.hmm 16 gggaenavDgdpntrWssag.......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gt 88 +g+ e+avDgd nt+Ws+++ +wlt+dLg+p+++++ +ltw ++ +++ +y +evS+Dg++W tv+++++ d ++ XWN45671.1|CBM32|CBM47|GH53 51 EGQKEKAVDGDVNTHWSASSpssesnpHWLTIDLGAPYELSGAELTWkDK-DQVVKYLIEVSDDGNNWSTVVDQTTN-DiKQ 130 3679**************633456789********************865.88******************988652.3233 PP CBM32.hmm 89 te.titfdkpvtaryvRltvtkra.tnawgasiaEl 122 t+ + +f++ ++++yv++t+ a + +w+ i+El XWN45671.1|CBM32|CBM47|GH53 131 TVaSEEFQTRTSVQYVKVTIPYYAgA-TWWPGISEL 165 4546699987889*******655533.344556665 PP == domain 2 score: 68.1 bits; conditional E-value: 5.1e-23 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 atass++ + ++++ +++e a+D++pnt W ++ w +vdLg++ +++k+++ + ++ +yk+evS+D++++++v+ XWN45671.1|CBM32|CBM47|GH53 834 ATASSSAGTGGNQA-NSPEGAIDNNPNTSWGTDKsigSWWQVDLGQVANLRKIEMSMwSG---GIKYKIEVSNDNQNFVKVV 911 67777776777777.99***************734778******************7766...89****************9 PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtkratnawgasiaE 121 ++++ + +t + +++ +++ry+R+t+t+ +w + E XWN45671.1|CBM32|CBM47|GH53 912 DTTSDVVvST-ApSHVLPEGTEGRYIRVTITA--GPTW-VGFME 951 8875444455.33778888889********65..2223.44444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1458 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 130.50 // Query: XMN12464.1|CBM32|CBM47|GH53 [L=1458] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-46 141.9 20.6 3.9e-27 81.4 5.7 2.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 81.4 5.7 3.9e-27 3.9e-27 16 122 .. 51 165 .. 38 167 .. 0.78 2 ! 65.2 6.9 4.1e-22 4.1e-22 2 121 .. 834 951 .. 832 985 .. 0.81 Alignments for each domain: == domain 1 score: 81.4 bits; conditional E-value: 3.9e-27 CBM32.hmm 16 gggaenavDgdpntrWssag.......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gt 88 +g+ e+avDgd nt+Ws+++ +wlt+dLg+p+++++ +ltw ++ +++ +y +evS+Dg++W tv+++++ d ++ XMN12464.1|CBM32|CBM47|GH53 51 EGQKEKAVDGDVNTHWSASSpstesnpHWLTIDLGAPYELSGAELTWkDK-DQVVKYLIEVSDDGNNWSTVVDQTTN-DiKQ 130 3679**************633456789********************865.88******************988652.3233 PP CBM32.hmm 89 te.titfdkpvtaryvRltvtkra.tnawgasiaEl 122 t+ + +f++ ++++yv++t+ a + +w+ i+El XMN12464.1|CBM32|CBM47|GH53 131 TVaSEEFQTRTSVQYVKVTIPYYAgA-TWWPGISEL 165 4546699987889*******655533.344556665 PP == domain 2 score: 65.2 bits; conditional E-value: 4.1e-22 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 a+ass++ + ++++ +++e a+D++pnt W +++ w +vdLg++ +++k+++ + ++ +y++evS+D++++++v+ XMN12464.1|CBM32|CBM47|GH53 834 AKASSSAGTGGNQA-NSPEGAIDNNPNTSWGTDQskdSWWQVDLGQVANLRKIEMSMwSG---GIKYTIEVSNDNQNFVKVV 911 45666666666666.99***************745789******************7766...89****************9 PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtkratna.wgasiaE 121 ++++ + +t + +++ +++ry+R+t+++ + w + E XMN12464.1|CBM32|CBM47|GH53 912 DTTSDVVvST-ApSHVLPEGTEGRYIRVTIKT---GPtW-VGFME 951 8875444455.33778888889********22...2214.44444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1458 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.61 // Query: XQA50389.1|CBM32|CBM47|GH53 [L=1459] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-40 124.6 16.2 5.7e-22 64.7 4.1 3.