# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM32/fasta_for_each_cluster/cluster_63.txt # target HMM database: merged_hmms/CBM32.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM32/CBM32_cluster_63.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: QSL38718.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W QSL38718.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t QSL38718.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + QSL38718.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 59.77 // Query: QIK21479.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QIK21479.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QIK21479.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QIK21479.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QIK21479.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 59.03 // Query: AXW73098.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AXW73098.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AXW73098.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW73098.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW73098.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 63.47 // Query: ARS58292.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ ARS58292.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y ARS58292.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + ARS58292.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ ARS58292.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.53 // Query: AYB62406.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-30 90.5 2.2 6e-30 90.5 2.2 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.1 0.18 0.18 59 95 .. 150 186 .. 124 200 .. 0.67 2 ? -2.4 0.1 0.34 0.34 106 106 .. 289 289 .. 240 325 .. 0.56 3 ! 90.5 2.2 6e-30 6e-30 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.18 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgt.tetitfd 95 g++ + ++++ g +t v++ +ntt + +++ +f+ AYB62406.1|CBM32 150 GDVMQATLSYTRTGPIFTSVVDITNTT-PAiENSMPFA 186 667777888888888888888877654.2212244555 PP == domain 2 score: -2.4 bits; conditional E-value: 0.34 CBM32.hmm 106 t 106 AYB62406.1|CBM32 289 S 289 2 PP == domain 3 score: 90.5 bits; conditional E-value: 6e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt ++++++ + AYB62406.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAVQTSSDGVNWTNIYATSSGIA-YgH 439 33..344445589********758*****65114579********************878...******************87655332.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+ +t+rat wg+si E++ AYB62406.1|CBM32 440 AVLsNLH--GSGRYVRMLGTQRAT-PWGYSIDEMQ 471 4444887..568*******88876.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.38 // Query: ANB71439.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-30 89.9 5.2 9e-30 89.9 5.2 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.15 0.15 59 76 .. 291 310 .. 275 330 .. 0.51 2 ! 89.9 5.2 9e-30 9e-30 6 123 .. 346 466 .. 342 467 .. 0.80 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.15 CBM32.hmm 59 grikdykvevStD..gktWt 76 +++ y+++v + gk W ANB71439.1|CBM32 291 TTAGGYQLYVGDAntGKRWS 310 33444444444221244443 PP == domain 2 score: 89.9 bits; conditional E-value: 9e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 +a++sss++++ ++++a+Dg++ +trW s ++ qwl vdLg+++++++v l+w a+ +k y++++S+D+ +Wtt++++++ g + ANB71439.1|CBM32 346 TATASSSYNTSLTPDKAFDGNTvSTRWDSieGSsagtQWLAVDLGAVKNITSVDLYWdAG---AKVYSIQTSNDNVNWTTIYSTSSGV-GYgH 434 4445555566699*******97469****65114679********************878...******************9876543.3335 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++i ++ ++ryvR+++t+rat wg+s+ E++ ANB71439.1|CBM32 435 VSIpGLK--GSGRYVRMVGTQRAT-PWGYSLDEMQ 466 6776666..578*******88876.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.96 // Query: BCN11801.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 123 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ BCN11801.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888888888877654333.2133555 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v BCN11801.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + BCN11801.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ BCN11801.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.13 // Query: BAG46819.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W BAG46819.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t BAG46819.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + BAG46819.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 90.20 // Query: ATG22258.1|CBM32 [L=474] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-30 92.8 5.7 1.2e-30 92.8 5.7 2.1 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.1 0.39 0.39 59 80 .. 150 171 .. 124 197 .. 0.56 2 ? -2.6 0.1 0.4 0.4 107 107 .. 290 290 .. 242 324 .. 0.55 3 ! 92.8 5.7 1.2e-30 1.2e-30 6 123 .. 352 470 .. 346 471 .. 0.81 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.39 CBM32.hmm 59 grikdykvevStDgktWttvae 80 g++ + +++ + g +t v++ ATG22258.1|CBM32 150 GDVMQAALSYTSSGPVFTSVVN 171 4444555555555555555554 PP == domain 2 score: -2.6 bits; conditional E-value: 0.4 CBM32.hmm 107 v 107 ATG22258.1|CBM32 290 S 290 2 PP == domain 3 score: 92.8 bits; conditional E-value: 1.2e-30 CBM32.hmm 6 saessssaaggggaenavDgdpn.trWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss +a+ g+++a+Dg+++ trW s ++ qwl vdLg+++t+++v l+w a+ +k y++++S+Dg +Wt +++++n + g + ATG22258.1|CBM32 352 SA-SSSYSAS-LGPAYAFDGNTTnTRWDSieGSaagtQWLMVDLGTTRTITGVDLYWdAG---AKVYSIQTSNDGVNWTNIYSTSNGASwG-H 438 33.3555556.99********7549****65114579********************878...******************9887765544.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ +++ ++ryvR+++t+rat +wg+s+ E++ ATG22258.1|CBM32 439 TSLaNLK--GSGRYVRMYGTQRAT-QWGYSLDEMQ 470 6555998..568*******99887.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (474 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.58 // Query: QGR63053.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W QGR63053.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t QGR63053.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + QGR63053.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.00 // Query: QKZ35276.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKZ35276.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKZ35276.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKZ35276.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKZ35276.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.78 // Query: ALV60389.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-31 95.9 4.1 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 130 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n ALV60389.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378889999998888888888876554 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ ALV60389.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ ALV60389.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 89.82 // Query: AQQ34237.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-31 94.7 5.8 3.4e-31 94.5 3.1 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.086 0.086 53 83 .. 146 174 .. 123 197 .. 0.66 2 ! 94.5 3.1 3.4e-31 3.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.086 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n AQQ34237.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 174 22...226777777777777777777776554 PP == domain 2 score: 94.5 bits; conditional E-value: 3.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ +a++a+Dg++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n +++++t AQQ34237.1|CBM32 347 AASASYNAS-LTADKAFDGNTAsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGVSYSHVT 435 334455566.99********8659****73356789********************877...9*****************9887754455566 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +ryvR+ +tkrat +wg+s++E++ AQQ34237.1|CBM32 436 LpNLN--GHGRYVRMLGTKRAT-QWGYSLYEMQ 465 66777..558*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.10 // Query: ATF83297.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-32 97.4 2.3 4.3e-32 97.4 2.3 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.15 0.15 54 84 .. 147 175 .. 134 195 .. 0.72 2 ? -3.5 0.0 0.75 0.75 50 69 .. 282 301 .. 275 319 .. 0.53 3 ! 97.4 2.3 4.3e-32 4.3e-32 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.15 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n ATF83297.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 3...2388999999999999999999876654 PP == domain 2 score: -3.5 bits; conditional E-value: 0.75 CBM32.hmm 50 kvvltw.aengrikdykvevS 69 + ++ + ++ +++ y+++v ATF83297.1|CBM32 282 GTNYVFfSS-TTAGGYQLYVG 301 444444322.34445555544 PP == domain 3 score: 97.4 bits; conditional E-value: 4.3e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t ATF83297.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagvgsQWISVDLGAVKRIDHVDLYWdAG---ALAYQIQTSNDNANWTTIYSTSNGGSYTHVT 436 334555566.99********877*****64245789********************878...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ ATF83297.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.61 // Query: AQQ21576.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n AQQ21576.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ AQQ21576.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ AQQ21576.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.65 // Query: CAR56187.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n CAR56187.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ CAR56187.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ CAR56187.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.55 // Query: AXW77709.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-30 92.0 4.3 2e-30 92.0 4.3 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 198 .. 0.66 2 ? -1.6 0.1 0.2 0.2 22 32 .. 300 310 .. 240 336 .. 0.60 3 ! 92.0 4.3 2e-30 2e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AXW77709.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.6 bits; conditional E-value: 0.2 CBM32.hmm 22 avDgdpntrWs 32 + D +++ rWs AXW77709.1|CBM32 300 LGDASTGQRWS 310 22222222333 PP == domain 3 score: 92.0 bits; conditional E-value: 2e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ +a++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW77709.1|CBM32 353 SA--SSSYNSSLSADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW77709.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 65.21 // Query: ARF89436.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n ARF89436.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ ARF89436.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ ARF89436.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 89.18 // Query: QND97364.1|CBM32 [L=487] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-31 96.0 5.3 1.5e-31 95.6 2.8 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.0 0.092 0.092 53 83 .. 164 192 .. 141 214 .. 0.66 2 ! 95.6 2.8 1.5e-31 1.5e-31 7 123 .. 365 483 .. 360 484 .. 0.82 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.092 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n QND97364.1|CBM32 164 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 192 22...226777777777777777777776554 PP == domain 2 score: 95.6 bits; conditional E-value: 1.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n +++++t QND97364.1|CBM32 365 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGVSYSHVT 453 334455666.99********8769****73356789********************877...9*****************9887754455566 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +ryvR+ +tkrat +wg+s++E++ QND97364.1|CBM32 454 LpNLN--GHGRYVRMLGTKRAT-QWGYSLYEMQ 483 66777..558*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (487 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.63 // Query: AYY99897.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-32 96.5 5.4 8.3e-32 96.5 3.7 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 96.5 3.7 8.3e-32 8.3e-32 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W AYY99897.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 96.5 bits; conditional E-value: 8.3e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t AYY99897.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALAYQIQTSNDNVNWTTIYSTTNGVSYQHVT 437 334455555.9*********8769****64246889********************878...9*****************9988754343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + AYY99897.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 66666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.53 // Query: CUV27303.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.13 0.13 59 95 .. 150 186 .. 122 201 .. 0.69 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ CUV27303.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v CUV27303.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + CUV27303.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ CUV27303.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 68.92 // Query: QKM15039.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKM15039.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKM15039.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKM15039.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKM15039.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.07 // Query: BCL90199.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ BCL90199.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y BCL90199.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + BCL90199.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ BCL90199.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 57.55 // Query: QTO50258.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-31 94.6 4.9 6.5e-31 93.6 3.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.9 0.0 0.24 0.24 58 84 .. 148 175 .. 133 195 .. 0.69 2 ! 93.6 3.8 6.5e-31 6.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 58 n.grikdykvevStDgktWttvaekgnt 84 + g++k+ ++++ + g +t v++ +n QTO50258.1|CBM32 148 QnGDVKQGTLSYTSAGPVFTSVVSLTNA 175 2378888888888888888888876654 PP == domain 2 score: 93.6 bits; conditional E-value: 6.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ +a++a+Dg+++ trW s + qw+ vdLg+++++++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ QTO50258.1|CBM32 348 AASASYNAT-LTADKAFDGNTTsTRWDSPEgagvdpQWISVDLGAVKKISSVDLYWdAG---ALVYQIQTSNDNVNWTTVYSTNNGVSyG-HV 435 333455555.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ QTO50258.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 86.11 // Query: CUV45125.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ CUV45125.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y CUV45125.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + CUV45125.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ CUV45125.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.35 // Query: QUP61405.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QUP61405.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QUP61405.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QUP61405.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QUP61405.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.93 // Query: QKM29914.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKM29914.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKM29914.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKM29914.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKM29914.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.87 // Query: QOK94017.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-31 94.5 3.8 3.4e-31 94.5 3.8 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.1 0.15 0.15 59 88 .. 150 178 .. 123 202 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 94.5 3.8 3.4e-31 3.4e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.15 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgt 88 g++ + ++++ + g +t v++ +nt +t QOK94017.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA-PT 178 667777888888888888888876644.44 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QOK94017.1|CBM32 285 Y 285 2 PP == domain 3 score: 94.5 bits; conditional E-value: 3.4e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt +++++n g + QOK94017.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAVQTSNDGVNWTSIYATSNGIAyG-H 439 33..344445589********7359****65114579********************878...******************9876643323.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QOK94017.1|CBM32 440 AVLsNLH--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..568*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.26 // Query: ANH34897.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ ANH34897.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y ANH34897.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + ANH34897.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ ANH34897.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.32 // Query: BCN07852.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ BCN07852.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v BCN07852.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + BCN07852.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ BCN07852.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.60 // Query: AXW03000.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AXW03000.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AXW03000.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW03000.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW03000.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.78 // Query: QKT90211.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n QKT90211.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ QKT90211.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ QKT90211.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 90.17 // Query: QBR02909.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-32 96.7 2.2 2.3e-31 95.1 2.2 1.8 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 95.1 2.2 2.3e-31 2.3e-31 7 123 .. 348 466 .. 343 467 .. 0.81 Alignments for each domain: == domain 1 score: 95.1 bits; conditional E-value: 2.3e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+ + trW s + qw+ vdLg++++++++ l+w a+ ++ y++++S+D+ +Wtt+++++n + g ++ QBR02909.1|CBM32 348 AASASYNAS-LTPDKAFDGNLTtTRWDSPEgagvdpQWISVDLGAVKNISSIDLYWdAG---ASVYQIQTSNDNVNWTTLYSTSNGVSyG-HV 435 334555566.99********8747****73356789********************877...9*****************9887754433.34 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ +ryvR+++tkrat +wg+s+ E++ QBR02909.1|CBM32 436 NLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 444555..568*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 91.14 // Query: QKL78829.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKL78829.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKL78829.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKL78829.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKL78829.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.62 // Query: QVN20928.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 95.0 4.3 3.7e-31 94.4 2.3 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 0.0 0.12 0.12 54 84 .. 147 175 .. 126 196 .. 0.72 2 ! 94.4 2.3 3.7e-31 3.7e-31 7 123 .. 348 466 .. 343 467 .. 0.81 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.12 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n QVN20928.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 3...2388999999999999999999876654 PP == domain 2 score: 94.4 bits; conditional E-value: 3.7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+ + trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t QVN20928.1|CBM32 348 AASASYNAS-LTPDKAFDGNSTsTRWDSPeGagvgsQWISVDLGAVKHIDHVDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGGSYTHVT 436 334455666.99*******96559****64245789********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +t+rat +wg+s++E++ QVN20928.1|CBM32 437 LpNLN--GSGRYVRMLGTQRAT-QWGYSLYEMQ 466 66666..678*******99887.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.15 // Query: AQW31629.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-30 92.8 3.9 1.1e-30 92.8 3.9 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 199 .. 0.66 2 ? -1.9 0.1 0.24 0.24 38 38 .. 296 296 .. 240 330 .. 0.57 3 ! 92.8 3.9 1.1e-30 1.1e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AQW31629.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 38 l 38 + AQW31629.1|CBM32 296 Y 296 1 PP == domain 3 score: 92.8 bits; conditional E-value: 1.1e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AQW31629.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AQW31629.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.11 // Query: AST35503.2|CBM32 [L=478] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-30 90.8 3.1 4.6e-30 90.8 3.1 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.1 0.2 0.2 59 85 .. 153 179 .. 126 202 .. 0.66 2 ? -2.4 0.1 0.33 0.33 107 107 .. 293 293 .. 243 330 .. 0.57 3 ! 90.8 3.1 4.6e-30 4.6e-30 6 123 .. 356 474 .. 350 475 .. 0.80 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AST35503.2|CBM32 153 GDVMQATLSYTSTGPIFTSVVDITNTA 179 566677777777888888887776543 PP == domain 2 score: -2.4 bits; conditional E-value: 0.33 CBM32.hmm 107 v 107 AST35503.2|CBM32 293 S 293 1 PP == domain 3 score: 90.8 bits; conditional E-value: 4.6e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt +++++n g + AST35503.2|CBM32 356 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAVQTSNDGVNWTNIYATSNGIAyG-H 442 33..344445589********758*****65114579********************878...******************9876644323.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+ +t+rat +wg++i E++ AST35503.2|CBM32 443 AVLsNLH--GSGRYVRMLGTQRAT-QWGYAIDEMQ 474 4444887..568*******99887.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (478 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.93 // Query: QMT13244.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QMT13244.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QMT13244.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QMT13244.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QMT13244.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.99 // Query: AXW49889.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AXW49889.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AXW49889.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW49889.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW49889.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.40 // Query: QKL58869.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.13 0.13 59 95 .. 150 186 .. 122 201 .. 0.69 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKL58869.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v QKL58869.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKL58869.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKL58869.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.85 // Query: QKL73623.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKL73623.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKL73623.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKL73623.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKL73623.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 76.95 // Query: BCM04359.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ BCM04359.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v BCM04359.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + BCM04359.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ BCM04359.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.81 // Query: APC66022.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ APC66022.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v APC66022.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + APC66022.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ APC66022.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.88 // Query: QKM39907.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.13 0.13 59 95 .. 150 186 .. 122 201 .. 0.69 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKM39907.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v QKM39907.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKM39907.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKM39907.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.37 // Query: QSL44459.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W QSL44459.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t QSL44459.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + QSL44459.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.90 // Query: AYB54455.1|CBM32 [L=478] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-30 91.1 3.2 4e-30 91.1 3.2 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.1 0.2 0.2 59 85 .. 153 179 .. 126 202 .. 0.66 2 ! 91.1 3.2 4e-30 4e-30 6 123 .. 356 474 .. 350 475 .. 0.80 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AYB54455.1|CBM32 153 GDVMQATLSYTSTGPIFTSVVDITNTA 179 566677777777888888887776543 PP == domain 2 score: 91.1 bits; conditional E-value: 4e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt +++++n g + AYB54455.1|CBM32 356 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTARTINGVDLYWdAG---AKTYAVQTSNDGVNWTNIYATSNGIAyG-H 442 33..344445589********758*****65114579********************878...******************9876644323.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+ +t+rat +wg++i E++ AYB54455.1|CBM32 443 AVLsNLH--GSGRYVRMLGTQRAT-QWGYAIDEMQ 474 4444887..568*******99887.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (478 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.79 // Query: AYA48548.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.13 0.13 59 95 .. 150 186 .. 122 201 .. 0.69 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AYA48548.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v AYA48548.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AYA48548.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AYA48548.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 64.58 // Query: QRR07888.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-32 97.6 5.0 6.5e-32 96.8 2.4 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.1 0.0 0.057 0.057 53 84 .. 146 175 .. 123 197 .. 0.69 2 ! 96.8 2.4 6.5e-32 6.5e-32 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: 0.1 bits; conditional E-value: 0.057 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgnt 84 ++ + g++k+ ++++ + g +t v++ +n QRR07888.1|CBM32 146 FK---QnGDVKQATLSYTSAGPAFTSVVSLTNA 175 33...2377888888888888888888776554 PP == domain 2 score: 96.8 bits; conditional E-value: 6.5e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+p+t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ QRR07888.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAPKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTNNGVSyG-HV 435 334455666.99********8769****64246889********************877...9*****************9887654433.45 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ QRR07888.1|CBM32 436 TLpNLK--ASGRYVRMLGTKRAT-QWGYSLDEMQ 466 666666..579*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.07 // Query: APR38607.1|CBM32 [L=474] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-31 93.8 8.6 5.4e-31 93.8 8.6 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.3 0.0 0.31 0.31 59 85 .. 151 177 .. 125 198 .. 0.63 2 ? -2.9 0.2 0.47 0.47 63 76 .. 296 311 .. 277 336 .. 0.50 3 ! 93.8 8.6 5.4e-31 5.4e-31 8 123 .. 351 470 .. 345 471 .. 0.80 Alignments for each domain: == domain 1 score: -2.3 bits; conditional E-value: 0.31 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + +++ + g ++t v++ +nt APR38607.1|CBM32 151 GDVMEATLSFTSGGPQFTSVVNITNTA 177 556666666667777777777766543 PP == domain 2 score: -2.9 bits; conditional E-value: 0.47 CBM32.hmm 63 dykvevSt..DgktWt 76 y+++v + gk W+ APR38607.1|CBM32 296 GYQLYVGDvsTGKRWN 311 3344433211344444 PP == domain 3 score: 93.8 bits; conditional E-value: 5.4e-31 CBM32.hmm 8 essssaaggggaenavDgdpn.t.rWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.te 90 ++sss++++ +a++a+Dg++ t rW s ++ qw+tvdLg+++t+++v ++w a+ +k+y++++S+D+ +Wtt++++++ g+ ++ APR38607.1|CBM32 351 TASSSYNSSLTASKAFDGNTAnTsRWDSieGNaagtQWITVDLGGVKTITSVDIYWdAG---AKTYQIQTSNDNANWTTIYSTSSGV-GSgHV 439 33444555599********75446****65114579********************878...******************9876533.55456 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ ++ryvR+++t+rat +wg+si E++ APR38607.1|CBM32 440 SLaNLK--GSGRYVRMYGTQRAT-TWGYSIDEMQ 470 665888..568*******99886.6*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (474 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.61 // Query: AIO37054.