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.3 4.2 7.6e-22 7.6e-22 10 107 .. 46 148 .. 37 175 .. 0.76 2 ! 64.7 4.1 5.7e-22 5.7e-22 2 121 .. 834 951 .. 832 981 .. 0.81 Alignments for each domain: == domain 1 score: 64.3 bits; conditional E-value: 7.6e-22 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgn 83 ++ + +++ en+vDg+ +t+W ++ g qw +dLg+ +++++ ++tw + +++ +y ve+S D + Wt+v+++++ XQA50389.1|CBM32|CBM47|GH53 46 EYL-EWESKKENLVDGKSDTHWTAKaGvtseqpQWAMIDLGEDYNLSGAEITWrE--NTVVKYMVETSADQQVWTKVVDQNE 124 333.444899**************642456789********************63..46******************98864 PP CBM32.hmm 84 ttdgtte..titfdkpvtaryvRltv 107 d++ + + tf++ ++ry+Rl++ XQA50389.1|CBM32|CBM47|GH53 125 NADPK-QiaDLTFQQ-NDVRYIRLNI 148 33344.223667774.468******9 PP == domain 2 score: 64.7 bits; conditional E-value: 5.7e-22 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 atass++ + ++++ +++e a+D++pnt W +++ +vdLg++ +++k+++ + ++ +y++evS+D+k++++v+ XQA50389.1|CBM32|CBM47|GH53 834 ATASSSAGTGGNQA-NSPEGAIDNNPNTSWGTDQskdSRWQVDLGQVANLRKIEMSMwSG---GIKYTIEVSNDNKNFVKVV 911 67777776777777.99***************74456679****************7766...89****************9 PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtkratna.wgasiaE 121 ++++ + +t + +++ +++ry+R+t+++ + w + E XQA50389.1|CBM32|CBM47|GH53 912 DTTSDVVvST-ApSHVLPEGTEGRYIRVTIKT---GPtW-VGFME 951 8875444455.33778888889********22...2214.44444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1459 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 154.31 // Query: WWP18487.1|CBM32|CBM47|GH53 [L=1458] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-47 146.8 18.6 5.1e-28 84.2 5.3 2.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 84.2 5.3 5.1e-28 5.1e-28 15 122 .. 50 165 .. 41 167 .. 0.80 2 ! 67.3 5.4 8.9e-23 8.9e-23 2 121 .. 834 951 .. 832 984 .. 0.81 Alignments for each domain: == domain 1 score: 84.2 bits; conditional E-value: 5.1e-28 CBM32.hmm 15 ggggaenavDgdpntrWssag.......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt 88 ++g+ e+avDgd nt+Ws+++ +wlt+dLg+p+++++ +ltw ++ +++ +y +evS+Dg++W tv+++++ + ++ WWP18487.1|CBM32|CBM47|GH53 50 NEGQKEKAVDGDVNTHWSASSptsesnpHWLTIDLGAPYDLSGAELTWkDK-DQVVKYLIEVSDDGNNWSTVVDQTTNEIKQ 130 45789**************633456789********************865.88******************9887532233 PP CBM32.hmm 89 te.titfdkpvtaryvRltvtkra.tnawgasiaEl 122 t+ + +f+++++++yv++t+ a +n+w i+El WWP18487.1|CBM32|CBM47|GH53 131 TVaSEEFQTNTPVQYVKVTIPYYAgANWW-PGISEL 165 3546699988899*******666645445.557776 PP == domain 2 score: 67.3 bits; conditional E-value: 8.9e-23 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 atass++ + ++++ +++e a+D++pnt W +++ w +vdLg++ +++k+++ + ++ +y++evS+D+k++++v+ WWP18487.1|CBM32|CBM47|GH53 834 ATASSSAGTGGNQA-NSPEGAIDNNPNTSWGTDQskdSWWQVDLGQVANLRKIEMSMwSG---GIKYTIEVSNDNKNFVKVV 911 67777776777777.99***************745789******************7766...89****************9 PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtkratna.wgasiaE 121 ++++ + +t + +++ +++ry+R+t+++ + w + E WWP18487.1|CBM32|CBM47|GH53 912 DTTSDVVvST-ApSHLLPEGTEGRYIRVTIKT---GPtW-VGFME 951 8875444455.336677778899*******22...2214.44444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1458 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 159.25 // Query: WWP24787.1|CBM32|CBM47|GH53 [L=1459] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-40 123.7 17.4 9.9e-23 67.2 3.3 3.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.2 3.3 9.9e-23 9.9e-23 10 107 .. 46 148 .. 37 175 .. 0.77 2 ! 60.6 6.3 1e-20 1e-20 2 109 .. 834 942 .. 832 986 .. 0.82 Alignments for each domain: == domain 1 score: 67.2 bits; conditional E-value: 9.9e-23 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgn 83 ++ ++g ++ e +vDg+ +t+W+++ g qw+ +dLg+++++++ ++tw + +++ +y ve+S D + Wt+v+++++ WWP24787.1|CBM32|CBM47|GH53 46 EYLEWG-SKKEHLVDGKSDTHWAAKaGvtteqpQWVMIDLGEAYNLSGAEITWrE--NTVVKYMVETSADQQAWTKVVDQSE 124 344444.899**************641446789********************63..46******************98865 PP CBM32.hmm 84 ttdgtte..titfdkpvtaryvRltv 107 d++ + + tf+++ ++ry+Rl++ WWP24787.1|CBM32|CBM47|GH53 125 NADPK-QiaDLTFEQN-DVRYIRLNI 148 33344.2236677754.68******9 PP == domain 2 score: 60.6 bits; conditional E-value: 1e-20 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 atass++ + ++++ +++e a+D++pnt W +++ w +vdLg++ +++k+++ + ++ +y++evS+D+k++++v+ WWP24787.1|CBM32|CBM47|GH53 834 ATASSSAGTGGNQA-NSPEGAIDNNPNTSWGTDQskdSWWQVDLGQVANLRKIEMSMwSG---GIKYTIEVSNDNKNFVKVV 911 67777776777777.99***************745789******************7766...89****************9 PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtk 109 ++++ + +t + +++ +++ry+ +t+++ WWP24787.1|CBM32|CBM47|GH53 912 DTTSDVVvST-ApSHVLPEGTEGRYILVTIKT 942 8875444455.337788888899*******33 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1459 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 151.72 // Query: XCQ16610.1|CBM32|CBM47|GH53 [L=1458] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-40 125.0 16.9 2.8e-22 65.7 4.3 3.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.6 4.7 1.2e-21 1.2e-21 10 107 .. 46 148 .. 37 175 .. 0.76 2 ! 65.7 4.3 2.8e-22 2.8e-22 2 121 .. 834 951 .. 832 981 .. 0.81 Alignments for each domain: == domain 1 score: 63.6 bits; conditional E-value: 1.2e-21 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgn 83 ++ ++g ++ + +vDg+ +t+W ++ g qw+ +dLg+ +++++ ++tw + +++ +y ve+S D + Wt va++++ XCQ16610.1|CBM32|CBM47|GH53 46 EYLEWG-SKKDHLVDGKSDTHWTATaGvtteqpQWVMIDLGEDYNLSGAEITWrE--NTVVKYMVETSADQQAWTNVADQNE 124 344444.889**************642456789********************63..46******************99864 PP CBM32.hmm 84 ttdgtte..titfdkpvtaryvRltv 107 d++ + + tf++ ++ry+Rl++ XCQ16610.1|CBM32|CBM47|GH53 125 NADPK-QiaDLTFQQ-NDVRYIRLNI 148 33344.223667774.468******9 PP == domain 2 score: 65.7 