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 4.7 4.8e-31 94.0 3.2 1.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.7 0.0 0.43 0.43 57 85 .. 149 176 .. 140 195 .. 0.68 2 ! 94.0 3.2 4.8e-31 4.8e-31 7 122 .. 348 465 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -2.7 bits; conditional E-value: 0.43 CBM32.hmm 57 engrikdykvevStDgktWttvaekgntt 85 + g++k+ ++++ + g +t +++ +n + AIO37054.1|CBM32 149 N-GDVKQGTLSYTSAGPVFTSIVSLTNAP 176 2.788899999999998899888766543 PP == domain 2 score: 94.0 bits; conditional E-value: 4.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n +++++t AIO37054.1|CBM32 348 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTNNGVSYQHVT 436 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + AIO37054.1|CBM32 437 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 465 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.80 // Query: QSL32975.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W QSL32975.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t QSL32975.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + QSL32975.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.57 // Query: QDW52489.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.7e-31 93.2 3.6 8.7e-31 93.2 3.6 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.6 0.1 0.19 0.19 10 29 .. 126 143 .. 122 163 .. 0.73 2 ? -1.7 0.0 0.21 0.21 54 87 .. 147 178 .. 136 195 .. 0.69 3 ! 93.2 3.6 8.7e-31 8.7e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.6 bits; conditional E-value: 0.19 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 s++a+ ++++++a Dg +t QDW52489.1|CBM32 126 STGATRNEDPKFAADG--KT 143 3344455899999999..44 PP == domain 2 score: -1.7 bits; conditional E-value: 0.21 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttdg 87 + + g++k+ ++++ + g +t v++ +n + g QDW52489.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVSLTNAPAG 178 3...2388999999999999999999887664434 PP == domain 3 score: 93.2 bits; conditional E-value: 8.7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ QDW52489.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ QDW52489.1|CBM32 436 TLpNLN--GQGRYVRMIGTKRAT-QWGYSLDEMQ 466 776777..568*******88877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 44.35 // Query: CDN64055.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n CDN64055.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ CDN64055.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ CDN64055.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.19 // Query: AIO38496.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-31 94.6 4.9 6.5e-31 93.6 3.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.9 0.0 0.24 0.24 58 84 .. 148 175 .. 133 195 .. 0.69 2 ! 93.6 3.8 6.5e-31 6.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 58 n.grikdykvevStDgktWttvaekgnt 84 + g++k+ ++++ + g +t v++ +n AIO38496.1|CBM32 148 QnGDVKQGTLSYTSAGPVFTSVVSLTNA 175 2378888888888888888888876654 PP == domain 2 score: 93.6 bits; conditional E-value: 6.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ +a++a+Dg+++ trW s + qw+ vdLg+++++++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ AIO38496.1|CBM32 348 AASASYNAT-LTADKAFDGNTTsTRWDSPEgagvdpQWISVDLGAVKKISSVDLYWdAG---ALVYQIQTSNDNVNWTTVYSTNNGVSyG-HV 435 333455555.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ AIO38496.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 79.37 // Query: AIO73477.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-32 96.6 5.4 8.2e-32 96.5 3.7 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 279 308 .. 275 318 .. 0.58 2 ! 96.5 3.7 8.2e-32 8.2e-32 7 122 .. 347 464 .. 342 466 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W AIO73477.1|CBM32 279 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 308 55555555433.4566666666632235555 PP == domain 2 score: 96.5 bits; conditional E-value: 8.2e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t AIO73477.1|CBM32 347 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALAYQIQTSNDNVNWTTIYSTTNGVSYQHVT 435 334455555.9*********8769****64246889********************878...9*****************9988754343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + AIO73477.1|CBM32 436 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 464 66666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.71 // Query: QIF10083.1|CBM32 [L=474] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-30 92.8 6.1 1.1e-30 92.8 6.1 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.0 0.38 0.38 107 107 .. 290 290 .. 241 324 .. 0.55 2 ! 92.8 6.1 1.1e-30 1.1e-30 6 123 .. 352 470 .. 346 471 .. 0.81 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.38 CBM32.hmm 107 v 107 QIF10083.1|CBM32 290 S 290 2 PP == domain 2 score: 92.8 bits; conditional E-value: 1.1e-30 CBM32.hmm 6 saessssaaggggaenavDgdpn.trWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss +a+ g+++a+Dg+++ trW s ++ qwl vdLg+++t+++v l+w a+ +k y++++S+Dg +Wt +++++n + g + QIF10083.1|CBM32 352 SA-SSSYSAS-LGPAYAFDGNTTnTRWDSieGSaagtQWLMVDLGTTRTITGVDLYWdAG---AKVYSIQTSNDGVNWTNLYSTSNGASwG-H 438 33.3555556.99********7549****65114579********************878...******************9887765544.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ +++ ++ryvR+++t+rat +wg+s++E++ QIF10083.1|CBM32 439 TSLaNLK--GSGRYVRMYGTQRAT-QWGYSVNEMQ 470 6555998..568*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (474 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.01 // Query: AXV74808.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AXV74808.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AXV74808.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXV74808.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXV74808.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.97 // Query: QUN57533.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n QUN57533.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ QUN57533.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ QUN57533.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.77 // Query: AJX13718.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-31 94.4 2.6 3.7e-31 94.4 2.6 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.9 0.0 0.12 0.12 54 85 .. 147 176 .. 127 197 .. 0.72 2 ? -3.1 0.1 0.56 0.56 51 69 .. 283 301 .. 275 322 .. 0.50 3 ! 94.4 2.6 3.7e-31 3.7e-31 7 123 .. 348 466 .. 343 467 .. 0.83 Alignments for each domain: == domain 1 score: -0.9 bits; conditional E-value: 0.12 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgntt 85 + + g++k+ ++++ + g +t v++ +n + AJX13718.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 3...23889999999999999999998766543 PP == domain 2 score: -3.1 bits; conditional E-value: 0.56 CBM32.hmm 51 vvltw.aengrikdykvevS 69 ++ + ++ +++ y+++v AJX13718.1|CBM32 283 TNYVFfSS-TTAGGYQLYVG 301 44443322.33445555544 PP == domain 3 score: 94.4 bits; conditional E-value: 3.7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ AJX13718.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGSVKTINGVDLYWdAG---ALVYQIQTSSDNVNWTTIYSTSNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887755433.57 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 i +++ ++ryvR+++tkrat +wg+s+ E++ AJX13718.1|CBM32 436 AIpNLN--GRGRYVRMYGTKRAT-QWGYSLDEMQ 466 888888..578*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.90 // Query: AXF22987.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-31 94.3 2.3 2.4e-30 91.7 0.8 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.8 0.0 0.035 0.035 53 85 .. 144 176 .. 123 206 .. 0.73 2 ! 91.7 0.8 2.4e-30 2.4e-30 7 123 .. 348 466 .. 343 467 .. 0.81 Alignments for each domain: == domain 1 score: 0.8 bits; conditional E-value: 0.035 CBM32.hmm 53 ltw.aengrikdykvevStDgktWttvaekgntt 85 l + ++ g+ik+ ++++ + g +t v++ +n + AXF22987.1|CBM32 144 LVFkQN-GDIKRATLSYTSTGPVFTSVVSLTNAP 176 343233.889999999999999999998766543 PP == domain 2 score: 91.7 bits; conditional E-value: 2.4e-30 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g qwl vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n g ++ AXF22987.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGsgvdpQWLSVDLGAVKNIDHVDLYWdAG---ALVYQIQTSSDNVNWTTLYATSNGVAyG-HV 435 334555566.99********8769****74246889********************877...9*****************9877644323.45 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat wg+s+ E++ AXF22987.1|CBM32 436 MLpNLN--GQGRYVRMIGTKRAT-PWGYSLDEMQ 466 454777..568*******88876.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.61 // Query: AIO44799.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n AIO44799.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ AIO44799.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ AIO44799.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.46 // Query: ACA94324.1|CBM32 [L=480] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-31 94.9 5.6 3.5e-31 94.5 3.1 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.09 0.09 53 83 .. 157 185 .. 134 207 .. 0.66 2 ! 94.5 3.1 3.5e-31 3.5e-31 7 123 .. 358 476 .. 353 477 .. 0.82 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.09 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n ACA94324.1|CBM32 157 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 185 22...226777777777777777777776554 PP == domain 2 score: 94.5 bits; conditional E-value: 3.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ +a++a+Dg++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n +++++t ACA94324.1|CBM32 358 AASASYNAS-LTADKAFDGNTAsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGVSYSHVT 446 334455566.99********8659****73356789********************877...9*****************9887754455566 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +ryvR+ +tkrat +wg+s++E++ ACA94324.1|CBM32 447 LpNLN--GHGRYVRMLGTKRAT-QWGYSLYEMQ 476 66777..558*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (480 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.79 // Query: AWV02333.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-31 94.5 4.3 1.1e-30 92.9 2.8 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.2 0.0 0.07 0.07 54 85 .. 147 176 .. 128 198 .. 0.74 2 ! 92.9 2.8 1.1e-30 1.1e-30 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.2 bits; conditional E-value: 0.07 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgntt 85 + + g++k+ ++++ + g +t v++ +n + AWV02333.1|CBM32 147 K---QnGDVKQATLSYTSAGPAFTSVVSLTNAP 176 3...33899999999999999999999876643 PP == domain 2 score: 92.9 bits; conditional E-value: 1.1e-30 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg ++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ AWV02333.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGVTKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887755433.45 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ AWV02333.1|CBM32 436 TLpNLK--ASGRYVRMLGTKRAT-QWGYSLDEMQ 466 666666..579*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.30 // Query: AUS44110.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.13 0.13 59 95 .. 150 186 .. 122 201 .. 0.69 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AUS44110.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v AUS44110.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AUS44110.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AUS44110.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 65.37 // Query: QQK37331.1|CBM32 [L=472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-30 90.2 4.8 7.4e-30 90.2 4.8 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.1 0.0 0.54 0.54 13 28 .. 129 142 .. 123 176 .. 0.63 2 ? -2.1 0.1 0.27 0.27 38 47 .. 296 305 .. 242 329 .. 0.57 3 ! 90.2 4.8 7.4e-30 7.4e-30 6 123 .. 351 468 .. 345 469 .. 0.81 Alignments for each domain: == domain 1 score: -3.1 bits; conditional E-value: 0.54 CBM32.hmm 13 aaggggaenavDgdpn 28 ++ ++++++ +Dg + QQK37331.1|CBM32 129 QTRNEDPKFSTDG--K 142 3344778888888..3 PP == domain 2 score: -2.1 bits; conditional E-value: 0.27 CBM32.hmm 38 ltvdLgkptt 47 +++ Lg + t QQK37331.1|CBM32 296 YQLYLGDAST 305 2222222222 PP == domain 3 score: 90.2 bits; conditional E-value: 7.4e-30 CBM32.hmm 6 saessssaaggggaenavDgdpn.trWss.ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 sa sss +a+ g+++a+Dg+++ trW s +g qwl vdLg+++t+++v l+w a+ +k y++++S+Dg +Wt ++++++ + g ++ QQK37331.1|CBM32 351 SA-SSSYSAS-LGPAYAFDGNTTsTRWDSvEGvagaQWLMVDLGATRTITGVDLYWdAG---AKVYSIQTSNDGVSWTSIYSTSSGASwG-HT 437 33.3555556.99********8769****6224569********************878...******************9876644434.45 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ ++ryvR+++t+rat +wg+s+ E++ QQK37331.1|CBM32 438 SLtNLK--GSGRYVRMYGTQRAT-QWGYSLDEMQ 468 444888..568*******99887.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (472 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.10 // Query: QKM44677.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKM44677.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKM44677.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKM44677.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKM44677.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.14 // Query: QTD92502.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-31 94.8 2.3 2.8e-31 94.8 2.3 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.4 0.0 0.16 0.16 54 80 .. 147 171 .. 123 195 .. 0.59 2 ! 94.8 2.3 2.8e-31 2.8e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.4 bits; conditional E-value: 0.16 CBM32.hmm 54 twaen.grikdykvevStDgktWttvae 80 + + g++k+ ++++ + g +t v++ QTD92502.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVS 171 2...225555555555555555555554 PP == domain 2 score: 94.8 bits; conditional E-value: 2.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dgd++ trW s + qwl vdLg+++++++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ QTD92502.1|CBM32 348 AASASYDAS-LTPDKAFDGDTTsTRWDSPEgagvdpQWLSVDLGAVKKISSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTSNGVSyG-HV 435 333455555.99********8769****73356789********************877...9*****************9887755433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ QTD92502.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 87.03 // Query: CCA87557.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-30 92.8 3.9 1.1e-30 92.8 3.9 2.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.7 0.0 0.1 0.1 59 95 .. 150 186 .. 123 203 .. 0.70 2 ? -2.5 0.0 0.36 0.36 22 32 .. 300 310 .. 268 330 .. 0.52 3 ! 92.8 3.9 1.1e-30 1.1e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -0.7 bits; conditional E-value: 0.1 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt + e + +f+ CCA87557.1|CBM32 150 GDVMQATLSYTSTGPVFTSVVDITNTA-PAIEsSMPFA 186 777788888888999999998877654.2222133555 PP == domain 2 score: -2.5 bits; conditional E-value: 0.36 CBM32.hmm 22 avDgdpntrWs 32 + D +++ rWs CCA87557.1|CBM32 300 LGDASTGQRWS 310 22222222333 PP == domain 3 score: 92.8 bits; conditional E-value: 1.1e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + CCA87557.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ CCA87557.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.10 // Query: QKL68431.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKL68431.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKL68431.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKL68431.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKL68431.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.48 // Query: QSL55923.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W QSL55923.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t QSL55923.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + QSL55923.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.60 // Query: AMP72508.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-30 90.5 2.2 6e-30 90.5 2.2 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.1 0.18 0.18 59 95 .. 150 186 .. 124 200 .. 0.67 2 ? -2.4 0.1 0.34 0.34 106 106 .. 289 289 .. 240 325 .. 0.56 3 ! 90.5 2.2 6e-30 6e-30 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.18 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgt.tetitfd 95 g++ + ++++ g +t v++ +ntt + +++ +f+ AMP72508.1|CBM32 150 GDVMQATLSYTRTGPIFTSVVDITNTT-PAiENSMPFA 186 667777888888888888888877654.2212244555 PP == domain 2 score: -2.4 bits; conditional E-value: 0.34 CBM32.hmm 106 t 106 AMP72508.1|CBM32 289 S 289 2 PP == domain 3 score: 90.5 bits; conditional E-value: 6e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt ++++++ + AMP72508.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAVQTSSDGVNWTNIYATSSGIA-YgH 439 33..344445589********758*****65114579********************878...******************87655332.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+ +t+rat wg+si E++ AMP72508.1|CBM32 440 AVLsNLH--GSGRYVRMLGTQRAT-PWGYSIDEMQ 471 4444887..568*******88876.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 68.09 // Query: BBA38191.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 3.5 2.5e-31 94.9 3.5 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 94.9 3.5 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + BBA38191.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ BBA38191.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ BBA38191.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.42 // Query: CAD17430.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ CAD17430.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v CAD17430.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + CAD17430.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ CAD17430.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.53 // Query: QKL63625.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKL63625.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKL63625.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKL63625.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKL63625.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.62 // Query: QSL61657.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W QSL61657.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t QSL61657.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + QSL61657.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.45 // Query: AKM03206.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-31 94.7 3.9 3.3e-31 94.5 1.7 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.0 0.17 0.17 54 80 .. 147 171 .. 123 195 .. 0.60 2 ! 94.5 1.7 3.3e-31 3.3e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.17 CBM32.hmm 54 twaen.grikdykvevStDgktWttvae 80 + + g++k+ +++ + g +t v++ AKM03206.1|CBM32 147 K---QnGDVKQAALSYTSAGPVFTSVVS 171 2...225556666666666666666555 PP == domain 2 score: 94.5 bits; conditional E-value: 3.3e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n +++++t AKM03206.1|CBM32 348 AASASYNAS-LTPDKAFDGNATgTRWDSPeGagvgsQWISVDLGAVKHIDHVDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGGSYSHVT 436 334455666.99********876*****64245789********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +t+rat +wg+s++E++ AKM03206.1|CBM32 437 LpNLN--GSGRYVRMLGTQRAT-QWGYSLYEMQ 466 66776..578*******99887.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.38 // Query: AXW45001.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AXW45001.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AXW45001.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW45001.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW45001.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.67 // Query: ALK21484.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-32 97.4 2.3 4.3e-32 97.4 2.3 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.15 0.15 54 84 .. 147 175 .. 134 195 .. 0.72 2 ? -3.5 0.0 0.75 0.75 50 69 .. 282 301 .. 275 319 .. 0.53 3 ! 97.4 2.3 4.3e-32 4.3e-32 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.15 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n ALK21484.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 3...2388999999999999999999876654 PP == domain 2 score: -3.5 bits; conditional E-value: 0.75 CBM32.hmm 50 kvvltw.aengrikdykvevS 69 + ++ + ++ +++ y+++v ALK21484.1|CBM32 282 GTNYVFfSS-TTAGGYQLYVG 301 444444322.34445555544 PP == domain 3 score: 97.4 bits; conditional E-value: 4.3e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t ALK21484.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagvgsQWISVDLGAVKRIDHVDLYWdAG---ALAYQIQTSNDNANWTTIYSTSNGGSYTHVT 436 334555566.99********877*****64245789********************878...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ ALK21484.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.80 // Query: QET33083.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-31 94.5 5.2 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W QET33083.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t QET33083.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + QET33083.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.23 // Query: QKL89248.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKL89248.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKL89248.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKL89248.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKL89248.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.78 // Query: AMP39401.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-30 92.0 4.3 2e-30 92.0 4.3 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 198 .. 0.66 2 ? -1.7 0.1 0.2 0.2 21 21 .. 299 299 .. 240 333 .. 0.59 3 ! 92.0 4.3 2e-30 2e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AMP39401.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 21 n 21 + AMP39401.1|CBM32 299 Y 299 2 PP == domain 3 score: 92.0 bits; conditional E-value: 2e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ +a++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AMP39401.1|CBM32 353 SA--SSSYNSSLSADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AMP39401.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 65.74 // Query: AXV97826.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AXV97826.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AXV97826.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXV97826.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXV97826.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.81 // Query: AYY57008.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-32 96.5 5.4 8.3e-32 96.5 3.7 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 96.5 3.7 8.3e-32 8.3e-32 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W AYY57008.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 96.5 bits; conditional E-value: 8.3e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t AYY57008.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALAYQIQTSNDNVNWTTIYSTTNGVSYQHVT 437 334455555.9*********8769****64246889********************878...9*****************9988754343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + AYY57008.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 66666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 77.17 // Query: ACB67470.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.7e-31 93.2 3.6 8.7e-31 93.2 3.6 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.6 0.1 0.19 0.19 10 29 .. 126 143 .. 122 163 .. 0.73 2 ? -1.7 0.0 0.21 0.21 54 87 .. 147 178 .. 136 195 .. 0.69 3 ! 93.2 3.6 8.7e-31 8.7e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.6 bits; conditional E-value: 0.19 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 s++a+ ++++++a Dg +t ACB67470.1|CBM32 126 STGATRNEDPKFAADG--KT 143 3344455899999999..44 PP == domain 2 score: -1.7 bits; conditional E-value: 0.21 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttdg 87 + + g++k+ ++++ + g +t v++ +n + g ACB67470.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVSLTNAPAG 178 3...2388999999999999999999887664434 PP == domain 3 score: 93.2 bits; conditional E-value: 8.7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ ACB67470.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ ACB67470.1|CBM32 436 TLpNLN--GQGRYVRMIGTKRAT-QWGYSLDEMQ 466 776777..568*******88877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 43.24 // Query: QCY07533.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-32 97.4 2.3 4.3e-32 97.4 2.3 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.15 0.15 54 84 .. 147 175 .. 134 195 .. 0.72 2 ? -3.5 0.0 0.75 0.75 50 69 .. 282 301 .. 275 319 .. 0.53 3 ! 97.4 2.3 4.3e-32 4.3e-32 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.15 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n QCY07533.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 3...2388999999999999999999876654 PP == domain 2 score: -3.5 bits; conditional E-value: 0.75 CBM32.hmm 50 kvvltw.aengrikdykvevS 69 + ++ + ++ +++ y+++v QCY07533.1|CBM32 282 GTNYVFfSS-TTAGGYQLYVG 301 444444322.34445555544 PP == domain 3 score: 97.4 bits; conditional E-value: 4.3e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t QCY07533.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagvgsQWISVDLGAVKRIDHVDLYWdAG---ALAYQIQTSNDNANWTTIYSTSNGGSYTHVT 436 334555566.99********877*****64245789********************878...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ QCY07533.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.15 // Query: QKM04615.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKM04615.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKM04615.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKM04615.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKM04615.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.80 // Query: CCA83817.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-30 92.8 3.9 1.1e-30 92.8 3.9 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 199 .. 0.66 2 ? -1.9 0.1 0.24 0.24 38 38 .. 296 296 .. 240 330 .. 0.57 3 ! 92.8 3.9 1.1e-30 1.1e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt CCA83817.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 38 l 38 + CCA83817.1|CBM32 296 Y 296 1 PP == domain 3 score: 92.8 bits; conditional E-value: 1.1e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + CCA83817.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ CCA83817.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.68 // Query: AOE92542.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AOE92542.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AOE92542.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AOE92542.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AOE92542.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.82 // Query: AXV71319.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AXV71319.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AXV71319.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXV71319.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXV71319.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.88 // Query: ANA35075.1|CBM32 [L=474] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-30 92.8 5.7 1.2e-30 92.8 5.7 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.1 0.4 0.4 107 107 .. 290 290 .. 242 324 .. 0.55 2 ! 92.8 5.7 1.2e-30 1.2e-30 6 123 .. 352 470 .. 346 471 .. 0.81 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.4 CBM32.hmm 107 v 107 ANA35075.1|CBM32 290 S 290 2 PP == domain 2 score: 92.8 bits; conditional E-value: 1.2e-30 CBM32.hmm 6 saessssaaggggaenavDgdpn.trWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss +a+ g+++a+Dg+++ trW s ++ qwl vdLg+++t+++v l+w a+ +k y++++S+Dg +Wt +++++n + g + ANA35075.1|CBM32 352 SA-SSSYSAS-LGPAYAFDGNTTnTRWDSieGSaagtQWLMVDLGTTRTITGVDLYWdAG---AKVYSIQTSNDGVNWTNIYSTSNGASwG-H 438 33.3555556.99********7549****65114579********************878...******************9887765544.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ +++ ++ryvR+++t+rat +wg+s+ E++ ANA35075.1|CBM32 439 TSLaNLK--GSGRYVRMYGTQRAT-QWGYSLDEMQ 470 6555998..568*******99887.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (474 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 90.91 // Query: QUO28621.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n QUO28621.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ QUO28621.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ QUO28621.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.85 // Query: AJY16798.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 3.5 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 279 308 .. 275 318 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 347 464 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W AJY16798.1|CBM32 279 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 308 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t AJY16798.1|CBM32 347 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 435 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + AJY16798.1|CBM32 436 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 464 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.26 // Query: AXF22694.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-30 92.6 3.5 2.7e-30 91.6 2.0 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 0.0 0.13 0.13 53 85 .. 146 176 .. 136 197 .. 0.70 2 ! 91.6 2.0 2.7e-30 2.7e-30 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.13 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + AXF22694.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 33...23889999999999999999998876543 PP == domain 2 score: 91.6 bits; conditional E-value: 2.7e-30 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ AXF22694.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887755433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+ +tkrat wg+++ E++ AXF22694.1|CBM32 436 TLpNLN--GHGRYVRMLGTKRAT-PWGYALDEIQ 466 666777..458*******88876.799*999985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.64 // Query: ARU25711.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ ARU25711.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y ARU25711.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + ARU25711.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ ARU25711.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.06 // Query: CBJ39909.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-31 94.5 3.8 3.4e-31 94.5 3.8 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 0.1 0.13 0.13 59 95 .. 150 186 .. 122 203 .. 0.69 2 ? -2.2 0.1 0.29 0.29 102 102 .. 285 285 .. 233 325 .. 0.56 3 ! 94.5 3.8 3.4e-31 3.4e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.13 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ CBJ39909.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 102 y 102 y CBJ39909.1|CBM32 285 Y 285 2 PP == domain 3 score: 94.5 bits; conditional E-value: 3.4e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt +++++n g + CBJ39909.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAVQTSNDGVNWTSIYATSNGIAyG-H 439 33..344445589********7359****65114579********************878...******************9876643323.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ CBJ39909.1|CBM32 440 AVLsNLH--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..568*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.62 // Query: AXW16637.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AXW16637.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AXW16637.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW16637.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW16637.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.66 // Query: API76867.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ API76867.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v API76867.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + API76867.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ API76867.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.92 // Query: QKL84037.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKL84037.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKL84037.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKL84037.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKL84037.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.16 // Query: AXW63697.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-30 92.0 4.3 2e-30 92.0 4.3 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 198 .. 0.66 2 ? -1.6 0.1 0.2 0.2 22 32 .. 300 310 .. 240 336 .. 0.60 3 ! 92.0 4.3 2e-30 2e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AXW63697.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.6 bits; conditional E-value: 0.2 CBM32.hmm 22 avDgdpntrWs 32 + D +++ rWs AXW63697.1|CBM32 300 LGDASTGQRWS 310 22222222333 PP == domain 3 score: 92.0 bits; conditional E-value: 2e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ +a++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW63697.1|CBM32 353 SA--SSSYNSSLSADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW63697.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.03 // Query: QSL50196.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W QSL50196.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t QSL50196.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + QSL50196.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 90.90 // Query: AQQ30042.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-31 94.7 5.8 3.4e-31 94.5 3.1 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.086 0.086 53 83 .. 146 174 .. 123 197 .. 0.66 2 ! 94.5 3.1 3.4e-31 3.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.086 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n AQQ30042.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 174 22...226777777777777777777776554 PP == domain 2 score: 94.5 bits; conditional E-value: 3.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ +a++a+Dg++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n +++++t AQQ30042.1|CBM32 347 AASASYNAS-LTADKAFDGNTAsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGVSYSHVT 435 334455566.99********8659****73356789********************877...9*****************9887754455566 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +ryvR+ +tkrat +wg+s++E++ AQQ30042.1|CBM32 436 LpNLN--GHGRYVRMLGTKRAT-QWGYSLYEMQ 465 66777..558*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.99 // Query: AXW40306.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AXW40306.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AXW40306.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW40306.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW40306.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.84 // Query: QRO79533.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-31 93.6 3.5 6.7e-31 93.6 3.5 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.0 0.17 0.17 53 82 .. 146 173 .. 124 195 .. 0.62 2 ! 93.6 3.5 6.7e-31 6.7e-31 7 123 .. 348 466 .. 343 467 .. 0.83 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.17 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekg 82 ++ + g++k+ ++++ + g +t v++ + QRO79533.1|CBM32 146 FK---QnGDVKQGTLSYTSAGPVFTSVVSLT 173 22...22666666666666666666666554 PP == domain 2 score: 93.6 bits; conditional E-value: 6.7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ +a++a+Dg+++ trW s g qw+ vdLg++++++++ l+w a+ + y++++S+D+ +Wtt+++++n g ++ QRO79533.1|CBM32 348 AASASYNAS-LTADKAFDGNTSsTRWDSPeGtgvdpQWISVDLGAVKQIRSIDLYWdAG---ALAYQIQTSNDNANWTTIYSTTNGAAyG-HV 435 334455566.99********9879****64246889********************878...9*****************9988755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ QRO79533.1|CBM32 436 TLqNLN--GSGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.71 // Query: AFQ49750.1|CBM32 [L=480] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-32 96.7 4.0 2.2e-31 95.1 2.9 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 0.0 0.13 0.13 54 85 .. 157 186 .. 145 207 .. 0.70 2 ! 95.1 2.9 2.2e-31 2.2e-31 7 123 .. 358 476 .. 353 477 .. 0.82 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.13 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgntt 85 + + g++k+ ++++ + g +t v++ +n + AFQ49750.1|CBM32 157 K---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 186 3...33889999999999999999998876543 PP == domain 2 score: 95.1 bits; conditional E-value: 2.2e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++++++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ AFQ49750.1|CBM32 358 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGAVKKISSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 445 334555566.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ AFQ49750.1|CBM32 446 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 476 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (480 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 83.20 // Query: AMP76807.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-30 90.5 2.2 6e-30 90.5 2.2 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.1 0.18 0.18 59 95 .. 150 186 .. 124 200 .. 0.67 2 ? -2.4 0.1 0.34 0.34 106 106 .. 289 289 .. 240 325 .. 0.56 3 ! 90.5 2.2 6e-30 6e-30 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.18 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgt.tetitfd 95 g++ + ++++ g +t v++ +ntt + +++ +f+ AMP76807.1|CBM32 150 GDVMQATLSYTRTGPIFTSVVDITNTT-PAiENSMPFA 186 667777888888888888888877654.2212244555 PP == domain 2 score: -2.4 bits; conditional E-value: 0.34 CBM32.hmm 106 t 106 AMP76807.1|CBM32 289 S 289 2 PP == domain 3 score: 90.5 bits; conditional E-value: 6e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt ++++++ + AMP76807.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAVQTSSDGVNWTNIYATSSGIA-YgH 439 33..344445589********758*****65114579********************878...******************87655332.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+ +t+rat wg+si E++ AMP76807.1|CBM32 440 AVLsNLH--GSGRYVRMLGTQRAT-PWGYSIDEMQ 471 4444887..568*******88876.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.82 // Query: QKM25106.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKM25106.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKM25106.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKM25106.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKM25106.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.68 // Query: AMU12977.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n AMU12977.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ AMU12977.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ AMU12977.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.61 // Query: QTO45164.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-31 94.8 4.4 6.5e-31 93.6 3.8 1.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.0 0.38 0.38 58 82 .. 148 173 .. 134 194 .. 0.68 2 ! 93.6 3.8 6.5e-31 6.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.38 CBM32.hmm 58 n.grikdykvevStDgktWttvaekg 82 + g++k+ ++++ + g +t v++ + QTO45164.1|CBM32 148 QnGDVKQGTLSYTSAGPVFTSVVSLT 173 23778888888888888888887654 PP == domain 2 score: 93.6 bits; conditional E-value: 6.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ +a++a+Dg+++ trW s + qw+ vdLg+++++++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ QTO45164.1|CBM32 348 AASASYNAT-LTADKAFDGNTTsTRWDSPEgagvdpQWISVDLGAVKKISSVDLYWdAG---ALVYQIQTSNDNVNWTTVYSTNNGVSyG-HV 435 333455555.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ QTO45164.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 78.07 // Query: QRR16187.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-31 95.7 6.4 1.5e-31 95.7 3.6 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.086 0.086 53 83 .. 146 174 .. 123 197 .. 0.66 2 ! 95.7 3.6 1.5e-31 1.5e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.086 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n QRR16187.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 174 22...226777777777777777777776554 PP == domain 2 score: 95.7 bits; conditional E-value: 1.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ QRR16187.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****64246889********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+++tkrat +wg+s+ E++ QRR16187.1|CBM32 435 TLpNLN--GQGRYVRMVGTKRAT-QWGYSLDEMQ 465 777777..568*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.60 // Query: AJY25118.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-31 93.5 3.6 7e-31 93.5 3.6 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.1 0.08 0.08 10 29 .. 126 143 .. 122 183 .. 0.68 2 ? -1.9 0.0 0.23 0.23 54 88 .. 147 179 .. 138 195 .. 0.69 3 ! 93.5 3.6 7e-31 7e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.08 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 ss+a+ ++++++a Dg +t AJY25118.1|CBM32 126 SSGATRNEDPKFAADG--KT 143 4444555778888888..33 PP == domain 2 score: -1.9 bits; conditional E-value: 0.23 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttdgt 88 + + g++k+ ++++ + g +t v++ +n + g+ AJY25118.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVSLTNAPAGS 179 3...23889999999999999999998876644343 PP == domain 3 score: 93.5 bits; conditional E-value: 7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ AJY25118.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ AJY25118.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 42.59 // Query: QFR11633.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 3.5 2.5e-31 94.9 3.5 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 94.9 3.5 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + QFR11633.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ QFR11633.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ QFR11633.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.68 // Query: QVN14235.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-31 95.7 6.4 1.5e-31 95.7 3.6 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.086 0.086 53 83 .. 146 174 .. 123 197 .. 0.66 2 ! 95.7 3.6 1.5e-31 1.5e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.086 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n QVN14235.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 174 22...226777777777777777777776554 PP == domain 2 score: 95.7 bits; conditional E-value: 1.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ QVN14235.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****64246889********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+++tkrat +wg+s+ E++ QVN14235.1|CBM32 435 TLpNLN--GQGRYVRMVGTKRAT-QWGYSLDEMQ 465 777777..568*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.48 // Query: AWG28716.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-31 95.9 5.1 1.4e-31 95.7 2.5 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.086 0.086 53 83 .. 146 174 .. 123 197 .. 0.66 2 ! 95.7 2.5 1.4e-31 1.4e-31 7 123 .. 347 465 .. 342 466 .. 0.83 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.086 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n AWG28716.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 174 22...226777777777777777777776554 PP == domain 2 score: 95.7 bits; conditional E-value: 1.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n +++++t AWG28716.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTgTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGVSYSHVT 435 334455666.99********877*****73356789********************877...9*****************9887754455566 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +ryvR+ +tkrat +wg+s++E++ AWG28716.1|CBM32 436 LpNLN--GHGRYVRMLGTKRAT-QWGYSLYEMQ 465 66777..558*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.07 // Query: BCM09382.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ BCM09382.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y BCM09382.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + BCM09382.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ BCM09382.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.47 // Query: ABK11820.1|CBM32 [L=487] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-31 94.6 5.8 4e-31 94.3 3.3 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.0 0.092 0.092 53 83 .. 164 192 .. 141 214 .. 0.66 2 ! 94.3 3.3 4e-31 4e-31 7 123 .. 365 483 .. 360 484 .. 0.82 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.092 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n ABK11820.1|CBM32 164 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 192 22...226777777777777777777776554 PP == domain 2 score: 94.3 bits; conditional E-value: 4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ +a++a+Dg++ trW s + qw+ vdLg+++tv+++ l+w a+ + y++++S+D+ +Wtt+++++n +++++t ABK11820.1|CBM32 365 AASASYNAS-LTADKAFDGNTAsTRWDSPEgagvdpQWISVDLGATKTVSSIDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGVSYSHVT 453 334455566.99********8659****73356789********************877...9*****************9887754455566 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +ryvR+ +tkrat +wg+s++E++ ABK11820.1|CBM32 454 LpNLN--GHGRYVRMLGTKRAT-QWGYSLYEMQ 483 66777..558*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (487 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 93.80 // Query: QOK84435.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-30 90.8 3.1 4.6e-30 90.8 3.1 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.1 0.21 0.21 59 85 .. 150 176 .. 124 199 .. 0.66 2 ? -2.4 0.1 0.35 0.35 106 106 .. 289 289 .. 240 325 .. 0.56 3 ! 90.8 3.1 4.6e-30 4.6e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.21 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt QOK84435.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -2.4 bits; conditional E-value: 0.35 CBM32.hmm 106 t 106 QOK84435.1|CBM32 289 S 289 2 PP == domain 3 score: 90.8 bits; conditional E-value: 4.6e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt +++++n g + QOK84435.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAVQTSNDGVNWTNIYATSNGIAyG-H 439 33..344445589********758*****65114579********************878...******************9876644323.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+ +t+rat +wg++i E++ QOK84435.1|CBM32 440 AVLsNLH--GSGRYVRMLGTQRAT-QWGYAIDEMQ 471 4444887..568*******99887.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.08 // Query: AGH86232.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AGH86232.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AGH86232.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AGH86232.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AGH86232.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.38 // Query: QCX51326.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-31 94.0 3.0 4.7e-31 94.0 3.0 2.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.1 0.086 0.086 59 95 .. 150 186 .. 122 206 .. 0.71 2 ? -2.1 0.1 0.28 0.28 101 101 .. 284 284 .. 233 325 .. 0.55 3 ! 94.0 3.0 4.7e-31 4.7e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.086 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QCX51326.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667788888888888999998887755333.3244666 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 101 r 101 QCX51326.1|CBM32 284 N 284 2 PP == domain 3 score: 94.0 bits; conditional E-value: 4.7e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt +++++n g + QCX51326.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAVQTSNDGVNWTSIYATSNGIAyG-H 439 33..344445589********7359****65114579********************878...******************9876643323.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat wg+si E++ QCX51326.1|CBM32 440 AVLsNLH--GSGRYVRMYGTQRAT-PWGYSIDEMQ 471 4444887..568*******88876.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.28 // Query: ASE98441.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-32 97.4 2.3 4.3e-32 97.4 2.3 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.15 0.15 54 84 .. 147 175 .. 134 195 .. 0.72 2 ? -3.5 0.0 0.75 0.75 50 69 .. 282 301 .. 275 319 .. 0.53 3 ! 97.4 2.3 4.3e-32 4.3e-32 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.15 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n ASE98441.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 3...2388999999999999999999876654 PP == domain 2 score: -3.5 bits; conditional E-value: 0.75 CBM32.hmm 50 kvvltw.aengrikdykvevS 69 + ++ + ++ +++ y+++v ASE98441.1|CBM32 282 GTNYVFfSS-TTAGGYQLYVG 301 444444322.34445555544 PP == domain 3 score: 97.4 bits; conditional E-value: 4.3e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t ASE98441.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagvgsQWISVDLGAVKRIDHVDLYWdAG---ALAYQIQTSNDNANWTTIYSTSNGGSYTHVT 436 334555566.99********877*****64245789********************878...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ ASE98441.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.95 // Query: AYZ94914.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-31 93.6 3.5 6.7e-31 93.6 3.5 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.0 0.17 0.17 53 82 .. 146 173 .. 124 195 .. 0.62 2 ! 93.6 3.5 6.7e-31 6.7e-31 7 123 .. 348 466 .. 343 467 .. 0.83 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.17 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekg 82 ++ + g++k+ ++++ + g +t v++ + AYZ94914.1|CBM32 146 FK---QnGDVKQGTLSYTSAGPVFTSVVSLT 173 22...22666666666666666666666554 PP == domain 2 score: 93.6 bits; conditional E-value: 6.7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ +a++a+Dg+++ trW s g qw+ vdLg++++++++ l+w a+ + y++++S+D+ +Wtt+++++n g ++ AYZ94914.1|CBM32 348 AASASYNAS-LTADKAFDGNTSsTRWDSPeGtgvdpQWISVDLGAVKQIRSIDLYWdAG---ALAYQIQTSNDNANWTTIYSTTNGAAyG-HV 435 334455566.99********9879****64246889********************878...9*****************9988755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ AYZ94914.1|CBM32 436 TLqNLN--GSGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.27 // Query: QUN39470.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n QUN39470.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ QUN39470.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ QUN39470.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 82.22 // Query: QET37115.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-31 94.5 5.2 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W QET37115.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t QET37115.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + QET37115.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.05 // Query: AXW68380.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AXW68380.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AXW68380.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW68380.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW68380.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 65.74 // Query: AST88733.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AST88733.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AST88733.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AST88733.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AST88733.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.67 // Query: QLR11877.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QLR11877.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QLR11877.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QLR11877.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QLR11877.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.69 // Query: QNN08136.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n QNN08136.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ QNN08136.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ QNN08136.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.20 // Query: AEG70933.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-30 90.5 2.2 6e-30 90.5 2.2 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.1 0.18 0.18 59 95 .. 150 186 .. 124 200 .. 0.67 2 ? -2.4 0.1 0.34 0.34 106 106 .. 289 289 .. 240 325 .. 0.56 3 ! 90.5 2.2 6e-30 6e-30 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.18 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgt.tetitfd 95 g++ + ++++ g +t v++ +ntt + +++ +f+ AEG70933.1|CBM32 150 GDVMQATLSYTRTGPIFTSVVDITNTT-PAiENSMPFA 186 667777888888888888888877654.2212244555 PP == domain 2 score: -2.4 bits; conditional E-value: 0.34 CBM32.hmm 106 t 106 AEG70933.1|CBM32 289 S 289 2 PP == domain 3 score: 90.5 bits; conditional E-value: 6e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt ++++++ + AEG70933.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAVQTSSDGVNWTNIYATSSGIA-YgH 439 33..344445589********758*****65114579********************878...******************87655332.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+ +t+rat wg+si E++ AEG70933.1|CBM32 440 AVLsNLH--GSGRYVRMLGTQRAT-PWGYSIDEMQ 471 4444887..568*******88876.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.60 // Query: QFS41460.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-32 97.4 2.5 4.4e-32 97.4 2.5 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.0 0.15 0.15 54 84 .. 147 175 .. 134 195 .. 0.72 2 ? -3.6 0.0 0.81 0.81 49 69 .. 281 301 .. 275 316 .. 0.51 3 ! 97.4 2.5 4.4e-32 4.4e-32 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.15 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n QFS41460.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 3...2388999999999999999999876654 PP == domain 2 score: -3.6 bits; conditional E-value: 0.81 CBM32.hmm 49 dkvvltw.aengrikdykvevS 69 ++ ++ + ++ +++ y+++v QFS41460.1|CBM32 281 NGTNYVFfSS-TTAGGYQLYVG 301 4444444322.34455555554 PP == domain 3 score: 97.4 bits; conditional E-value: 4.4e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t QFS41460.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagvgsQWISVDLGAAKRIDHVDLYWdAG---ALAYQIQTSNDNVNWTTIYSTSNGGSYTHVT 436 334555566.99********877*****64245789********************878...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ QFS41460.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.90 // Query: AXW12469.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AXW12469.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AXW12469.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW12469.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW12469.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.41 // Query: QRK11762.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-31 95.3 2.0 1.9e-31 95.3 2.0 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.0 0.15 0.15 58 95 .. 148 186 .. 135 204 .. 0.70 2 ? -2.6 0.0 0.39 0.39 38 47 .. 295 304 .. 259 323 .. 0.56 3 ! 95.3 2.0 1.9e-31 1.9e-31 6 123 .. 349 467 .. 343 468 .. 0.81 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.15 CBM32.hmm 58 n.grikdykvevStDgktWttvaekgnttdgtte.titfd 95 + g+i + ++++ + g +t v++ +nt ++ e + +f+ QRK11762.1|CBM32 148 QnGDIMQATLSYTSSGPVFTSVVNLTNTA-PDVEsSMPFA 186 23889999999999999999999876643.3322133555 PP == domain 2 score: -2.6 bits; conditional E-value: 0.39 CBM32.hmm 38 ltvdLgkptt 47 +++ Lg ++t QRK11762.1|CBM32 295 YQLYLGDTRT 304 2333333333 PP == domain 3 score: 95.3 bits; conditional E-value: 1.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdpn.trWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss +a+ g++na+Dg+++ trW s ++ qwl vdLg+++t+++v l+w a+ ++ y +++S+Dg +Wtt+++++n + g + QRK11762.1|CBM32 349 SA-SSSYNAS-LGPNNAFDGNTTsTRWNSieGSaagsQWLMVDLGSVRTINGVDLYWdAG---ARVYYLQASNDGVNWTTFYSTTNGVSyG-H 435 33.4555566.99********8769****65114579********************878...******************9998765434.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ ++ryvR+ +t+rat +wg+s+ E++ QRK11762.1|CBM32 436 VVLpNLN--GSGRYVRMLGTQRAT-QWGYSLDEMQ 467 5555777..568*******99887.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.78 // Query: QYD73156.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-31 94.8 8.5 2.7e-31 94.8 8.5 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.21 0.21 59 95 .. 151 187 .. 125 199 .. 0.67 2 ! 94.8 8.5 2.7e-31 2.7e-31 8 123 .. 352 471 .. 346 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.21 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + +v+ + g ++t v++ +nt g e + +f+ QYD73156.1|CBM32 151 GDVMEATVSFTSGGPQFTSVVNITNTAPGI-EsSMPFP 187 666677777777888888888776644333.3133555 PP == domain 2 score: 94.8 bits; conditional E-value: 2.7e-31 CBM32.hmm 8 essssaaggggaenavDgdpn.t.rWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.te 90 ++sss++++ +a++a+Dg++ t rW s ++ qw+tvdLg+++tv++v ++w a+ +k+y++++S+D+ +Wtt++++++ g+ ++ QYD73156.1|CBM32 352 TASSSYNSTLTAAKAFDGNTAnTsRWDSieGSaagtQWITVDLGAVKTVSAVDIYWdAG---AKTYQIQTSNDNANWTTIYSTSSGV-GSgHV 440 34555566699********75456****65114579********************878...******************9876533.55456 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ ++ryvR+++t+rat +wg+si E++ QYD73156.1|CBM32 441 SLaNLK--GSGRYVRMYGTQRAT-SWGYSIDEMQ 471 665888..568*******99886.7*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.91 // Query: AOL07615.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-31 94.5 6.1 4.7e-31 94.0 2.8 2.4 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.4 0.1 0.046 0.046 53 86 .. 146 177 .. 124 200 .. 0.71 2 ! 94.0 2.8 4.7e-31 4.7e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: 0.4 bits; conditional E-value: 0.046 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgnttd 86 ++ + g++k+ ++++ + g +t v++ +n ++ AOL07615.1|CBM32 146 FK---QnGDVKQATLSYTSAGPAFTSVVSLTNAPS 177 33...238889999999999999999987666443 PP == domain 2 score: 94.0 bits; conditional E-value: 4.7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ AOL07615.