bits; conditional E-value: 2.8e-22 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 a+ass++ + ++++ +++e a+D++pnt W ++ w +vdLg++ +++k+ + + ++ +y++evS+D+k++++v+ XCQ16610.1|CBM32|CBM47|GH53 834 AKASSSAGTGGNQA-NSPEGAIDNNPNTSWGTDKsidSWWQVDLGQVANLRKIDMSMwSG---GIKYTIEVSNDNKSFVKVV 911 45666666666666.99***************734788******************7766...89****************9 PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtkratna.wgasiaE 121 ++++ + +t + +++ +++ry+R+t+++ + w + E XCQ16610.1|CBM32|CBM47|GH53 912 DTTSDVVvST-ApSHVLPEGTEGRYIRVTIKT---GPtW-VGFME 951 8875444455.33778888889********22...2214.44444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1458 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.79 // Query: XRV57487.1|CBM32|CBM47|GH53 [L=1463] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-43 132.0 17.2 8.9e-25 73.8 3.6 3.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.8 3.6 8.9e-25 8.9e-25 8 107 .. 42 151 .. 35 175 .. 0.76 2 ! 65.5 1.9 3.3e-22 3.3e-22 4 121 .. 838 956 .. 834 977 .. 0.80 3 ? -3.1 0.1 0.57 0.57 68 73 .. 1238 1243 .. 1206 1291 .. 0.50 Alignments for each domain: == domain 1 score: 73.8 bits; conditional E-value: 8.9e-25 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag.......qwltvdLgkpttvdkvvltw.ae..n.grikdykvevStDgktWttv 78 +++++++g g+ e+avDgd ++Ws+ g +wl v+Lg+p+ +++ ++tw +e + ++i +y +evS+Dg+tWt+v XRV57487.1|CBM32|CBM47|GH53 42 SAEDTNWG-GEKEKAVDGDVYSHWSAPGpskandpHWLMVNLGGPYVLSGAEITWkDEddQkDKIIQYVIEVSEDGNTWTQV 122 33344455.89***************633456789********************9444667******************** PP CBM32.hmm 79 aekgnttdgttetitfd..kpvtaryvRltv 107 a+ +++ + +ti++d + + ++yv++t+ XRV57487.1|CBM32|CBM47|GH53 123 ASNTDQI-AE-KTISLDfnTSTAVQYVKVTI 151 9877654.32.2444444255546******9 PP == domain 2 score: 65.5 bits; conditional E-value: 3.3e-22 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 a+s++++++ + +++++ a+D+dp+t W +++ +w tvdLg++ +++k+++ + ++ +y++ +S+D+++++tv+ XRV57487.1|CBM32|CBM47|GH53 838 AASSSAGNGGGKDNSPAGAIDDDPTTSWGTDQgpgenTWWTVDLGQVANLRKIEMSMwSG---GIKYRIDISDDNEHFKTVV 916 445556777777788***************73356789******************7766...89****************9 PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtkratnawgasiaE 121 ++++ + +t + +++ +++ryvR+t+t+ + +w + E XRV57487.1|CBM32|CBM47|GH53 917 DTTSDVVvST-SpSHVLPEGTEGRYVRVTITAGS--SW-VGFME 956 8875444455.33778888889********6533..34.44444 PP == domain 3 score: -3.1 bits; conditional E-value: 0.57 CBM32.hmm 68 vStDgk 73 +St+g+ XRV57487.1|CBM32|CBM47|GH53 1238 ISTNGE 1243 344442 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1463 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.35 // Query: XNR06092.1|CBM32|CBM47|GH53 [L=1459] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-41 127.2 17.3 4.7e-23 68.2 5.7 3.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.4 3.8 1.4e-21 1.4e-21 6 107 .. 42 148 .. 37 175 .. 0.76 2 ! 68.2 5.7 4.7e-23 4.7e-23 2 121 .. 834 951 .. 832 984 .. 