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+ +tkrat +wg+s+ E++ AOL07615.1|CBM32 436 TLpNLN--GHGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..458*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.57 // Query: CUV53021.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-31 93.4 3.2 7.7e-31 93.4 3.2 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.4 3.2 7.7e-31 7.7e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ CUV53021.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y CUV53021.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.4 bits; conditional E-value: 7.7e-31 CBM32.hmm 6 saessssaaggggaenavDgd.pntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd +ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + CUV53021.1|CBM32 353 SA--SSSYNSSLGAANAFDGDsANTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589*******9446*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ CUV53021.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 67.24 // Query: AXW20883.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-30 92.0 4.3 2e-30 92.0 4.3 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 198 .. 0.66 2 ? -1.6 0.1 0.2 0.2 22 32 .. 300 310 .. 240 336 .. 0.60 3 ! 92.0 4.3 2e-30 2e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AXW20883.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.6 bits; conditional E-value: 0.2 CBM32.hmm 22 avDgdpntrWs 32 + D +++ rWs AXW20883.1|CBM32 300 LGDASTGQRWS 310 22222222333 PP == domain 3 score: 92.0 bits; conditional E-value: 2e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ +a++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW20883.1|CBM32 353 SA--SSSYNSSLSADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW20883.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.90 // Query: QOK89356.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QOK89356.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QOK89356.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QOK89356.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QOK89356.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.08 // Query: QGR85527.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W QGR85527.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t QGR85527.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + QGR85527.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 93.59 // Query: AXV83448.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-30 92.8 3.9 1.1e-30 92.8 3.9 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 198 .. 0.66 2 ? -1.8 0.1 0.21 0.21 22 33 .. 300 311 .. 246 336 .. 0.61 3 ! 92.8 3.9 1.1e-30 1.1e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AXV83448.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.8 bits; conditional E-value: 0.21 CBM32.hmm 22 avDgdpntrWss 33 + D +++ rWs AXV83448.1|CBM32 300 LGDASTGQRWSL 311 222222224433 PP == domain 3 score: 92.8 bits; conditional E-value: 1.1e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXV83448.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXV83448.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.71 // Query: QTO21065.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-32 96.7 3.4 3.5e-31 94.4 2.1 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.5 0.0 0.042 0.042 53 86 .. 146 177 .. 132 200 .. 0.73 2 ! 94.4 2.1 3.5e-31 3.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: 0.5 bits; conditional E-value: 0.042 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgnttd 86 ++ + g+ik+ ++++ + g +t v++ +n + QTO21065.1|CBM32 146 FK---QnGDIKQATLSYTSAGPAFTSVVSLTNAPA 177 33...3389*****************998766443 PP == domain 2 score: 94.4 bits; conditional E-value: 3.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ +a++a+Dg+++ trW s + qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n +++++t QTO21065.1|CBM32 348 AASASYNAS-LTADKAFDGNATgTRWDSPEgagvdpQWISVDLGATKHIDHVDLYWdAG---ALVYQIQTSNDNVNWTTLYSTSNGGSYNHVT 436 334455566.99********876*****73356789********************877...9*****************9877654333456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ QTO21065.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66776..578*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.70 // Query: AXW07717.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-30 92.0 4.3 2e-30 92.0 4.3 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 198 .. 0.66 2 ? -1.7 0.1 0.2 0.2 21 21 .. 299 299 .. 240 333 .. 0.59 3 ! 92.0 4.3 2e-30 2e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AXW07717.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 21 n 21 + AXW07717.1|CBM32 299 Y 299 2 PP == domain 3 score: 92.0 bits; conditional E-value: 2e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ +a++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW07717.1|CBM32 353 SA--SSSYNSSLSADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW07717.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.18 // Query: AST30625.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-31 93.8 3.5 5.7e-31 93.8 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 144 180 .. 116 193 .. 0.68 2 ? -2.1 0.1 0.28 0.28 103 103 .. 280 280 .. 228 321 .. 0.56 3 ! 93.8 3.5 5.7e-31 5.7e-31 6 123 .. 347 465 .. 342 466 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AST30625.1|CBM32 144 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 180 667777888888888888888877654333.2133554 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 103 v 103 v AST30625.1|CBM32 280 V 280 2 PP == domain 3 score: 93.8 bits; conditional E-value: 5.7e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AST30625.1|CBM32 347 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 433 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AST30625.1|CBM32 434 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 465 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.92 // Query: AXW30489.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AXW30489.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AXW30489.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW30489.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW30489.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.15 // Query: AXV92813.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-30 92.0 4.3 2e-30 92.0 4.3 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 198 .. 0.66 2 ? -1.6 0.1 0.2 0.2 22 32 .. 300 310 .. 240 336 .. 0.60 3 ! 92.0 4.3 2e-30 2e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AXV92813.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.6 bits; conditional E-value: 0.2 CBM32.hmm 22 avDgdpntrWs 32 + D +++ rWs AXV92813.1|CBM32 300 LGDASTGQRWS 310 22222222333 PP == domain 3 score: 92.0 bits; conditional E-value: 2e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ +a++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXV92813.1|CBM32 353 SA--SSSYNSSLSADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXV92813.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.33 // Query: QKL95298.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKL95298.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKL95298.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKL95298.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKL95298.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.73 // Query: ASL76081.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.13 0.13 59 95 .. 150 186 .. 122 201 .. 0.69 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ ASL76081.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v ASL76081.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + ASL76081.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ ASL76081.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.51 // Query: AQT53445.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-31 94.7 5.8 3.4e-31 94.5 3.1 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.086 0.086 53 83 .. 146 174 .. 123 197 .. 0.66 2 ! 94.5 3.1 3.4e-31 3.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.086 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n AQT53445.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 174 22...226777777777777777777776554 PP == domain 2 score: 94.5 bits; conditional E-value: 3.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ +a++a+Dg++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n +++++t AQT53445.1|CBM32 347 AASASYNAS-LTADKAFDGNTAsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGVSYSHVT 435 334455566.99********8659****73356789********************877...9*****************9887754455566 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +ryvR+ +tkrat +wg+s++E++ AQT53445.1|CBM32 436 LpNLN--GHGRYVRMLGTKRAT-QWGYSLYEMQ 465 66777..558*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 89.10 // Query: AIO28951.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-32 97.4 2.3 4.3e-32 97.4 2.3 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.15 0.15 54 84 .. 147 175 .. 134 195 .. 0.72 2 ? -3.5 0.0 0.75 0.75 50 69 .. 282 301 .. 275 319 .. 0.53 3 ! 97.4 2.3 4.3e-32 4.3e-32 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.15 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n AIO28951.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 3...2388999999999999999999876654 PP == domain 2 score: -3.5 bits; conditional E-value: 0.75 CBM32.hmm 50 kvvltw.aengrikdykvevS 69 + ++ + ++ +++ y+++v AIO28951.1|CBM32 282 GTNYVFfSS-TTAGGYQLYVG 301 444444322.34445555544 PP == domain 3 score: 97.4 bits; conditional E-value: 4.3e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t AIO28951.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagvgsQWISVDLGAVKRIDHVDLYWdAG---ALAYQIQTSNDNANWTTIYSTSNGGSYTHVT 436 334555566.99********877*****64245789********************878...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ AIO28951.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.61 // Query: AQQ47312.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n AQQ47312.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ AQQ47312.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ AQQ47312.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.45 // Query: QIX14780.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W QIX14780.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t QIX14780.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + QIX14780.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.22 // Query: QKM09826.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKM09826.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKM09826.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKM09826.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKM09826.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.18 // Query: QQV58214.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-30 92.8 3.9 1.1e-30 92.8 3.9 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 199 .. 0.66 2 ? -1.9 0.1 0.24 0.24 38 38 .. 296 296 .. 240 330 .. 0.57 3 ! 92.8 3.9 1.1e-30 1.1e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt QQV58214.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 38 l 38 + QQV58214.1|CBM32 296 Y 296 1 PP == domain 3 score: 92.8 bits; conditional E-value: 1.1e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QQV58214.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QQV58214.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 65.48 // Query: QKM20256.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKM20256.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKM20256.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKM20256.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKM20256.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 75.44 // Query: QOH40157.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-31 95.4 2.6 1.8e-31 95.4 2.6 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.15 0.15 54 84 .. 147 175 .. 134 195 .. 0.72 2 ? -3.0 0.1 0.51 0.51 50 69 .. 282 301 .. 272 322 .. 0.51 3 ! 95.4 2.6 1.8e-31 1.8e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.15 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n QOH40157.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 3...2388999999999999999999876654 PP == domain 2 score: -3.0 bits; conditional E-value: 0.51 CBM32.hmm 50 kvvltw.aengrikdykvevS 69 + ++ + ++ +++ y+++v QOH40157.1|CBM32 282 GTNYVFfSS-TTAGGYQLYVG 301 444443322.33444444444 PP == domain 3 score: 95.4 bits; conditional E-value: 1.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t QOH40157.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGasagsQWISVDLGAVKRIDHVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGGSYTHVT 436 334555566.99********877*****64145679********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ QOH40157.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.21 // Query: QQJ99779.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-31 93.5 3.6 7e-31 93.5 3.6 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.1 0.08 0.08 10 29 .. 126 143 .. 122 183 .. 0.68 2 ? -1.9 0.0 0.23 0.23 54 88 .. 147 179 .. 138 195 .. 0.69 3 ! 93.5 3.6 7e-31 7e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.08 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 ss+a+ ++++++a Dg +t QQJ99779.1|CBM32 126 SSGATRNEDPKFAADG--KT 143 4444555778888888..33 PP == domain 2 score: -1.9 bits; conditional E-value: 0.23 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttdgt 88 + + g++k+ ++++ + g +t v++ +n + g+ QQJ99779.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVSLTNAPAGS 179 3...23889999999999999999998876644343 PP == domain 3 score: 93.5 bits; conditional E-value: 7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ QQJ99779.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ QQJ99779.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 41.01 // Query: QGW70969.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 3.5 2.5e-31 94.9 3.5 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 94.9 3.5 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + QGW70969.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ QGW70969.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ QGW70969.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 79.16 // Query: QKM34917.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.13 0.13 59 95 .. 150 186 .. 122 201 .. 0.69 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKM34917.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v QKM34917.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKM34917.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKM34917.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.52 // Query: AXW82422.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-30 92.0 4.3 2e-30 92.0 4.3 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 198 .. 0.66 2 ? -1.7 0.1 0.2 0.2 21 21 .. 299 299 .. 240 333 .. 0.59 3 ! 92.0 4.3 2e-30 2e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AXW82422.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 21 n 21 + AXW82422.1|CBM32 299 Y 299 2 PP == domain 3 score: 92.0 bits; conditional E-value: 2e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ +a++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW82422.1|CBM32 353 SA--SSSYNSSLSADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW82422.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.44 // Query: CBJ53087.1|CBM32 [L=520] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-30 90.6 3.1 5.4e-30 90.6 3.1 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.9 0.1 0.24 0.24 59 85 .. 195 221 .. 169 243 .. 0.66 2 ? -3.2 0.0 0.61 0.61 39 41 .. 342 344 .. 311 371 .. 0.52 3 ! 90.6 3.1 5.4e-30 5.4e-30 6 123 .. 398 516 .. 392 517 .. 0.80 Alignments for each domain: == domain 1 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt CBJ53087.1|CBM32 195 GDVMQATLSYTSTGPIFTSVVDITNTA 221 666777788888888888888776643 PP == domain 2 score: -3.2 bits; conditional E-value: 0.61 CBM32.hmm 39 tvd 41 ++ CBJ53087.1|CBM32 342 QLY 344 222 PP == domain 3 score: 90.6 bits; conditional E-value: 5.4e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt +++++n g + CBJ53087.1|CBM32 398 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAVQTSNDGVNWTNIYATSNGIAyG-H 484 33..344445589********758*****65114579********************878...******************9876644323.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+ +t+rat +wg++i E++ CBJ53087.1|CBM32 485 AVLsNLH--GSGRYVRMLGTQRAT-QWGYAIDEMQ 516 4444887..568*******99887.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (520 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 90.55 // Query: BCN02763.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ BCN02763.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y BCN02763.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + BCN02763.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ BCN02763.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.89 // Query: VBB14894.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 2.3 3.6e-31 94.4 2.3 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.0 0.091 0.091 54 88 .. 147 179 .. 127 199 .. 0.73 2 ? -2.9 0.0 0.47 0.47 49 69 .. 281 301 .. 270 322 .. 0.52 3 ! 94.4 2.3 3.6e-31 3.6e-31 8 123 .. 349 466 .. 343 467 .. 0.81 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.091 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttdgt 88 + + g++k+ ++++ + g +t v++ +n + g+ VBB14894.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNAPAGS 179 3...33889999999999999999998876654344 PP == domain 2 score: -2.9 bits; conditional E-value: 0.47 CBM32.hmm 49 dkvvltw.aengrikdykvevS 69 ++ ++ + ++ +++ y+++v VBB14894.1|CBM32 281 NGTNYVFfSS-TTAGGYQLYVG 301 4444443322.33444444444 PP == domain 3 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 8 essssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgtteti 92 +s+s +++ ++++a+Dg+++ trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n +++++t VBB14894.1|CBM32 349 ASASYNTS-LTPDKAFDGNTTgTRWDSPeGagvgsQWISVDLGAVKHIDHVDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGGSYSHVTL 437 33344445.89********877*****64245789********************877...9*****************98776433445566 PP CBM32.hmm 93 .tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ VBB14894.1|CBM32 438 pNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 6776..578*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.55 // Query: AYB59009.1|CBM32 [L=478] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-30 91.1 3.2 4e-30 91.1 3.2 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.1 0.2 0.2 59 85 .. 153 179 .. 126 202 .. 0.66 2 ! 91.1 3.2 4e-30 4e-30 6 123 .. 356 474 .. 350 475 .. 0.80 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AYB59009.1|CBM32 153 GDVMQATLSYTSTGPIFTSVVDITNTA 179 566677777777888888887776543 PP == domain 2 score: 91.1 bits; conditional E-value: 4e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt +++++n g + AYB59009.1|CBM32 356 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTARTINGVDLYWdAG---AKTYAVQTSNDGVNWTNIYATSNGIAyG-H 442 33..344445589********758*****65114579********************878...******************9876644323.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+ +t+rat +wg++i E++ AYB59009.1|CBM32 443 AVLsNLH--GSGRYVRMLGTQRAT-QWGYAIDEMQ 474 4444887..568*******99887.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (478 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.12 // Query: BCM15823.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ BCM15823.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v BCM15823.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + BCM15823.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ BCM15823.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.46 // Query: QIK25584.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.13 0.13 59 95 .. 150 186 .. 122 201 .. 0.69 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QIK25584.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v QIK25584.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QIK25584.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QIK25584.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.00 // Query: BCM00389.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ BCM00389.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v BCM00389.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + BCM00389.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ BCM00389.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.74 // Query: QKZ29861.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKZ29861.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKZ29861.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKZ29861.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKZ29861.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.71 // Query: ATB36255.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-32 97.8 1.8 2e-31 95.2 1.9 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.0 0.15 0.15 58 95 .. 148 186 .. 135 205 .. 0.70 2 ! 95.2 1.9 2e-31 2e-31 6 123 .. 349 467 .. 343 468 .. 0.81 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.15 CBM32.hmm 58 n.grikdykvevStDgktWttvaekgnttdgtte.titfd 95 + g+i + ++++ + g +t v++ +nt ++ e + +f+ ATB36255.1|CBM32 148 QnGDIMQATLSYTSSGPVFTSVVNLTNTA-PDVEsSMPFA 186 23889999999999999999999876643.3322133555 PP == domain 2 score: 95.2 bits; conditional E-value: 2e-31 CBM32.hmm 6 saessssaaggggaenavDgdpn.trWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss +a+ g++na+Dg+++ trW s ++ qwl vdLg+++t+++v l+w a+ ++ y +++S+Dg +Wtt+++++n + g + ATB36255.1|CBM32 349 SA-SSSYNAS-LGPNNAFDGNTTsTRWNSieGSaagsQWLMVDLGSVRTINGVDLYWdAG---ARVYYLQASNDGVNWTTFYSTTNGVSyG-H 435 33.4555566.99********8769****65114579********************878...******************9998765434.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ ++ryvR+ +t+rat +wg+s+ E++ ATB36255.1|CBM32 436 VVLpNLN--GSGRYVRMLGTQRAT-QWGYSLVEMQ 467 5555777..568*******99887.8*****9986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 90.72 // Query: AYQ41415.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-31 95.8 5.6 2.2e-31 95.1 3.3 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.0 0.08 0.08 54 84 .. 147 175 .. 92 196 .. 0.70 2 ! 95.1 3.3 2.2e-31 2.2e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.08 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n AYQ41415.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 2...2377888888888888888888776553 PP == domain 2 score: 95.1 bits; conditional E-value: 2.2e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ AYQ41415.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334555566.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ AYQ41415.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.21 // Query: AMU08353.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n AMU08353.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ AMU08353.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ AMU08353.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 90.25 // Query: AKE06391.1|CBM32 [L=460] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-31 93.6 3.5 6.4e-31 93.6 3.5 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.4 0.0 0.17 0.17 53 82 .. 136 163 .. 114 185 .. 0.62 2 ! 93.6 3.5 6.4e-31 6.4e-31 7 123 .. 338 456 .. 333 457 .. 0.83 Alignments for each domain: == domain 1 score: -1.4 bits; conditional E-value: 0.17 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekg 82 ++ + g++k+ ++++ + g +t v++ + AKE06391.1|CBM32 136 FK---QnGDVKQGTLSYTSAGPVFTSVVSLT 163 22...22666666666666666666666554 PP == domain 2 score: 93.6 bits; conditional E-value: 6.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ +a++a+Dg+++ trW s g qw+ vdLg++++++++ l+w a+ + y++++S+D+ +Wtt+++++n g ++ AKE06391.1|CBM32 338 AASASYNAS-LTADKAFDGNTSsTRWDSPeGtgvdpQWISVDLGAVKQIRSIDLYWdAG---ALAYQIQTSNDNANWTTIYSTTNGAAyG-HV 425 334455566.99********9879****64246889********************878...9*****************9988755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ AKE06391.1|CBM32 426 TLqNLN--GSGRYVRMLGTKRAT-QWGYSLDEMQ 456 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (460 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.69 // Query: AKZ28329.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AKZ28329.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v AKZ28329.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AKZ28329.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AKZ28329.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.16 // Query: CBJ34611.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-30 92.8 3.9 1.1e-30 92.8 3.9 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 199 .. 0.66 2 ? -1.9 0.1 0.24 0.24 38 38 .. 296 296 .. 240 330 .. 0.57 3 ! 92.8 3.9 1.1e-30 1.1e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt CBJ34611.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 38 l 38 + CBJ34611.1|CBM32 296 Y 296 1 PP == domain 3 score: 92.8 bits; conditional E-value: 1.1e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + CBJ34611.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ CBJ34611.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.84 // Query: AXW59146.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AXW59146.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AXW59146.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW59146.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW59146.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 69.50 // Query: QKM00379.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKM00379.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKM00379.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKM00379.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKM00379.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.97 // Query: QGR89928.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-32 96.5 5.4 8.3e-32 96.5 3.7 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 96.5 3.7 8.3e-32 8.3e-32 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W QGR89928.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 96.5 bits; conditional E-value: 8.3e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t QGR89928.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALAYQIQTSNDNVNWTTIYSTTNGVSYQHVT 437 334455555.9*********8769****64246889********************878...9*****************9988754343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + QGR89928.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 66666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 91.37 // Query: AOR70873.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-31 96.0 2.1 1.1e-31 96.0 2.1 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.9 0.0 0.11 0.11 54 85 .. 147 176 .. 126 197 .. 0.72 2 ? -2.9 0.0 0.47 0.47 49 69 .. 281 301 .. 270 322 .. 0.52 3 ! 96.0 2.1 1.1e-31 1.1e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.9 bits; conditional E-value: 0.11 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgntt 85 + + g++k+ ++++ + g +t v++ +n + AOR70873.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 3...23889999999999999999998766543 PP == domain 2 score: -2.9 bits; conditional E-value: 0.47 CBM32.hmm 49 dkvvltw.aengrikdykvevS 69 ++ ++ + ++ +++ y+++v AOR70873.1|CBM32 281 NGTNYVFfSS-TTAGGYQLYVG 301 4444443322.33444444444 PP == domain 3 score: 96.0 bits; conditional E-value: 1.1e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n +++++t AOR70873.1|CBM32 348 AASASYNAS-MTPDKAFDGNTTgTRWDSPEgagvdpQWISVDLGATKHIDHVDLYWdAG---ALVYQIQTSNDNVNWTTIYATSNGGSYSHVT 436 344556677.9*********877*****73356789********************877...9*****************8776643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ AOR70873.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66776..578*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.74 // Query: QKL53852.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QKL53852.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QKL53852.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QKL53852.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QKL53852.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.24 // Query: QSL27180.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W QSL27180.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t QSL27180.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + QSL27180.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.08 // Query: AKM38556.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-31 94.5 6.1 4.7e-31 94.0 2.8 2.4 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.4 0.1 0.046 0.046 53 86 .. 146 177 .. 124 200 .. 0.71 2 ! 94.0 2.8 4.7e-31 4.7e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: 0.4 bits; conditional E-value: 0.046 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgnttd 86 ++ + g++k+ ++++ + g +t v++ +n ++ AKM38556.1|CBM32 146 FK---QnGDVKQATLSYTSAGPAFTSVVSLTNAPS 177 33...238889999999999999999987666443 PP == domain 2 score: 94.0 bits; conditional E-value: 4.7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ AKM38556.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+ +tkrat +wg+s+ E++ AKM38556.1|CBM32 436 TLpNLN--GHGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..458*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.25 // Query: APF90204.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ APF90204.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y APF90204.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + APF90204.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ APF90204.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 65.96 // Query: BAX60967.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-31 94.0 4.9 4.9e-31 94.0 3.0 1.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.0 0.4 0.4 58 79 .. 148 170 .. 125 183 .. 0.66 2 ! 94.0 3.0 4.9e-31 4.9e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.4 CBM32.hmm 58 n.grikdykvevStDgktWttva 79 + g++k+ ++++ + g +t v+ BAX60967.1|CBM32 148 QnGDVKQATLSYTSAGPVFTSVV 170 22666666666666666666665 PP == domain 2 score: 94.0 bits; conditional E-value: 4.9e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t BAX60967.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagvgtQWISVDLGTVKHIDHVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGVSYTHVT 436 334455666.99********877*****64245789********************877...9*****************9887654455556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ BAX60967.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.75 // Query: AQQ39482.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n AQQ39482.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ AQQ39482.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ AQQ39482.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.40 // Query: QDS30481.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 3.5 2.5e-31 94.9 3.5 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 94.9 3.5 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + QDS30481.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ QDS30481.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ QDS30481.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 79.43 // Query: AXW36441.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AXW36441.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AXW36441.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW36441.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW36441.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.60 // Query: AOI76515.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-31 94.5 5.5 5.1e-31 93.9 3.4 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.9 0.0 0.12 0.12 54 85 .. 147 176 .. 127 197 .. 0.72 2 ! 93.9 3.4 5.1e-31 5.1e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.9 bits; conditional E-value: 0.12 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgntt 85 + + g++k+ ++++ + g +t v++ +n + AOI76515.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 3...23889999999999999999998766543 PP == domain 2 score: 93.9 bits; conditional E-value: 5.1e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ +a++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ AOI76515.1|CBM32 348 AASASYDAS-LTADKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTNNGVSyG-HV 435 333455555.99********8769****73356789********************877...9*****************9887654433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ AOI76515.1|CBM32 436 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 466 776777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 89.04 // Query: CUV12040.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-31 94.0 3.0 4.7e-31 94.0 3.0 2.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.1 0.086 0.086 59 95 .. 150 186 .. 122 206 .. 0.71 2 ? -2.1 0.1 0.28 0.28 101 101 .. 284 284 .. 233 325 .. 0.55 3 ! 94.0 3.0 4.7e-31 4.7e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.086 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ CUV12040.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667788888888888999998887755333.3244666 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 101 r 101 CUV12040.1|CBM32 284 N 284 2 PP == domain 3 score: 94.0 bits; conditional E-value: 4.7e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt +++++n g + CUV12040.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAVQTSNDGVNWTSIYATSNGIAyG-H 439 33..344445589********7359****65114579********************878...******************9876643323.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat wg+si E++ CUV12040.1|CBM32 440 AVLsNLH--GSGRYVRMYGTQRAT-PWGYSIDEMQ 471 4444887..568*******88876.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.31 // Query: AVR18584.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 3.5 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W AVR18584.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t AVR18584.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + AVR18584.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.14 // Query: QIY39069.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-31 94.5 6.1 3.8e-31 94.4 3.3 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.086 0.086 53 83 .. 146 174 .. 123 197 .. 0.66 2 ! 94.4 3.3 3.8e-31 3.8e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.086 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n QIY39069.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 174 22...226777777777777777777776554 PP == domain 2 score: 94.4 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ +a++a+Dg++ trW s + qw+ vdLg+++tv+++ l+w a+ + y++++S+D+ +Wtt+++++n +++++t QIY39069.1|CBM32 347 AASASYNAS-LTADKAFDGNTAsTRWDSPEgagvdpQWISVDLGATKTVSSIDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGVSYSHVT 435 334455566.99********8659****73356789********************877...9*****************9887754455566 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +ryvR+ +tkrat +wg+s++E++ QIY39069.1|CBM32 436 LpNLN--GHGRYVRMLGTKRAT-QWGYSLYEMQ 465 66777..558*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.44 // Query: QIK30322.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.13 0.13 59 95 .. 150 186 .. 122 201 .. 0.69 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QIK30322.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v QIK30322.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QIK30322.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QIK30322.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.59 // Query: QJC23825.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-30 90.5 2.2 6e-30 90.5 2.2 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.1 0.18 0.18 59 95 .. 150 186 .. 124 200 .. 0.67 2 ? -2.4 0.1 0.34 0.34 106 106 .. 289 289 .. 240 325 .. 0.56 3 ! 90.5 2.2 6e-30 6e-30 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.18 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgt.tetitfd 95 g++ + ++++ g +t v++ +ntt + +++ +f+ QJC23825.1|CBM32 150 GDVMQATLSYTRTGPIFTSVVDITNTT-PAiENSMPFA 186 667777888888888888888877654.2212244555 PP == domain 2 score: -2.4 bits; conditional E-value: 0.34 CBM32.hmm 106 t 106 QJC23825.1|CBM32 289 S 289 2 PP == domain 3 score: 90.5 bits; conditional E-value: 6e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt ++++++ + QJC23825.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAVQTSSDGVNWTNIYATSSGIA-YgH 439 33..344445589********758*****65114579********************878...******************87655332.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+ +t+rat wg+si E++ QJC23825.1|CBM32 440 AVLsNLH--GSGRYVRMLGTQRAT-PWGYSIDEMQ 471 4444887..568*******88876.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.45 // Query: QUN50437.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 3.5 2.5e-31 94.9 3.5 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 94.9 3.5 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + QUN50437.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ QUN50437.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ QUN50437.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 93.80 // Query: CUV16032.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ CUV16032.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y CUV16032.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + CUV16032.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ CUV16032.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.86 // Query: AXV78791.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-30 92.0 4.3 2e-30 92.0 4.3 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 198 .. 0.66 2 ? -1.6 0.1 0.2 0.2 22 32 .. 300 310 .. 240 336 .. 0.60 3 ! 92.0 4.3 2e-30 2e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AXV78791.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.6 bits; conditional E-value: 0.2 CBM32.hmm 22 avDgdpntrWs 32 + D +++ rWs AXV78791.1|CBM32 300 LGDASTGQRWS 310 22222222333 PP == domain 3 score: 92.0 bits; conditional E-value: 2e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ +a++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXV78791.1|CBM32 353 SA--SSSYNSSLSADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXV78791.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.40 // Query: AOJ89966.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-31 95.7 4.3 3.9e-31 94.3 3.4 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.6 0.0 0.19 0.19 54 86 .. 147 177 .. 135 196 .. 0.68 2 ! 94.3 3.4 3.9e-31 3.9e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.6 bits; conditional E-value: 0.19 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttd 86 + + g++k+ ++++ + g +t v++ +n ++ AOJ89966.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVSLTNAPS 177 3...238899999999999999999988766443 PP == domain 2 score: 94.3 bits; conditional E-value: 3.9e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++++++v l+w a+ + y++++StD+ +Wttv++++n + g ++ AOJ89966.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGTVKKISSVDLYWdAG---ALVYQIQTSTDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ AOJ89966.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.38 // Query: AZQ55625.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-31 95.6 5.0 1.9e-31 95.4 2.4 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.087 0.087 53 83 .. 146 174 .. 123 197 .. 0.66 2 ! 95.4 2.4 1.9e-31 1.9e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.087 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n AZQ55625.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 174 22...226777777777777777777776554 PP == domain 2 score: 95.4 bits; conditional E-value: 1.9e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t AZQ55625.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagvgsQWISVDLGAVKHIDHVDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGGSYTHVT 436 334455666.99********877*****64245789********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +t+rat +wg+s++E++ AZQ55625.1|CBM32 437 LpNLN--GNGRYVRMLGTQRAT-QWGYSLYEMQ 466 66666..578*******99887.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.67 // Query: AXV88237.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-30 92.0 4.3 2e-30 92.0 4.3 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 198 .. 0.66 2 ? -1.7 0.1 0.2 0.2 21 21 .. 299 299 .. 240 333 .. 0.59 3 ! 92.0 4.3 2e-30 2e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AXV88237.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 21 n 21 + AXV88237.1|CBM32 299 Y 299 2 PP == domain 3 score: 92.0 bits; conditional E-value: 2e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ +a++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXV88237.1|CBM32 353 SA--SSSYNSSLSADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXV88237.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 69.78 // Query: BCL95285.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ BCL95285.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v BCL95285.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + BCL95285.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ BCL95285.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.83 // Query: AXW25510.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-30 92.0 4.3 2e-30 92.0 4.3 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 198 .. 0.66 2 ? -1.7 0.1 0.2 0.2 21 21 .. 299 299 .. 240 333 .. 0.59 3 ! 92.0 4.3 2e-30 2e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AXW25510.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 21 n 21 + AXW25510.1|CBM32 299 Y 299 2 PP == domain 3 score: 92.0 bits; conditional E-value: 2e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ +a++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW25510.1|CBM32 353 SA--SSSYNSSLSADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW25510.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.80 // Query: QUP56153.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-30 92.0 4.3 2e-30 92.0 4.3 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 199 .. 0.66 2 ? -2.0 0.1 0.25 0.25 38 38 .. 296 296 .. 240 329 .. 0.57 3 ! 92.0 4.3 2e-30 2e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt QUP56153.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -2.0 bits; conditional E-value: 0.25 CBM32.hmm 38 l 38 + QUP56153.1|CBM32 296 Y 296 1 PP == domain 3 score: 92.0 bits; conditional E-value: 2e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ +a++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QUP56153.1|CBM32 353 SA--SSSYNSSLSADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QUP56153.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.84 // Query: ALX15129.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 4.3 5.5e-31 93.8 2.4 1.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.0 0.53 0.53 59 79 .. 150 170 .. 126 184 .. 0.60 2 ! 93.8 2.4 5.5e-31 5.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.53 CBM32.hmm 59 grikdykvevStDgktWttva 79 g++k+ ++++ + g t t v+ ALX15129.1|CBM32 150 GDVKQATLSYTSAGPTLTSVV 170 555555555555555555554 PP == domain 2 score: 93.8 bits; conditional E-value: 5.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t ALX15129.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgsQWISVDLGAVKHIDHVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGVSYT--H 434 334555566.99********8769****64245789********************877...9*****************9887654355..4 PP CBM32.hmm 92 itfd.kpvtaryvRltvtkratnawgasiaEla 123 +t++ + ++ryvR+ +t+rat +wg+s++E++ ALX15129.1|CBM32 435 VTLPhLNGSGRYVRMLGTQRAT-QWGYSLYEMQ 466 4666544679*******99887.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.45 // Query: QIK35352.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.13 0.13 59 95 .. 150 186 .. 122 201 .. 0.69 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ QIK35352.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v QIK35352.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + QIK35352.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QIK35352.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.22 // Query: AYZ62812.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-30 92.2 3.2 1.8e-30 92.2 3.2 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 0.0 0.13 0.13 53 85 .. 146 176 .. 127 197 .. 0.73 2 ? -3.1 0.1 0.56 0.56 51 69 .. 283 301 .. 275 322 .. 0.50 3 ! 92.2 3.2 1.8e-30 1.8e-30 8 123 .. 349 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.13 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + AYZ62812.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 33...33889999999999999999998876543 PP == domain 2 score: -3.1 bits; conditional E-value: 0.56 CBM32.hmm 51 vvltw.aengrikdykvevS 69 ++ + ++ +++ y+++v AYZ62812.1|CBM32 283 TNYVFfSS-TTAGGYQLYVG 301 44443322.33445555544 PP == domain 3 score: 92.2 bits; conditional E-value: 1.8e-30 CBM32.hmm 8 essssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gttet 91 +s+s +++ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n g ++ AYZ62812.1|CBM32 349 ASASYNSS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGAVKTINGVDLYWdAG---ALVYQIQTSSDNVNWTTIYSTSNGVAwG-HVA 436 33344444.89********8769****73356789********************877...9*****************9887754434.578 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 i +++ +ryvR+++tkrat +wg+s+ E++ AYZ62812.1|CBM32 437 IpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 88998..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.77 // Query: ABB10683.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-32 97.5 4.3 1.2e-31 96.0 3.3 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 0.0 0.13 0.13 54 85 .. 147 176 .. 134 195 .. 0.71 2 ! 96.0 3.3 1.2e-31 1.2e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.13 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgntt 85 + + g++k+ ++++ + g +t v++ +n + ABB10683.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 3...33889999999999999999998866543 PP == domain 2 score: 96.0 bits; conditional E-value: 1.2e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ ABB10683.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTINSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTNNGVSyG-HV 435 334555566.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ ABB10683.1|CBM32 436 TLpNLN--GHGRYVRMVGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.24 // Query: CUV60321.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -1.7 0.1 0.2 0.2 105 105 .. 288 288 .. 233 329 .. 0.55 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ CUV60321.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 105 l 105 + CUV60321.1|CBM32 288 F 288 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + CUV60321.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ CUV60321.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.82 // Query: AJY09517.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-31 93.6 3.5 6.7e-31 93.6 3.5 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.0 0.17 0.17 53 82 .. 146 173 .. 124 195 .. 0.62 2 ! 93.6 3.5 6.7e-31 6.7e-31 7 123 .. 348 466 .. 343 467 .. 0.83 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.17 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekg 82 ++ + g++k+ ++++ + g +t v++ + AJY09517.1|CBM32 146 FK---QnGDVKQGTLSYTSAGPVFTSVVSLT 173 22...22666666666666666666666554 PP == domain 2 score: 93.6 bits; conditional E-value: 6.7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ +a++a+Dg+++ trW s g qw+ vdLg++++++++ l+w a+ + y++++S+D+ +Wtt+++++n g ++ AJY09517.1|CBM32 348 AASASYNAS-LTADKAFDGNTSsTRWDSPeGtgvdpQWISVDLGAVKQIRSIDLYWdAG---ALAYQIQTSNDNANWTTIYSTTNGAAyG-HV 435 334455566.99********9879****64246889********************878...9*****************9988755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ AJY09517.1|CBM32 436 TLqNLN--GSGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 87.02 // Query: AXW54580.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-30 92.8 3.9 1.1e-30 92.8 3.9 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 198 .. 0.66 2 ? -1.8 0.1 0.21 0.21 22 33 .. 300 311 .. 246 336 .. 0.61 3 ! 92.8 3.9 1.1e-30 1.1e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AXW54580.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.8 bits; conditional E-value: 0.21 CBM32.hmm 22 avDgdpntrWss 33 + D +++ rWs AXW54580.1|CBM32 300 LGDASTGQRWSL 311 222222224433 PP == domain 3 score: 92.8 bits; conditional E-value: 1.1e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AXW54580.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AXW54580.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.10 // Query: AZU58730.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ AZU58730.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y AZU58730.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + AZU58730.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ AZU58730.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.63 // Query: ABX17228.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W ABX17228.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t ABX17228.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + ABX17228.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 91.81 // Query: QOK98885.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-31 94.5 3.8 3.4e-31 94.5 3.8 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.4 0.1 0.16 0.16 59 88 .. 150 178 .. 123 198 .. 0.68 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 94.5 3.8 3.4e-31 3.4e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.4 bits; conditional E-value: 0.16 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgt 88 g++ + ++++ + g +t v++ +nt +t QOK98885.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA-PT 178 667777888888888888888876644.43 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y QOK98885.1|CBM32 285 Y 285 2 PP == domain 3 score: 94.5 bits; conditional E-value: 3.4e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt +++++n g + QOK98885.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAVQTSNDGVNWTSIYATSNGIAyG-H 439 33..344445589********7359****65114579********************878...******************9876643323.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ QOK98885.1|CBM32 440 AVLsNLH--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..568*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 67.87 // Query: AJW46734.1|CBM32 [L=474] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-30 92.8 6.1 1.1e-30 92.8 6.1 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.0 0.38 0.38 107 107 .. 290 290 .. 241 324 .. 0.55 2 ! 92.8 6.1 1.1e-30 1.1e-30 6 123 .. 352 470 .. 346 471 .. 0.81 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.38 CBM32.hmm 107 v 107 AJW46734.1|CBM32 290 S 290 2 PP == domain 2 score: 92.8 bits; conditional E-value: 1.1e-30 CBM32.hmm 6 saessssaaggggaenavDgdpn.trWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss +a+ g+++a+Dg+++ trW s ++ qwl vdLg+++t+++v l+w a+ +k y++++S+Dg +Wt +++++n + g + AJW46734.1|CBM32 352 SA-SSSYSAS-LGPAYAFDGNTTnTRWDSieGSaagtQWLMVDLGTTRTITGVDLYWdAG---AKVYSIQTSNDGVNWTNLYSTSNGASwG-H 438 33.3555556.99********7549****65114579********************878...******************9887765544.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ +++ ++ryvR+++t+rat +wg+s++E++ AJW46734.1|CBM32 439 TSLaNLK--GSGRYVRMYGTQRAT-QWGYSVNEMQ 470 6555998..568*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (474 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.37 // Query: AKH86410.1|CBM32|PL8 [L=974] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-50 156.0 13.2 1.5e-30 92.4 2.7 3.3 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.4 0.1 0.34 0.34 70 84 .. 82 96 .. 62 119 .. 0.62 2 ? -2.9 0.1 0.5 0.5 16 32 .. 283 296 .. 272 306 .. 0.71 3 ! 69.7 0.1 1.6e-23 1.6e-23 10 113 .. 731 834 .. 727 846 .. 0.78 4 ! 92.4 2.7 1.5e-30 1.5e-30 8 122 .. 857 969 .. 851 971 .. 0.83 Alignments for each domain: == domain 1 score: -2.4 bits; conditional E-value: 0.34 CBM32.hmm 70 tDgktWttvaekg.nt 84 Dg +W +v+ ++ n AKH86410.1|CBM32|PL8 82 ADG-SWSDVDYSAtNS 96 577.888885433132 PP == domain 2 score: -2.9 bits; conditional E-value: 0.5 CBM32.hmm 16 gggaenavDgdpntrWs 32 ++ a++++Dg trW AKH86410.1|CBM32|PL8 283 YDYASWVLDG---TRWM 296 3568889999...9996 PP == domain 3 score: 69.7 bits; conditional E-value: 1.6e-23 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetit 93 ss+++++ ga +++Dg+p+trW sa + +w vdL +p+ d+v l+w a ++ y vevS Dg++W+tv+++++ t gt +t AKH86410.1|CBM32|PL8 731 SSEQDTSVGAHFLTDGNPRTRWGSApSddEWAMVDLLTPQMADAVALHWdtA---FAQAYAVEVSPDGESWRTVHSTTSGTGGT-RTLA 815 455566688***************853699*******************644...5******************9987654344.3444 PP CBM32.hmm 94 fdkpvtaryvRltvtkratn 113 ++ p ++r+vRl+ tkr+t AKH86410.1|CBM32|PL8 816 IT-PQPVRFVRLNLTKRHTR 834 44.5556*******997753 PP == domain 4 score: 92.4 bits; conditional E-value: 1.5e-30 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttet 91 ++ss+ ++ +++na+Dg+++trW s++ qwl vdLg++t + +v+l+w a +k+y+++vS+Dg +Wt+v+++++ + g et AKH86410.1|CBM32|PL8 857 TASSTRVAELAPANATDGQDTTRWGSDYsdpQWLSVDLGSTTAIGTVKLHWetA---SAKSYRLQVSDDGGDWTDVHSTTSGPGGV-ET 941 34555566699***************86689********************644...5******************9887654343.57 PP CBM32.hmm 92 itfdkpvtaryvRltvtkratnawgasiaEl 122 i+++ ++aryvR+++t+r+t ++g+s++ + AKH86410.1|CBM32|PL8 942 IPVS--ADARYVRMYGTQRNT-QYGYSLFSF 969 8888..579*******88765.799999877 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (974 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.54 // Query: AZM50462.1|CBM32|PL8 [L=974] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-50 154.8 10.1 2.9e-30 91.5 0.8 3.4 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.1 0.37 0.37 70 83 .. 82 94 .. 61 117 .. 0.63 2 ? -3.0 0.1 0.53 0.53 16 32 .. 283 296 .. 272 305 .. 0.71 3 ! 68.3 0.0 4.5e-23 4.5e-23 10 113 .. 731 834 .. 727 846 .. 0.78 4 ! 91.5 0.8 2.9e-30 2.9e-30 7 122 .. 856 969 .. 850 971 .. 0.84 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.37 CBM32.hmm 70 tDgktWttvaekgn 83 Dg +W +v+ +++ AZM50462.1|CBM32|PL8 82 ADG-SWSDVDYSAT 94 577.8888854332 PP == domain 2 score: -3.0 bits; conditional E-value: 0.53 CBM32.hmm 16 gggaenavDgdpntrWs 32 ++ a++++Dg trW AZM50462.1|CBM32|PL8 283 YDYASWVLDG---TRWM 296 3568889999...9995 PP == domain 3 score: 68.3 bits; conditional E-value: 4.5e-23 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetit 93 ss+++++ ga +++Dg+p+trW sa + +w vdL +p+ d+v+l+w a ++ y vevS Dg++W+tv+++++ + gt +t AZM50462.1|CBM32|PL8 731 SSEQDTSVGAHFLTDGNPRTRWGSApSddEWAMVDLLTPQIADAVRLHWdtA---FAQAYAVEVSPDGESWRTVHSTTSGSGGT-RTLA 815 455566688***************853699*******************644...5******************9887644243.3445 PP CBM32.hmm 94 fdkpvtaryvRltvtkratn 113 ++ p ++r+vRl+ tkr+t AZM50462.1|CBM32|PL8 816 IS-PQPVRFVRLNLTKRHTR 834 54.5567*******997753 PP == domain 4 score: 91.5 bits; conditional E-value: 2.9e-30 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 a++ss+ ++ +++na+Dg+++trW s++ qwl +dLg++ + +v+l+w a +k+y+++vS+Dg Wt+v+++++ + g e AZM50462.1|CBM32|PL8 856 ATASSTRVPELAPANATDGQDTTRWGSDYsdpQWLSIDLGATVAIGTVKLHWetA---SAKSYRLQVSDDGGAWTDVHSTTSGPGGV-E 940 445666778899***************86689********************644...5******************9887654344.6 PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEl 122 ti+++ ++aryvR+++t+r+t ++g+s++ + AZM50462.1|CBM32|PL8 941 TIPLS--ADARYVRMYGTQRNT-QYGYSLFSF 969 89999..579*******88765.799999877 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (974 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.94 // Query: UNK03378.1|CBM32 [L=472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-31 94.6 3.6 3.2e-31 94.6 3.6 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.1 0.29 0.29 39 46 .. 297 304 .. 253 330 .. 0.57 2 ! 94.6 3.6 3.2e-31 3.2e-31 6 123 .. 351 468 .. 345 469 .. 0.80 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 39 tvdLgkpt 46 ++ Lg + UNK03378.1|CBM32 297 QLYLGDAS 304 22222222 PP == domain 2 score: 94.6 bits; conditional E-value: 3.2e-31 CBM32.hmm 6 saessssaaggggaenavDgdpn.trWssag.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 sa sss++++ g+++a+Dg+++ trW s + qwl vdLg+++t+++v l+w a+ +k y++++S+Dg +Wt +++++n g ++ UNK03378.1|CBM32 351 SA--SSSYSSSLGPAYAFDGNTTsTRWDSIEgvagtQWLMVDLGSTRTINGVDLYWdAG---AKVYSIQTSNDGVNWTNIYSTSNGVAyG-HV 437 33..444445589********8769****5224568********************878...******************9887754423.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+++t+rat +wg+s+ E++ UNK03378.1|CBM32 438 ALaNLK--GSGRYVRMYGTQRAT-QWGYSLDEMQ 468 444887..568*******99887.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (472 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.09 // Query: UQO71359.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQO71359.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQO71359.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQO71359.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.24 // Query: AST35503.1|CBM32 [L=478] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-30 90.8 3.1 4.6e-30 90.8 3.1 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.1 0.2 0.2 59 85 .. 153 179 .. 126 202 .. 0.66 2 ? -2.4 0.1 0.33 0.33 107 107 .. 