0.82 Alignments for each domain: == domain 1 score: 63.4 bits; conditional E-value: 1.4e-21 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 s ++++ +++ ++ e +vDg+ +t+W ++ g qw +dLg+ +++++ ++tw + +++ +y ve+S D + Wt+v+ XNR06092.1|CBM32|CBM47|GH53 42 SVSTEYLEWE-SKKEHLVDGKSDTHWTATaGvtseqpQWAMIDLGEDYNLSGAEITWrE--NTVVKYMVETSADQQAWTKVV 120 4444444444.899**************742456789********************63..46******************9 PP CBM32.hmm 80 ekgnttdgtte..titfdkpvtaryvRltv 107 ++++ d++ + + tf++ ++ry+Rl++ XNR06092.1|CBM32|CBM47|GH53 121 DQSENADPK-QiaDLTFQQ-NDVRYIRLNI 148 886533344.223667774.468******9 PP == domain 2 score: 68.2 bits; conditional E-value: 4.7e-23 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 atass++ + ++++ +++e a+D++pnt W +++ +w +vdLg++ +++k+++ + ++ +y++evS+D+k++++v+ XNR06092.1|CBM32|CBM47|GH53 834 ATASSSAGTGGNQA-NSPEGAIDNNPNTSWGTDQskdNWWQVDLGQVANLRKIEMSMwSG---GIKYTIEVSNDNKNFVKVV 911 67777776777777.99***************745789******************7766...89****************9 PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtkratna.wgasiaE 121 ++++ + +t + +++ +++ry+R+t+++ + w + E XNR06092.1|CBM32|CBM47|GH53 912 DTTSDVVvST-ApSHVLPEGTEGRYIRVTIKT---GPtW-VGFME 951 8875444455.33778888889********22...2214.44444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1459 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 151.40 // Query: XOJ01155.1|CBM32|CBM47|GH53 [L=1459] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-41 128.4 17.2 2.4e-23 69.2 5.4 2.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.8 3.8 1.1e-21 1.1e-21 6 107 .. 42 148 .. 37 175 .. 0.76 2 ! 69.2 5.4 2.4e-23 2.4e-23 2 121 .. 834 951 .. 832 983 .. 0.82 Alignments for each domain: == domain 1 score: 63.8 bits; conditional E-value: 1.1e-21 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 s ++++ +++ ++ e +vDg+ +t+W ++ g qw +dLg+ +++++ ++tw + +++ +y ve+S D + Wt+v+ XOJ01155.1|CBM32|CBM47|GH53 42 SVSTEYLEWE-SKKEHLVDGKSDTHWTATaGvtseqpQWAMIDLGEDYNLSGAEITWrE--NTVVKYMVETSADQQAWTKVV 120 4444444444.899**************742456789********************63..46******************9 PP CBM32.hmm 80 ekgnttdgtte..titfdkpvtaryvRltv 107 ++++ +d++ + + tf++ ++ry+Rl++ XOJ01155.1|CBM32|CBM47|GH53 121 DQSENSDPK-QiaDLTFQQ-NDVRYIRLNI 148 886533344.223667774.468******9 PP == domain 2 score: 69.2 bits; conditional E-value: 2.4e-23 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttva 79 atass++ + ++++ +++e a+D++pnt W +++ w +vdLgk+ +++k+++ + ++ +y++evS+D+k++++v+ XOJ01155.1|CBM32|CBM47|GH53 834 ATASSSAGTGGNQA-NSPEGAIDNNPNTSWGTDQskdSWWQVDLGKVANLRKIEMSMwSG---GIKYTIEVSNDNKNFVKVV 911 67777776777777.99***************745789******************7766...89****************9 PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtkratna.wgasiaE 121 ++++ + +t + +++ +++ry+R+t+++ + w + E XOJ01155.1|CBM32|CBM47|GH53 912 DTTSDVVvST-ApSHVLPEGTEGRYIRVTIKT---GPtW-VGFME 951 8875444455.33778888889********22...2214.44444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1459 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 141.46 // [ok]