293 293 .. 243 330 .. 0.57 3 ! 90.8 3.1 4.6e-30 4.6e-30 6 123 .. 356 474 .. 350 475 .. 0.80 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt AST35503.1|CBM32 153 GDVMQATLSYTSTGPIFTSVVDITNTA 179 566677777777888888887776543 PP == domain 2 score: -2.4 bits; conditional E-value: 0.33 CBM32.hmm 107 v 107 AST35503.1|CBM32 293 S 293 1 PP == domain 3 score: 90.8 bits; conditional E-value: 4.6e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt +++++n g + AST35503.1|CBM32 356 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAVQTSNDGVNWTNIYATSNGIAyG-H 442 33..344445589********758*****65114579********************878...******************9876644323.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+ +t+rat +wg++i E++ AST35503.1|CBM32 443 AVLsNLH--GSGRYVRMLGTQRAT-QWGYAIDEMQ 474 4444887..568*******99887.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (478 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.37 // Query: WJN75016.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 4.6 6e-31 93.7 2.5 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.09 0.09 53 83 .. 146 174 .. 123 196 .. 0.67 2 ! 93.7 2.5 6e-31 6e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.09 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n WJN75016.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 174 22...237777778887777777777776554 PP == domain 2 score: 93.7 bits; conditional E-value: 6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++ ++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ WJN75016.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKAISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ WJN75016.1|CBM32 435 TLpNLK--AQGRYVRMLGTKRAT-QWGYSLDEMQ 465 666776..468*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 87.88 // Query: UXZ92072.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n UXZ92072.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ UXZ92072.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ UXZ92072.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.89 // Query: UJH77036.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-31 94.7 5.8 3.4e-31 94.5 3.1 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.086 0.086 53 83 .. 146 174 .. 123 197 .. 0.66 2 ! 94.5 3.1 3.4e-31 3.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.086 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n UJH77036.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 174 22...226777777777777777777776554 PP == domain 2 score: 94.5 bits; conditional E-value: 3.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ +a++a+Dg++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n +++++t UJH77036.1|CBM32 347 AASASYNAS-LTADKAFDGNTAsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGVSYSHVT 435 334455566.99********8659****73356789********************877...9*****************9887754455566 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +ryvR+ +tkrat +wg+s++E++ UJH77036.1|CBM32 436 LpNLN--GHGRYVRMLGTKRAT-QWGYSLYEMQ 465 66777..558*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.16 // Query: XRA72677.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XRA72677.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y XRA72677.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XRA72677.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XRA72677.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.00 // Query: WFN06436.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-31 94.5 6.1 4.7e-31 94.0 2.8 2.4 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.4 0.1 0.046 0.046 53 86 .. 146 177 .. 124 200 .. 0.71 2 ! 94.0 2.8 4.7e-31 4.7e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: 0.4 bits; conditional E-value: 0.046 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgnttd 86 ++ + g++k+ ++++ + g +t v++ +n ++ WFN06436.1|CBM32 146 FK---QnGDVKQATLSYTSAGPAFTSVVSLTNAPS 177 33...238889999999999999999987666443 PP == domain 2 score: 94.0 bits; conditional E-value: 4.7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ WFN06436.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+ +tkrat +wg+s+ E++ WFN06436.1|CBM32 436 TLpNLN--GHGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..458*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.77 // Query: BEU58883.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ BEU58883.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y BEU58883.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + BEU58883.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ BEU58883.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.66 // Query: UZF27650.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ UZF27650.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y UZF27650.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + UZF27650.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ UZF27650.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 62.46 // Query: UXU91828.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-31 94.7 6.6 3.2e-31 94.6 2.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.2 0.0 0.027 0.027 54 85 .. 147 176 .. 134 198 .. 0.75 2 ? -3.5 0.0 0.72 0.72 52 75 .. 284 309 .. 276 322 .. 0.51 3 ! 94.6 2.5 3.2e-31 3.2e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: 1.2 bits; conditional E-value: 0.027 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgntt 85 + + g++k+ ++++ + g +ttv++ +n + UXU91828.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTTVVSLTNAP 176 3...33899*****************9876643 PP == domain 2 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 52 vltw.aengrikdykvevSt..DgktW 75 ++ + ++ +++ y+++v + g+ W UXU91828.1|CBM32 284 NYLFfSS-TTAGGYQLYVGDvtTGQRW 309 4444422.3455555555421124444 PP == domain 3 score: 94.6 bits; conditional E-value: 3.2e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t UXU91828.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagvgtQWISVDLGAVKHIDHVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGGSYTHVT 436 334455666.99********877*****64245789********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +t+rat +wg+s++E++ UXU91828.1|CBM32 437 LpNLN--GSGRYVRMLGTQRAT-QWGYSLYEMQ 466 66666..678*******99887.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.80 // Query: UQO31916.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-31 94.5 5.2 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQO31916.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQO31916.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQO31916.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.88 // Query: XFG24983.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-30 92.8 3.9 1.1e-30 92.8 3.9 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 199 .. 0.66 2 ? -1.9 0.1 0.24 0.24 38 38 .. 296 296 .. 240 330 .. 0.57 3 ! 92.8 3.9 1.1e-30 1.1e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt XFG24983.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 38 l 38 + XFG24983.1|CBM32 296 Y 296 1 PP == domain 3 score: 92.8 bits; conditional E-value: 1.1e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XFG24983.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XFG24983.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 67.57 // Query: XLH21694.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-32 96.6 4.1 2.4e-31 95.0 2.7 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.2 0.0 0.07 0.07 54 85 .. 147 176 .. 128 198 .. 0.74 2 ! 95.0 2.7 2.4e-31 2.4e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.2 bits; conditional E-value: 0.07 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgntt 85 + + g++k+ ++++ + g +t v++ +n + XLH21694.1|CBM32 147 K---QnGDVKQATLSYTSAGPAFTSVVSLTNAP 176 3...33899999999999999999999876643 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n +++++t XLH21694.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGATKHIDHVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGGSYSHVT 436 334455666.99********8769****64246889********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ XLH21694.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66776..578*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 90.08 // Query: UEP37175.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-31 93.5 3.6 7e-31 93.5 3.6 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.1 0.08 0.08 10 29 .. 126 143 .. 122 183 .. 0.68 2 ? -1.9 0.0 0.23 0.23 54 88 .. 147 179 .. 138 195 .. 0.69 3 ! 93.5 3.6 7e-31 7e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.08 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 ss+a+ ++++++a Dg +t UEP37175.1|CBM32 126 SSGATRNEDPKFAADG--KT 143 4444555778888888..33 PP == domain 2 score: -1.9 bits; conditional E-value: 0.23 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttdgt 88 + + g++k+ ++++ + g +t v++ +n + g+ UEP37175.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVSLTNAPAGS 179 3...23889999999999999999998876644343 PP == domain 3 score: 93.5 bits; conditional E-value: 7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ UEP37175.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ UEP37175.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 41.93 // Query: UQP23510.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQP23510.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQP23510.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQP23510.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 83.59 // Query: UQY84591.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ UQY84591.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y UQY84591.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + UQY84591.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ UQY84591.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.75 // Query: XAF41426.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-31 93.7 3.9 6e-31 93.7 3.9 2.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.0 0.2 0.031 0.031 9 29 .. 125 143 .. 121 160 .. 0.76 2 ? -2.2 0.0 0.28 0.28 57 88 .. 149 179 .. 142 195 .. 0.69 3 ! 93.7 3.9 6e-31 6e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: 1.0 bits; conditional E-value: 0.031 CBM32.hmm 9 ssssaaggggaenavDgdpnt 29 +ss+a+ ++++++a+Dg +t XAF41426.1|CBM32 125 NSSGATRNEDPKFATDG--KT 143 3555666699*******..44 PP == domain 2 score: -2.2 bits; conditional E-value: 0.28 CBM32.hmm 57 engrikdykvevStDgktWttvaekgnttdgt 88 + g++k+ ++++ + g +t v++ +n + g+ XAF41426.1|CBM32 149 N-GDVKQGTLSYTSAGPVFTSVVSLTNAPAGS 179 3.889999999999999999998876644343 PP == domain 3 score: 93.7 bits; conditional E-value: 6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ XAF41426.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ XAF41426.1|CBM32 436 TLpNLN--AQGRYVRMIGTKRAT-QWGYSLDEMQ 466 666777..568*******88877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 45.05 // Query: UAC73067.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 3.5 2.5e-31 94.9 3.5 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 94.9 3.5 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + UAC73067.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ UAC73067.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ UAC73067.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.80 // Query: UQO91149.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-31 94.5 5.2 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQO91149.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQO91149.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQO91149.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.50 // Query: UQP17103.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 3.5 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQP17103.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQP17103.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQP17103.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.45 // Query: XDZ74542.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-31 95.6 2.3 1.6e-31 95.6 2.3 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.0 0.15 0.15 54 84 .. 147 175 .. 134 195 .. 0.72 2 ? -3.7 0.0 0.83 0.83 49 69 .. 281 301 .. 275 315 .. 0.51 3 ! 95.6 2.3 1.6e-31 1.6e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.15 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n XDZ74542.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 3...2388999999999999999999876654 PP == domain 2 score: -3.7 bits; conditional E-value: 0.83 CBM32.hmm 49 dkvvltw.aengrikdykvevS 69 ++ ++ + ++ +++ y+++v XDZ74542.1|CBM32 281 NGTNYVFfSS-TTAGGYQLYVG 301 4444444322.34555555554 PP == domain 3 score: 95.6 bits; conditional E-value: 1.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t XDZ74542.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagagsQWISVDLGAVKRIDHVDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGGSYTHVT 436 334455666.99********877*****64145679********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +t+rat +wg+s++E++ XDZ74542.1|CBM32 437 LpNLN--GSGRYVRMLGTQRAT-QWGYSLYEMQ 466 66666..678*******99887.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.33 // Query: XOT33729.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-31 95.8 2.2 1.4e-31 95.8 2.2 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.0 0.14 0.14 54 84 .. 147 175 .. 134 198 .. 0.72 2 ? -3.0 0.1 0.52 0.52 50 69 .. 282 301 .. 273 322 .. 0.51 3 ! 95.8 2.2 1.4e-31 1.4e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n XOT33729.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 3...2388999999999999999999876654 PP == domain 2 score: -3.0 bits; conditional E-value: 0.52 CBM32.hmm 50 kvvltw.aengrikdykvevS 69 + ++ + ++ +++ y+++v XOT33729.1|CBM32 282 GTNYVFfSS-TTAGGYQLYVG 301 444443322.33445555544 PP == domain 3 score: 95.8 bits; conditional E-value: 1.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t XOT33729.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagagsQWISVDLGAVKRIDHVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGGSYTHVT 436 334555566.99********877*****64145679********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ XOT33729.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.02 // Query: WFF89518.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 3.5 2.5e-31 94.9 3.5 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 94.9 3.5 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + WFF89518.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ WFF89518.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ WFF89518.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.31 // Query: XQL35853.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 3.5 2.5e-31 94.9 3.5 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 94.9 3.5 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + XQL35853.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ XQL35853.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ XQL35853.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.67 // Query: XCY13342.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-32 98.2 3.7 1.1e-31 96.0 2.4 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.5 0.0 0.042 0.042 53 86 .. 146 177 .. 132 200 .. 0.73 2 ! 96.0 2.4 1.1e-31 1.1e-31 7 123 .. 348 466 .. 343 467 .. 0.83 Alignments for each domain: == domain 1 score: 0.5 bits; conditional E-value: 0.042 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgnttd 86 ++ + g+ik+ ++++ + g +t v++ +n + XCY13342.1|CBM32 146 FK---QnGDIKQATLSYTSAGPAFTSVVSLTNAPA 177 33...3389*****************998766443 PP == domain 2 score: 96.0 bits; conditional E-value: 1.1e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++a++a+Dg+++ trW s + qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n +++++t XCY13342.1|CBM32 348 AASASYNAS-FTADKAFDGNATgTRWDSPEgagvdpQWISVDLGATKHIDHVDLYWdAG---ALVYQIQTSNDNVNWTTLYSTSNGGSYNHVT 436 344566677.**********876*****73356789********************877...9*****************9877654333456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ XCY13342.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66776..578*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.28 // Query: XAQ39350.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.13 0.13 59 95 .. 150 186 .. 122 201 .. 0.69 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XAQ39350.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v XAQ39350.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XAQ39350.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XAQ39350.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 64.58 // Query: XRQ27288.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XRQ27288.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v XRQ27288.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XRQ27288.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XRQ27288.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.04 // Query: UQP24783.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQP24783.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQP24783.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQP24783.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 93.16 // Query: UYR14109.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ UYR14109.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y UYR14109.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + UYR14109.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ UYR14109.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.43 // Query: WFN13915.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 3.5 2.5e-31 94.9 3.5 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 94.9 3.5 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + WFN13915.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ WFN13915.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ WFN13915.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.38 // Query: XFG31037.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-30 92.8 3.9 1.1e-30 92.8 3.9 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 199 .. 0.66 2 ? -1.9 0.1 0.24 0.24 38 38 .. 296 296 .. 240 330 .. 0.57 3 ! 92.8 3.9 1.1e-30 1.1e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt XFG31037.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 38 l 38 + XFG31037.1|CBM32 296 Y 296 1 PP == domain 3 score: 92.8 bits; conditional E-value: 1.1e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XFG31037.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XFG31037.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.07 // Query: XJO25666.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 3.5 2.5e-31 94.9 3.5 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 94.9 3.5 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + XJO25666.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ XJO25666.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ XJO25666.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.54 // Query: UEP24297.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-30 92.8 4.3 1.2e-30 92.8 4.3 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.1 0.08 0.08 10 29 .. 126 143 .. 122 183 .. 0.68 2 ? -1.9 0.0 0.23 0.23 54 88 .. 147 179 .. 138 195 .. 0.69 3 ! 92.8 4.3 1.2e-30 1.2e-30 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.08 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 ss+a+ ++++++a Dg +t UEP24297.1|CBM32 126 SSGATRNEDPKFAADG--KT 143 4444555778888888..33 PP == domain 2 score: -1.9 bits; conditional E-value: 0.23 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttdgt 88 + + g++k+ ++++ + g +t v++ +n + g+ UEP24297.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVSLTNAPAGS 179 3...23889999999999999999998876644343 PP == domain 3 score: 92.8 bits; conditional E-value: 1.2e-30 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ UEP24297.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ UEP24297.1|CBM32 436 TLaNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 676888..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 41.65 // Query: XCV63327.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-31 93.9 4.7 8.6e-31 93.2 2.6 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.09 0.09 53 83 .. 146 174 .. 123 196 .. 0.67 2 ! 93.2 2.6 8.6e-31 8.6e-31 7 123 .. 347 465 .. 342 466 .. 0.83 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.09 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n XCV63327.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 174 22...237777778887777777777776554 PP == domain 2 score: 93.2 bits; conditional E-value: 8.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++ ++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ XCV63327.1|CBM32 347 AASTSYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKAISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 445666677.99********8769****73356789********************877...9*****************9887755433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ XCV63327.1|CBM32 435 TLpNLK--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 666777..458*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.09 // Query: XUK02409.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-31 95.8 2.2 1.4e-31 95.8 2.2 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.15 0.15 54 84 .. 147 175 .. 134 195 .. 0.72 2 ? -3.0 0.1 0.52 0.52 50 69 .. 282 301 .. 273 322 .. 0.51 3 ! 95.8 2.2 1.4e-31 1.4e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.15 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n XUK02409.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 3...2388999999999999999999876654 PP == domain 2 score: -3.0 bits; conditional E-value: 0.52 CBM32.hmm 50 kvvltw.aengrikdykvevS 69 + ++ + ++ +++ y+++v XUK02409.1|CBM32 282 GTNYVFfSS-TTAGGYQLYVG 301 444443322.33445555544 PP == domain 3 score: 95.8 bits; conditional E-value: 1.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t XUK02409.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagagsQWISVDLGAVKRIDHVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGGSYTHVT 436 334555566.99********877*****64145679********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ XUK02409.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.77 // Query: UQP36272.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQP36272.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQP36272.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQP36272.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.35 // Query: XMR99756.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-32 97.5 4.0 7.3e-32 96.7 2.4 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.0 0.15 0.15 54 84 .. 147 175 .. 134 195 .. 0.72 2 ! 96.7 2.4 7.3e-32 7.3e-32 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.15 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n XMR99756.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 3...2388999999999999999999876654 PP == domain 2 score: 96.7 bits; conditional E-value: 7.3e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ +++++a+Dg+++ trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t XMR99756.1|CBM32 348 AASASYSAS-FTPDKAFDGNTTgTRWDSPeGagvgsQWISVDLGAVKHIDHVDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGGSYTHVT 436 344556677.**********877*****64245789********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +t+rat +wg+s++E++ XMR99756.1|CBM32 437 LpNLN--GSGRYVRMLGTQRAT-QWGYSLYEMQ 466 66666..678*******99887.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.23 // Query: XWZ87625.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-31 94.2 4.5 4.3e-31 94.2 4.5 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.7 0.0 0.099 0.099 53 86 .. 146 177 .. 124 197 .. 0.73 2 ! 94.2 4.5 4.3e-31 4.3e-31 5 123 .. 347 466 .. 341 467 .. 0.80 Alignments for each domain: == domain 1 score: -0.7 bits; conditional E-value: 0.099 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgnttd 86 ++ + g++k+ ++++ + g +t +++ +n ++ XWZ87625.1|CBM32 146 FK---QnGDVKQATLSYTSAGPAFTSIVSLTNAPS 177 33...238899999999999999999988766443 PP == domain 2 score: 94.2 bits; conditional E-value: 4.3e-31 CBM32.hmm 5 ssaessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gt 88 +sa s+s++++ ++++a+Dg+++ trW s + qw+ vdLg+++++++v l+w a+ ++ y++++S+D+ +Wtt+++++n g XWZ87625.1|CBM32 347 ASA--SASYNTSLTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGAVKSISGVDLYWdAG---ASVYQIQTSSDNVNWTTLYSTTNGVAyG- 433 333..333444489********8769****73356789********************877...9*****************9988754433. PP CBM32.hmm 89 teti.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +++ ++ryvR+++tkrat +wg+s+ E++ XWZ87625.1|CBM32 434 HVKLsNLN--GQGRYVRMYGTKRAT-QWGYSLDEMQ 466 46555887..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.81 // Query: WWT61239.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-31 94.2 2.0 4.4e-31 94.2 2.0 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.0 0.097 0.097 53 83 .. 146 174 .. 122 195 .. 0.65 2 ? -3.5 0.0 0.72 0.72 52 75 .. 284 309 .. 276 322 .. 0.51 3 ! 94.2 2.0 4.4e-31 4.4e-31 7 123 .. 348 466 .. 343 467 .. 0.81 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.097 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n WWT61239.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 174 22...226677777777777777777665544 PP == domain 2 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 52 vltw.aengrikdykvevSt..DgktW 75 ++ + ++ +++ y+++v + g+ W WWT61239.1|CBM32 284 NYLFfSS-TTAGGYQLYVGDvtTGQRW 309 4444422.3455555555421124444 PP == domain 3 score: 94.2 bits; conditional E-value: 4.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+ + trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n +++++t WWT61239.1|CBM32 348 AASASYNAS-LTPDKAFDGNSTsTRWDSPeGagvgsQWISVDLGAVKHIDHVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGGSYSHVT 436 334455666.99*******96559****64245789********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +t+rat +wg+s++E++ WWT61239.1|CBM32 437 LpNLN--GSGRYVRMLGTQRAT-QWGYSLYEMQ 466 66776..578*******99887.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.47 // Query: WDS13830.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-31 93.5 3.6 7e-31 93.5 3.6 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.1 0.08 0.08 10 29 .. 126 143 .. 122 183 .. 0.68 2 ? -1.9 0.0 0.23 0.23 54 88 .. 147 179 .. 138 195 .. 0.69 3 ! 93.5 3.6 7e-31 7e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.08 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 ss+a+ ++++++a Dg +t WDS13830.1|CBM32 126 SSGATRNEDPKFAADG--KT 143 4444555778888888..33 PP == domain 2 score: -1.9 bits; conditional E-value: 0.23 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttdgt 88 + + g++k+ ++++ + g +t v++ +n + g+ WDS13830.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVSLTNAPAGS 179 3...23889999999999999999998876644343 PP == domain 3 score: 93.5 bits; conditional E-value: 7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ WDS13830.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ WDS13830.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 42.76 // Query: XDZ47703.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-30 92.8 3.9 1.1e-30 92.8 3.9 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 199 .. 0.66 2 ? -1.9 0.1 0.24 0.24 38 38 .. 296 296 .. 240 330 .. 0.57 3 ! 92.8 3.9 1.1e-30 1.1e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt XDZ47703.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 38 l 38 + XDZ47703.1|CBM32 296 Y 296 1 PP == domain 3 score: 92.8 bits; conditional E-value: 1.1e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XDZ47703.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XDZ47703.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.32 // Query: XTZ96156.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XTZ96156.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y XTZ96156.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XTZ96156.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XTZ96156.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.87 // Query: BEU53633.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ BEU53633.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y BEU53633.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + BEU53633.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ BEU53633.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.80 // Query: WDS26970.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-31 93.5 3.6 7e-31 93.5 3.6 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.1 0.08 0.08 10 29 .. 126 143 .. 122 183 .. 0.68 2 ? -1.9 0.0 0.23 0.23 54 88 .. 147 179 .. 138 195 .. 0.69 3 ! 93.5 3.6 7e-31 7e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.08 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 ss+a+ ++++++a Dg +t WDS26970.1|CBM32 126 SSGATRNEDPKFAADG--KT 143 4444555778888888..33 PP == domain 2 score: -1.9 bits; conditional E-value: 0.23 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttdgt 88 + + g++k+ ++++ + g +t v++ +n + g+ WDS26970.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVSLTNAPAGS 179 3...23889999999999999999998876644343 PP == domain 3 score: 93.5 bits; conditional E-value: 7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ WDS26970.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ WDS26970.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 44.13 // Query: WVN47234.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 4.3 2.5e-31 94.9 2.7 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.9 2.7 2.5e-31 2.5e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W WVN47234.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t WVN47234.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPEgmgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****73356789********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + WVN47234.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.04 // Query: WNG23203.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-31 95.4 1.6 1.8e-31 95.4 1.6 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.6 0.0 0.19 0.19 91 107 .. 284 299 .. 240 321 .. 0.55 2 ! 95.4 1.6 1.8e-31 1.8e-31 6 123 .. 349 467 .. 343 468 .. 0.81 Alignments for each domain: == domain 1 score: -1.6 bits; conditional E-value: 0.19 CBM32.hmm 91 titfdkpvta.ryvRltv 107 ++ f++ +ta ry l+ WNG23203.1|CBM32 284 YVFFSS-TTAgRY-QLYL 299 333332.223122.2222 PP == domain 2 score: 95.4 bits; conditional E-value: 1.8e-31 CBM32.hmm 6 saessssaaggggaenavDgdpn.trWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss +++ g++na+Dg+++ trW s ++ qwl vdLg+++t+++v l+w a+ ++ y ++vS+Dg +Wtt+++++n + g + WNG23203.1|CBM32 349 SA-SSSYDDS-LGPNNAFDGNTTsTRWDSieGSaagkQWLMVDLGSVRTINGVDLYWdAG---ARVYYLQVSNDGVNWTTFYSTTNGVSyG-H 435 33.3444455.99********8769****65125679********************878...******************9998765434.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ ++ryvR+ +t+rat +wg+s+ E++ WNG23203.1|CBM32 436 VVLpKLN--GSGRYVRMLGTQRAT-QWGYSLVEMQ 467 5555776..578*******99887.8*****9986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.68 // Query: XCX19784.1|CBM32 [L=472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-29 88.2 4.0 3.1e-29 88.2 4.0 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.1 0.28 0.28 17 29 .. 133 143 .. 123 227 .. 0.60 2 ? -2.2 0.1 0.28 0.28 38 51 .. 296 309 .. 251 330 .. 0.56 3 ! 88.2 4.0 3.1e-29 3.1e-29 8 123 .. 352 468 .. 345 469 .. 0.80 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 17 ggaenavDgdpnt 29 +++++ +Dg ++ XCX19784.1|CBM32 133 EDPKFSTDG--KS 143 666667776..33 PP == domain 2 score: -2.2 bits; conditional E-value: 0.28 CBM32.hmm 38 ltvdLgkpttvdkv 51 +++ Lg + t +++ XCX19784.1|CBM32 296 YQLYLGDASTGQRW 309 22222222222222 PP == domain 3 score: 88.2 bits; conditional E-value: 3.1e-29 CBM32.hmm 8 essssaaggggaenavDgdpn.trWss.ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtteti 92 +sss +a+ g+++a+Dgd++ trW s +g qwl vdLg+++t+++v l+w a+ +k y +++S+Dg tWt ++++++ + g ++ XCX19784.1|CBM32 352 ASSSYSAS-LGPAYAFDGDTTnTRWDSvEGvagaQWLMVDLGSTRTITGVDLYWdAG---AKVYYIQTSNDGLTWTNIYSTSSGASwG-HTAL 439 33445555.99********7549****6224569********************878...******************9876644434.4544 PP CBM32.hmm 93 .tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+++t+rat +wg+s+ E++ XCX19784.1|CBM32 440 aNLK--GSGRYVRMYGTQRAT-QWGYSLDEMQ 468 4888..568*******99887.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (472 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.18 // Query: BEV50139.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-31 94.7 5.8 3.4e-31 94.5 3.1 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.086 0.086 53 83 .. 146 174 .. 123 197 .. 0.66 2 ! 94.5 3.1 3.4e-31 3.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.086 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n BEV50139.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 174 22...226777777777777777777776554 PP == domain 2 score: 94.5 bits; conditional E-value: 3.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ +a++a+Dg++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n +++++t BEV50139.1|CBM32 347 AASASYNAS-LTADKAFDGNTAsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGVSYSHVT 435 334455566.99********8659****73356789********************877...9*****************9887754455566 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +ryvR+ +tkrat +wg+s++E++ BEV50139.1|CBM32 436 LpNLN--GHGRYVRMLGTKRAT-QWGYSLYEMQ 465 66777..558*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.17 // Query: UVE58276.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n UVE58276.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ UVE58276.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ UVE58276.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.32 // Query: XHO60654.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-30 93.0 4.6 1e-30 93.0 4.6 2.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.1 0.2 0.056 0.056 10 29 .. 126 143 .. 122 160 .. 0.74 2 ? -1.9 0.0 0.23 0.23 54 88 .. 147 179 .. 139 195 .. 0.68 3 ! 93.0 4.6 1e-30 1e-30 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: 0.1 bits; conditional E-value: 0.056 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 s++a+ ++++++a+Dg +t XHO60654.1|CBM32 126 STGATRNEDPKFATDG--KT 143 344455599*******..44 PP == domain 2 score: -1.9 bits; conditional E-value: 0.23 CBM32.hmm 54 twaengrikdykvevStDgktWttvaekgnttdgt 88 + ++ g++k+ ++++ + g +t v++ +n + g+ XHO60654.1|CBM32 147 K-QN-GDVKQGTLSYTSAGPVFTSVVSLTNAPAGS 179 3.23.889999999999999999998876644343 PP == domain 3 score: 93.0 bits; conditional E-value: 1e-30 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ XHO60654.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ XHO60654.1|CBM32 436 TLaNLN--AQGRYVRMIGTKRAT-QWGYSLDEMQ 466 676888..568*******88877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 41.97 // Query: XAZ63318.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n XAZ63318.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ XAZ63318.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ XAZ63318.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.82 // Query: UQO80616.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-31 94.5 5.2 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQO80616.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQO80616.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQO80616.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.04 // Query: UMY30336.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 3.5 2.5e-31 94.9 3.5 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 94.9 3.5 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + UMY30336.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ UMY30336.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ UMY30336.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.61 // Query: XTZ94057.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XTZ94057.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y XTZ94057.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XTZ94057.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XTZ94057.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.66 // Query: XAE51045.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-31 93.9 4.3 5.5e-31 93.8 2.4 1.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.0 0.53 0.53 59 79 .. 150 170 .. 126 184 .. 0.60 2 ! 93.8 2.4 5.5e-31 5.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.53 CBM32.hmm 59 grikdykvevStDgktWttva 79 g++k+ ++++ + g t t v+ XAE51045.1|CBM32 150 GDVKQATLSYTSAGPTLTSVV 170 555555555555555555554 PP == domain 2 score: 93.8 bits; conditional E-value: 5.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t XAE51045.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgsQWISVDLGAVKHIDHVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGVSYT--H 434 334555566.99********8769****64245789********************877...9*****************9887654355..4 PP CBM32.hmm 92 itfd.kpvtaryvRltvtkratnawgasiaEla 123 +t++ + ++ryvR+ +t+rat +wg+s++E++ XAE51045.1|CBM32 435 VTLPhLNGSGRYVRMLGTQRAT-QWGYSLYEMQ 466 4666544679*******99887.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 91.57 // Query: XKO99938.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -1.7 0.1 0.2 0.2 105 105 .. 288 288 .. 233 329 .. 0.55 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XKO99938.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 105 l 105 + XKO99938.1|CBM32 288 F 288 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XKO99938.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XKO99938.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.80 // Query: UXZ77506.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 3.5 2.5e-31 94.9 3.5 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 94.9 3.5 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + UXZ77506.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ UXZ77506.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ UXZ77506.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 86.75 // Query: XBT63160.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 3.5 2.5e-31 94.9 3.5 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 94.9 3.5 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + XBT63160.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ XBT63160.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ XBT63160.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.44 // Query: XTZ88931.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XTZ88931.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y XTZ88931.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XTZ88931.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XTZ88931.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.82 // Query: UQO14460.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-31 94.5 5.2 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQO14460.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQO14460.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQO14460.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 82.52 // Query: XTZ81025.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XTZ81025.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y XTZ81025.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XTZ81025.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XTZ81025.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.45 // Query: UTV59493.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-31 93.9 4.3 5.5e-31 93.8 2.4 1.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.0 0.53 0.53 59 79 .. 150 170 .. 126 184 .. 0.60 2 ! 93.8 2.4 5.5e-31 5.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.53 CBM32.hmm 59 grikdykvevStDgktWttva 79 g++k+ ++++ + g t t v+ UTV59493.1|CBM32 150 GDVKQATLSYTSAGPTLTSVV 170 555555555555555555554 PP == domain 2 score: 93.8 bits; conditional E-value: 5.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t UTV59493.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgsQWISVDLGAVKHIDHVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGVSYT--H 434 334555566.99********8769****64245789********************877...9*****************9887654355..4 PP CBM32.hmm 92 itfd.kpvtaryvRltvtkratnawgasiaEla 123 +t++ + ++ryvR+ +t+rat +wg+s++E++ UTV59493.1|CBM32 435 VTLPhLNGSGRYVRMLGTQRAT-QWGYSLYEMQ 466 4666544679*******99887.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.33 // Query: XDR28312.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-32 97.4 2.3 4.3e-32 97.4 2.3 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.0 0.091 0.091 54 84 .. 147 175 .. 134 196 .. 0.73 2 ? -3.0 0.1 0.5 0.5 50 69 .. 282 301 .. 273 323 .. 0.51 3 ! 97.4 2.3 4.3e-32 4.3e-32 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.091 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n XDR28312.1|CBM32 147 K---QnGDVKQATLSYTSAGPAFTSVVSLTNA 175 3...3389999999999999999999887654 PP == domain 2 score: -3.0 bits; conditional E-value: 0.5 CBM32.hmm 50 kvvltw.aengrikdykvevS 69 + ++ + ++ +++ y+++v XDR28312.1|CBM32 282 GTNYVFfSS-TTAGGYQLYVG 301 444443322.33445555544 PP == domain 3 score: 97.4 bits; conditional E-value: 4.3e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t XDR28312.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagvgsQWISVDLGAVKRIDHVDLYWdAG---ALAYQIQTSNDNANWTTIYSTSNGGSYTHVT 436 334555566.99********877*****64245789********************878...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ XDR28312.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.28 // Query: UEP30919.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-31 93.5 3.6 7e-31 93.5 3.6 2.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.6 0.2 0.039 0.039 10 29 .. 126 143 .. 121 183 .. 0.73 2 ? -3.2 0.0 0.58 0.58 59 75 .. 291 309 .. 276 323 .. 0.51 3 ! 93.5 3.6 7e-31 7e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: 0.6 bits; conditional E-value: 0.039 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 s++a+ ++++++a+Dg +t UEP30919.1|CBM32 126 STGATRNEDPKFATDG--KT 143 3344455889999999..44 PP == domain 2 score: -3.2 bits; conditional E-value: 0.58 CBM32.hmm 59 grikdykvevSt..DgktW 75 +++ y+++v + g+ W UEP30919.1|CBM32 291 TTAGGYQIYVGDvtTGQRW 309 3344555555421123334 PP == domain 3 score: 93.5 bits; conditional E-value: 7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ UEP30919.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ UEP30919.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 43.40 // Query: UQN64002.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 3.5 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQN64002.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQN64002.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQN64002.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.83 // Query: USB86156.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n USB86156.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ USB86156.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ USB86156.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.58 // Query: XPC21114.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XPC21114.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v XPC21114.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XPC21114.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XPC21114.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 64.45 // Query: UWD88169.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-31 94.5 3.8 3.4e-31 94.5 3.8 2.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.1 0.086 0.086 59 95 .. 150 186 .. 122 206 .. 0.71 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 94.5 3.8 3.4e-31 3.4e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.086 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ UWD88169.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667788888888888999998887755333.3244666 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y UWD88169.1|CBM32 285 Y 285 2 PP == domain 3 score: 94.5 bits; conditional E-value: 3.4e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y v++S+Dg +Wt +++++n g + UWD88169.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAVQTSNDGVNWTSIYATSNGIAyG-H 439 33..344445589********7359****65114579********************878...******************9876643323.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ UWD88169.1|CBM32 440 AVLsNLH--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..568*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.81 // Query: XTZ75213.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XTZ75213.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y XTZ75213.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XTZ75213.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XTZ75213.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.30 // Query: UZF32788.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ UZF32788.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y UZF32788.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + UZF32788.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ UZF32788.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.45 // Query: UQO19272.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 3.5 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQO19272.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQO19272.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQO19272.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.28 // Query: WGY71157.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-32 97.0 5.0 3.8e-31 94.3 2.4 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 2.2 0.0 0.012 0.012 53 87 .. 146 178 .. 136 202 .. 0.73 2 ! 94.3 2.4 3.8e-31 3.8e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: 2.2 bits; conditional E-value: 0.012 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgnttdg 87 ++ + g++k+ ++++ + g t+t v++ +n ++g WGY71157.1|CBM32 146 FK---QnGDVKQATLSYTSAGPTFTSVVSLTNAPSG 178 33...3389******************987765443 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t WGY71157.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagvgsQWISVDLGAVKHIDHVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGVSYTHVT 436 334455666.99********877*****64245789********************877...9*****************9887654455556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +t+rat +wg+s++E++ WGY71157.1|CBM32 437 LpNLN--GSGRYVRMLGTQRAT-QWGYSLYEMQ 466 66666..678*******99887.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.87 // Query: UQN54271.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 3.5 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQN54271.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQN54271.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQN54271.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.62 // Query: BEU64035.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ BEU64035.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y BEU64035.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + BEU64035.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ BEU64035.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 67.00 // Query: UQO52304.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-31 95.8 2.2 1.4e-31 95.8 2.2 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.15 0.15 54 84 .. 147 175 .. 134 195 .. 0.72 2 ? -3.0 0.1 0.52 0.52 50 69 .. 282 301 .. 273 322 .. 0.51 3 ! 95.8 2.2 1.4e-31 1.4e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.15 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n UQO52304.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 3...2388999999999999999999876654 PP == domain 2 score: -3.0 bits; conditional E-value: 0.52 CBM32.hmm 50 kvvltw.aengrikdykvevS 69 + ++ + ++ +++ y+++v UQO52304.1|CBM32 282 GTNYVFfSS-TTAGGYQLYVG 301 444443322.33445555544 PP == domain 3 score: 95.8 bits; conditional E-value: 1.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t UQO52304.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagagsQWISVDLGAVKRIDHVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGGSYTHVT 436 334555566.99********877*****64145679********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ UQO52304.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.70 // Query: WDS00116.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-31 93.7 3.9 6e-31 93.7 3.9 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.1 0.08 0.08 10 29 .. 126 143 .. 122 183 .. 0.68 2 ? -1.9 0.0 0.23 0.23 54 88 .. 147 179 .. 138 195 .. 0.69 3 ! 93.7 3.9 6e-31 6e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.08 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 ss+a+ ++++++a Dg +t WDS00116.1|CBM32 126 SSGATRNEDPKFAADG--KT 143 4444555778888888..33 PP == domain 2 score: -1.9 bits; conditional E-value: 0.23 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttdgt 88 + + g++k+ ++++ + g +t v++ +n + g+ WDS00116.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVSLTNAPAGS 179 3...23889999999999999999998876644343 PP == domain 3 score: 93.7 bits; conditional E-value: 6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ WDS00116.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ WDS00116.1|CBM32 436 TLpNLN--AQGRYVRMIGTKRAT-QWGYSLDEMQ 466 666777..568*******88877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 42.38 // Query: UQO53915.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-31 94.5 5.2 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQO53915.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQO53915.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQO53915.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.95 // Query: UQP90746.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQP90746.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQP90746.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQP90746.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.05 // Query: UQP43067.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-31 94.5 5.2 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQP43067.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQP43067.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQP43067.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.55 // Query: XDJ21146.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-32 97.4 2.3 4.3e-32 97.4 2.3 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.0 0.091 0.091 54 84 .. 147 175 .. 134 196 .. 0.73 2 ? -3.0 0.1 0.5 0.5 50 69 .. 282 301 .. 273 323 .. 0.51 3 ! 97.4 2.3 4.3e-32 4.3e-32 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.091 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n XDJ21146.1|CBM32 147 K---QnGDVKQATLSYTSAGPAFTSVVSLTNA 175 3...3389999999999999999999887654 PP == domain 2 score: -3.0 bits; conditional E-value: 0.5 CBM32.hmm 50 kvvltw.aengrikdykvevS 69 + ++ + ++ +++ y+++v XDJ21146.1|CBM32 282 GTNYVFfSS-TTAGGYQLYVG 301 444443322.33445555544 PP == domain 3 score: 97.4 bits; conditional E-value: 4.3e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t XDJ21146.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagvgsQWISVDLGAVKRIDHVDLYWdAG---ALAYQIQTSNDNANWTTIYSTSNGGSYTHVT 436 334555566.99********877*****64245789********************878...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ XDJ21146.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.03 // Query: XNX14089.1|CBM32 [L=472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-29 89.3 5.3 1.4e-29 89.3 5.3 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.1 0.26 0.26 17 29 .. 133 143 .. 123 229 .. 0.58 2 ? -1.4 0.1 0.17 0.17 50 67 .. 282 299 .. 233 339 .. 0.59 3 ! 89.3 5.3 1.4e-29 1.4e-29 6 123 .. 351 468 .. 345 469 .. 0.81 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.26 CBM32.hmm 17 ggaenavDgdpnt 29 +++++ +Dg ++ XNX14089.1|CBM32 133 EDPKFSTDG--KS 143 566666666..32 PP == domain 2 score: -1.4 bits; conditional E-value: 0.17 CBM32.hmm 50 kvvltw.aengrikdykve 67 + ++ + ++ + + y+++ XNX14089.1|CBM32 282 GTNYVFfSS-TSAGGYQLY 299 333332211.223333333 PP == domain 3 score: 89.3 bits; conditional E-value: 1.4e-29 CBM32.hmm 6 saessssaaggggaenavDgdpn.trWss.ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 sa s+s +a+ g+++a+Dg+++ trW s +g qwl vdLg+++t+++v l+w a+ +k y +++S+Dg tWt ++++++ + g ++ XNX14089.1|CBM32 351 SA-STSYSAS-LGPAYAFDGNTTsTRWDSvEGvagaQWLMVDLGSTRTITGVDLYWdAG---AKVYYIQTSNDGVTWTNIYSTSSGASwG-HT 437 33.4555666.89********8769****6224569********************878...******************9876644434.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ ++ryvR+++t+rat +wg+s+ E++ XNX14089.1|CBM32 438 SLaNLK--GSGRYVRMYGTQRAT-QWGYSLDEMQ 468 555998..568*******99887.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (472 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 62.73 // Query: UQO62406.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-31 94.5 5.2 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQO62406.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQO62406.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQO62406.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 88.04 // Query: UVE69000.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-31 96.1 4.3 2.6e-31 94.9 2.6 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.0 0.075 0.075 54 85 .. 147 176 .. 128 198 .. 0.74 2 ! 94.9 2.6 2.6e-31 2.6e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.075 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgntt 85 + + g++k+ ++++ + g +t v++ +n + UVE69000.1|CBM32 147 K---QnGDVKQATLSYTSAGPAFTSVVSLTNAP 176 3...33899999999999999999999876643 PP == domain 2 score: 94.9 bits; conditional E-value: 2.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t UVE69000.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgsQWISVDLGAVKHIDHVDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGGSYTHVT 436 334455666.99********8769****64245789********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +t+rat +wg+s++E++ UVE69000.1|CBM32 437 LpNLN--GSGRYVRMLGTQRAT-QWGYSLYEMQ 466 66666..678*******99887.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.38 // Query: UQP66211.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 3.5 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQP66211.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQP66211.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQP66211.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.67 // Query: XTZ66339.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XTZ66339.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y XTZ66339.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XTZ66339.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XTZ66339.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.46 // Query: UQO09371.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 3.5 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQO09371.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQO09371.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQO09371.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.51 // Query: XQF13187.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-32 98.9 4.8 6.5e-32 96.8 3.1 2.4 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.6 0.0 0.039 0.039 54 87 .. 147 178 .. 135 201 .. 0.73 2 ! 96.8 3.1 6.5e-32 6.5e-32 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: 0.6 bits; conditional E-value: 0.039 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttdg 87 + + g++k+ ++++ + g +t v++++n + g XQF13187.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSVTNAPAG 178 3...33899*****************999875443 PP == domain 2 score: 96.8 bits; conditional E-value: 6.5e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y+++vS+D+ +Wtt+++++n + g ++ XQF13187.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTINSIDLYWdAG---ALVYQIQVSNDNANWTTIYSTNNGVSyG-HV 435 334555566.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ XQF13187.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.09 // Query: XRX70714.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-31 93.5 3.6 7e-31 93.5 3.6 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.1 0.08 0.08 10 29 .. 126 143 .. 122 183 .. 0.68 2 ? -1.9 0.0 0.23 0.23 54 88 .. 147 179 .. 138 195 .. 0.69 3 ! 93.5 3.6 7e-31 7e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.08 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 ss+a+ ++++++a Dg +t XRX70714.1|CBM32 126 SSGATRNEDPKFAADG--KT 143 4444555778888888..33 PP == domain 2 score: -1.9 bits; conditional E-value: 0.23 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttdgt 88 + + g++k+ ++++ + g +t v++ +n + g+ XRX70714.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVSLTNAPAGS 179 3...23889999999999999999998876644343 PP == domain 3 score: 93.5 bits; conditional E-value: 7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ XRX70714.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ XRX70714.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 42.63 // Query: WAS57420.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-31 93.2 4.1 8.6e-31 93.2 4.1 2.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.0 0.2 0.031 0.031 9 29 .. 125 143 .. 121 160 .. 0.76 2 ? -2.2 0.0 0.28 0.28 57 88 .. 149 179 .. 142 195 .. 0.69 3 ! 93.2 4.1 8.6e-31 8.6e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: 1.0 bits; conditional E-value: 0.031 CBM32.hmm 9 ssssaaggggaenavDgdpnt 29 +ss+a+ ++++++a+Dg +t WAS57420.1|CBM32 125 NSSGATRNEDPKFATDG--KT 143 3555666699*******..44 PP == domain 2 score: -2.2 bits; conditional E-value: 0.28 CBM32.hmm 57 engrikdykvevStDgktWttvaekgnttdgt 88 + g++k+ ++++ + g +t v++ +n + g+ WAS57420.1|CBM32 149 N-GDVKQGTLSYTSAGPVFTSVVSLTNAPAGS 179 3.889999999999999999998876644343 PP == domain 3 score: 93.2 bits; conditional E-value: 8.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++StD+ +Wttv++++n + g ++ WAS57420.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSTDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ WAS57420.1|CBM32 436 TLpNLN--AQGRYVRMIGTKRAT-QWGYSLDEMQ 466 666777..568*******88877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 43.53 // Query: UZU07926.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-31 93.5 3.6 7e-31 93.5 3.6 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.1 0.08 0.08 10 29 .. 126 143 .. 122 183 .. 0.68 2 ? -1.9 0.0 0.23 0.23 54 88 .. 147 179 .. 138 195 .. 0.69 3 ! 93.5 3.6 7e-31 7e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.08 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 ss+a+ ++++++a Dg +t UZU07926.1|CBM32 126 SSGATRNEDPKFAADG--KT 143 4444555778888888..33 PP == domain 2 score: -1.9 bits; conditional E-value: 0.23 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttdgt 88 + + g++k+ ++++ + g +t v++ +n + g+ UZU07926.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVSLTNAPAGS 179 3...23889999999999999999998876644343 PP == domain 3 score: 93.5 bits; conditional E-value: 7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ UZU07926.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ UZU07926.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 41.37 // Query: UXZ70798.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 3.5 2.5e-31 94.9 3.5 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 94.9 3.5 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + UXZ70798.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ UXZ70798.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ UXZ70798.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.22 // Query: XII29541.1|CBM32 [L=474] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-30 92.8 6.1 1.1e-30 92.8 6.1 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.0 0.38 0.38 107 107 .. 290 290 .. 241 324 .. 0.55 2 ! 92.8 6.1 1.1e-30 1.1e-30 6 123 .. 352 470 .. 346 471 .. 0.81 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.38 CBM32.hmm 107 v 107 XII29541.1|CBM32 290 S 290 2 PP == domain 2 score: 92.8 bits; conditional E-value: 1.1e-30 CBM32.hmm 6 saessssaaggggaenavDgdpn.trWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtt 89 sa sss +a+ g+++a+Dg+++ trW s ++ qwl vdLg+++t+++v l+w a+ +k y++++S+Dg +Wt +++++n + g + XII29541.1|CBM32 352 SA-SSSYSAS-LGPAYAFDGNTTnTRWDSieGSaagtQWLMVDLGTTRTITGVDLYWdAG---AKVYSIQTSNDGVNWTNLYSTSNGASwG-H 438 33.3555556.99********7549****65114579********************878...******************9887765544.4 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ +++ ++ryvR+++t+rat +wg+s++E++ XII29541.1|CBM32 439 TSLaNLK--GSGRYVRMYGTQRAT-QWGYSVNEMQ 470 6555998..568*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (474 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.00 // Query: XRW81272.1|CBM32 [L=476] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-29 88.4 5.2 2.7e-29 88.4 5.2 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.1 0.36 0.36 59 78 .. 153 172 .. 127 201 .. 0.55 2 ? -2.1 0.1 0.28 0.28 48 69 .. 283 304 .. 244 330 .. 0.59 3 ! 88.4 5.2 2.7e-29 2.7e-29 6 123 .. 355 472 .. 349 473 .. 0.81 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.36 CBM32.hmm 59 grikdykvevStDgktWttv 78 g++ + ++++ + g +t v XRW81272.1|CBM32 153 GDVMQATLSYTSSGPVFTSV 172 44444445555555555544 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 48 vdkvvltw.aengrikdykvevS 69 v++ ++ + ++ + + y+++v XRW81272.1|CBM32 283 VNNTNYVFfSS-TSAGGYQLYVG 304 33333333321.23334444433 PP == domain 3 score: 88.4 bits; conditional E-value: 2.7e-29 CBM32.hmm 6 saessssaaggggaenavDgdpn.trWss.ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 sa sss +a+ g+++a+Dg+++ trW s +g qwl vdLg+++t+++v l+w a+ +k y++++S+D +Wt +++++n + g ++ XRW81272.1|CBM32 355 SA-SSSYSAS-LGPAYAFDGNTTdTRWDSvEGvagtQWLMVDLGSTRTITGVDLYWdAG---AKVYSIQTSNDAVNWTNIYSTSNGASwG-HV 441 33.3555556.99********866*****6224568********************878...******************9887755444.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ ++ryvR+++t+rat +wg+s+ E++ XRW81272.1|CBM32 442 SLaNLK--GSGRYVRMYGTQRAT-QWGYSLDEMQ 472 555888..568*******99887.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (476 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.39 // Query: XKO89980.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XKO89980.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v XKO89980.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XKO89980.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XKO89980.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.14 // Query: XNL43872.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-30 92.5 2.9 1.4e-30 92.5 2.9 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.075 0.075 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 92.5 2.9 1.4e-30 1.4e-30 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.075 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + XNL43872.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887765543 PP == domain 2 score: 92.5 bits; conditional E-value: 1.4e-30 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ +a++a+Dg+++ trW s g qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ XNL43872.1|CBM32 348 AASASYNAS-LTADKAFDGNTTsTRWDSPeGtgvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTNNGVSyG-HV 435 334455566.99********8769****64246889********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+ +tkrat wg+s+ E++ XNL43872.1|CBM32 436 TLpNLN--GHGRYVRMLGTKRAT-PWGYSLDEMQ 466 666777..458*******88876.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 89.33 // Query: UQO03408.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n UQO03408.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ UQO03408.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ UQO03408.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.28 // Query: XTZ79187.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XTZ79187.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y XTZ79187.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XTZ79187.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XTZ79187.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.61 // Query: XRW87019.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-31 93.5 3.6 7e-31 93.5 3.6 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.1 0.08 0.08 10 29 .. 126 143 .. 122 183 .. 0.68 2 ? -1.9 0.0 0.23 0.23 54 88 .. 147 179 .. 138 195 .. 0.69 3 ! 93.5 3.6 7e-31 7e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.08 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 ss+a+ ++++++a Dg +t XRW87019.1|CBM32 126 SSGATRNEDPKFAADG--KT 143 4444555778888888..33 PP == domain 2 score: -1.9 bits; conditional E-value: 0.23 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttdgt 88 + + g++k+ ++++ + g +t v++ +n + g+ XRW87019.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVSLTNAPAGS 179 3...23889999999999999999998876644343 PP == domain 3 score: 93.5 bits; conditional E-value: 7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ XRW87019.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ XRW87019.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 45.12 // Query: XKO84181.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XKO84181.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v XKO84181.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XKO84181.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XKO84181.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.77 // Query: UXZ84430.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-31 94.5 5.2 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UXZ84430.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UXZ84430.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UXZ84430.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.02 // Query: XOD37212.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XOD37212.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v XOD37212.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XOD37212.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XOD37212.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.86 // Query: UQP06451.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-31 95.8 2.2 1.4e-31 95.8 2.2 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.15 0.15 54 84 .. 147 175 .. 134 195 .. 0.72 2 ? -3.0 0.1 0.52 0.52 50 69 .. 282 301 .. 273 322 .. 0.51 3 ! 95.8 2.2 1.4e-31 1.4e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.15 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n UQP06451.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 3...2388999999999999999999876654 PP == domain 2 score: -3.0 bits; conditional E-value: 0.52 CBM32.hmm 50 kvvltw.aengrikdykvevS 69 + ++ + ++ +++ y+++v UQP06451.1|CBM32 282 GTNYVFfSS-TTAGGYQLYVG 301 444443322.33445555544 PP == domain 3 score: 95.8 bits; conditional E-value: 1.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t UQP06451.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagagsQWISVDLGAVKRIDHVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGGSYTHVT 436 334555566.99********877*****64145679********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ UQP06451.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 86.51 // Query: XCF03744.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.13 0.13 59 95 .. 150 186 .. 122 201 .. 0.69 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XCF03744.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v XCF03744.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XCF03744.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XCF03744.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.29 // Query: UEP50895.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-31 93.7 3.9 6e-31 93.7 3.9 2.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.1 0.1 0.056 0.056 10 29 .. 126 143 .. 122 159 .. 0.74 2 ? -1.1 0.0 0.13 0.13 53 88 .. 146 179 .. 134 196 .. 0.67 3 ! 93.7 3.9 6e-31 6e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: 0.1 bits; conditional E-value: 0.056 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 s++a+ ++++++a+Dg +t UEP50895.1|CBM32 126 STGATRNEDPKFATDG--KT 143 344455599*******..44 PP == domain 2 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgnttdgt 88 ++ + g++k+ ++++ + g +t v++ +n ++g+ UEP50895.1|CBM32 146 FK---QnGDVKQGTLSYTSAGPVFTSVVSLTNAPSGS 179 33...23788999999999999999998876654444 PP == domain 3 score: 93.7 bits; conditional E-value: 6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ UEP50895.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ UEP50895.1|CBM32 436 TLpNLN--AQGRYVRMIGTKRAT-QWGYSLDEMQ 466 666777..568*******88877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 43.13 // Query: XHO07480.1|CBM32 [L=488] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-30 92.7 3.9 1.2e-30 92.7 3.9 2.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.8 0.0 0.11 0.11 59 95 .. 150 186 .. 124 203 .. 0.70 2 ? -2.6 0.0 0.38 0.38 22 32 .. 300 310 .. 269 330 .. 0.52 3 ! 92.7 3.9 1.2e-30 1.2e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -0.8 bits; conditional E-value: 0.11 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt + e + +f+ XHO07480.1|CBM32 150 GDVMQATLSYTSTGPVFTSVVDITNTA-PAIEsSMPFA 186 777888888888999999998887654.3222133555 PP == domain 2 score: -2.6 bits; conditional E-value: 0.38 CBM32.hmm 22 avDgdpntrWs 32 + D +++ rWs XHO07480.1|CBM32 300 LGDASTGQRWS 310 22222222333 PP == domain 3 score: 92.7 bits; conditional E-value: 1.2e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XHO07480.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XHO07480.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (488 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.83 // Query: UZF38380.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ UZF38380.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y UZF38380.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + UZF38380.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ UZF38380.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.82 // Query: UQP32008.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 3.5 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQP32008.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQP32008.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQP32008.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.23 // Query: XNL04051.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XNL04051.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y XNL04051.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XNL04051.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XNL04051.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.07 // Query: XLV70460.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-30 92.8 3.9 1.1e-30 92.8 3.9 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 199 .. 0.66 2 ? -1.9 0.1 0.24 0.24 38 38 .. 296 296 .. 240 330 .. 0.57 3 ! 92.8 3.9 1.1e-30 1.1e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt XLV70460.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 38 l 38 + XLV70460.1|CBM32 296 Y 296 1 PP == domain 3 score: 92.8 bits; conditional E-value: 1.1e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XLV70460.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XLV70460.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.88 // Query: XJV82605.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 2.6 2.5e-31 94.9 2.6 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.15 0.15 54 81 .. 147 172 .. 123 195 .. 0.60 2 ! 94.9 2.6 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.15 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaek 81 + + g++k+ ++++ + g +t v++ XJV82605.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVSL 172 2...2255666666666666666666554 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++++++v l+w a+ + y++++S+D+ +Wttv++++n g ++ XJV82605.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGAVKKISSVDLYWdAG---ALVYQIQTSNDNANWTTVYATSNGAAyG-HV 435 334555566.99********8769****73356789********************877...9*****************9877754423.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ XJV82605.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 87.81 // Query: UQP52216.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n UQP52216.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ UQP52216.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ UQP52216.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.44 // Query: XRQ22743.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XRQ22743.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y XRQ22743.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XRQ22743.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XRQ22743.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.56 // Query: UYR09878.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ UYR09878.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y UYR09878.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + UYR09878.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ UYR09878.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.54 // Query: UXZ64343.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-31 96.0 5.2 1.2e-31 96.0 3.6 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 96.0 3.6 1.2e-31 1.2e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UXZ64343.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 96.0 bits; conditional E-value: 1.2e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UXZ64343.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALAYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************878...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UXZ64343.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.54 // Query: UQP03766.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-31 94.5 5.2 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQP03766.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQP03766.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQP03766.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.04 // Query: UQN95625.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 96.2 3.7 2.4e-31 95.0 2.8 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.2 0.2 54 84 .. 147 175 .. 131 195 .. 0.70 2 ! 95.0 2.8 2.4e-31 2.4e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t +++ +n UQN95625.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSIVSLTNA 175 2...2378899999999888888888876654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ UQN95625.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.56 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ UQN95625.1|CBM32 435 TLpNLN--GQGRYVRMLGTKRAT-QWGYSLDEMQ 465 777777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 80.69 // Query: XKP09263.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XKP09263.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v XKP09263.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XKP09263.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XKP09263.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.94 // Query: UNJ32022.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ UNJ32022.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y UNJ32022.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + UNJ32022.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ UNJ32022.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.16 // Query: UEP43805.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-31 93.5 3.6 7e-31 93.5 3.6 2.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.6 0.2 0.039 0.039 10 29 .. 126 143 .. 121 183 .. 0.73 2 ? -3.2 0.0 0.58 0.58 59 75 .. 291 309 .. 276 323 .. 0.51 3 ! 93.5 3.6 7e-31 7e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: 0.6 bits; conditional E-value: 0.039 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 s++a+ ++++++a+Dg +t UEP43805.1|CBM32 126 STGATRNEDPKFATDG--KT 143 3344455889999999..44 PP == domain 2 score: -3.2 bits; conditional E-value: 0.58 CBM32.hmm 59 grikdykvevSt..DgktW 75 +++ y+++v + g+ W UEP43805.1|CBM32 291 TTAGGYQIYVGDvtTGQRW 309 3344555555421123334 PP == domain 3 score: 93.5 bits; conditional E-value: 7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ UEP43805.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ UEP43805.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 45.08 // Query: UQO22394.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 3.5 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQO22394.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQO22394.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQO22394.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.19 // Query: UOB57239.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-31 96.1 4.0 2.4e-31 95.0 2.7 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.0 0.14 0.14 54 82 .. 147 173 .. 126 195 .. 0.73 2 ! 95.0 2.7 2.4e-31 2.4e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekg 82 + + g++k+ ++++ + g +t v++ + UOB57239.1|CBM32 147 K---QnGDVKQATLSYTSAGPAFTSVVSLT 173 2...23888999999999999999887654 PP == domain 2 score: 95.0 bits; conditional E-value: 2.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UOB57239.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGATKHIDHVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGGSYSHVT 436 334455666.99********8769****64246889********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ UOB57239.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66776..578*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.87 // Query: WFN21442.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 3.5 2.5e-31 94.9 3.5 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 94.9 3.5 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + WFN21442.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ WFN21442.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ WFN21442.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.01 // Query: XPS65018.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-32 97.4 4.1 7.3e-32 96.7 2.4 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.16 0.16 54 84 .. 147 175 .. 137 195 .. 0.71 2 ! 96.7 2.4 7.3e-32 7.3e-32 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.16 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n XPS65018.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 3...2388999999999999999999876654 PP == domain 2 score: 96.7 bits; conditional E-value: 7.3e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ +++++a+Dg+++ trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t XPS65018.1|CBM32 348 AASASYSAS-FTPDKAFDGNTTgTRWDSPeGagvgsQWISVDLGAVKHIDHVDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGGSYTHVT 436 344556677.**********877*****64245789********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +t+rat +wg+s++E++ XPS65018.1|CBM32 437 LpNLN--GSGRYVRMLGTQRAT-QWGYSLYEMQ 466 66666..678*******99887.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.38 // Query: WVM99950.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W WVM99950.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t WVM99950.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + WVM99950.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 89.34 // Query: XQL31137.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-31 94.9 3.5 2.5e-31 94.9 3.5 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 94.9 3.5 2.5e-31 2.5e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + XQL31137.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 94.9 bits; conditional E-value: 2.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n + g ++ XQL31137.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ XQL31137.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.24 // Query: BEU69089.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ BEU69089.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y BEU69089.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + BEU69089.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ BEU69089.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.09 // Query: UQN80801.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 3.5 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQN80801.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQN80801.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQN80801.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 87.86 // Query: XKP04830.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XKP04830.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v XKP04830.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XKP04830.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XKP04830.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 65.18 // Query: UQO68819.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 3.5 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQO68819.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQO68819.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQO68819.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 89.76 // Query: XKP19827.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XKP19827.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v XKP19827.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XKP19827.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XKP19827.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 65.71 // Query: UYR04154.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.9 3.5 5.3e-31 93.9 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.28 0.28 102 102 .. 285 285 .. 233 326 .. 0.56 3 ! 93.9 3.5 5.3e-31 5.3e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ UYR04154.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 102 y 102 y UYR04154.1|CBM32 285 Y 285 2 PP == domain 3 score: 93.9 bits; conditional E-value: 5.3e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss+ +++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + UYR04154.1|CBM32 353 SA-SSSD-NSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33.3444.44599********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ UYR04154.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.28 // Query: WGS44382.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-31 94.6 5.4 4.6e-31 94.1 3.2 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.0 0.097 0.097 58 84 .. 148 175 .. 91 198 .. 0.76 2 ! 94.1 3.2 4.6e-31 4.6e-31 7 123 .. 348 466 .. 343 467 .. 0.83 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.097 CBM32.hmm 58 n.grikdykvevStDgktWttvaekgnt 84 + g++k+ ++++ + g +t v++ +n WGS44382.1|CBM32 148 QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 2378888888888888888888876654 PP == domain 2 score: 94.1 bits; conditional E-value: 4.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++StD+ +Wtt+++++n g ++ WGS44382.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINGVDLYWdAG---ALVYQIQTSTDNVNWTTIYSTNNGVAyG-HV 435 334455666.99********8769****64246889********************877...9*****************9887644323.67 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 i +++ +ryvR+++tkrat +wg+s+ E++ WGS44382.1|CBM32 436 AIpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 888998..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.86 // Query: XKS32400.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-30 92.8 3.9 1.1e-30 92.8 3.9 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 199 .. 0.66 2 ? -1.9 0.1 0.24 0.24 38 38 .. 296 296 .. 240 330 .. 0.57 3 ! 92.8 3.9 1.1e-30 1.1e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt XKS32400.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 38 l 38 + XKS32400.1|CBM32 296 Y 296 1 PP == domain 3 score: 92.8 bits; conditional E-value: 1.1e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XKS32400.1|CBM32 353 SA--SSSYNSSLGADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XKS32400.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.71 // Query: WZW57275.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-31 95.9 4.0 2e-31 95.3 2.2 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.0 0.14 0.14 54 84 .. 147 175 .. 126 195 .. 0.74 2 ! 95.3 2.2 2e-31 2e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n WZW57275.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 2...2388999999999999999988876654 PP == domain 2 score: 95.3 bits; conditional E-value: 2e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++ +d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t WZW57275.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagvgtQWISVDLGAVKHIDHVDLYWdAG---ALVYRIQTSNDNANWTTIYSTSNGGSYTHVT 436 334455666.99********877*****64245789********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ WZW57275.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 89.10 // Query: UGS88221.1|CBM32 [L=472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-30 91.0 5.8 4e-30 91.0 5.8 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.1 0.26 0.26 17 29 .. 133 143 .. 123 229 .. 0.58 2 ? -1.3 0.1 0.16 0.16 49 75 .. 281 309 .. 233 342 .. 0.59 3 ! 91.0 5.8 4e-30 4e-30 7 123 .. 351 468 .. 345 469 .. 0.82 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.26 CBM32.hmm 17 ggaenavDgdpnt 29 +++++ +Dg ++ UGS88221.1|CBM32 133 EDPKFSTDG--KS 143 566666666..32 PP == domain 2 score: -1.3 bits; conditional E-value: 0.16 CBM32.hmm 49 dkvvltw.aengrikdykvevSt..DgktW 75 ++ ++ + ++ + + y+++ + +g+ W UGS88221.1|CBM32 281 NGTNYVFfSS-TSAGGYQLYLGDasNGQRW 309 3333333221.2233333332211134444 PP == domain 3 score: 91.0 bits; conditional E-value: 4e-30 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWss.ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gttet 91 ++s+s +a+ +g+++a+Dg+++ trW s +g qwl vdLg+++t+++v l+w a+ +k y +++S+Dg tWt ++++++ + g +++ UGS88221.1|CBM32 351 SASTSYSAS-FGPAYAFDGNTTnTRWDSvEGvagaQWLMVDLGSTRTITGVDLYWdAG---AKVYYIQTSNDGVTWTNIYSTSSGASwG-HTS 438 334666677.**********7549****6224569********************878...******************9876644434.465 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+++t+rat +wg+s+ E++ UGS88221.1|CBM32 439 LaNLK--GSGRYVRMYGTQRAT-QWGYSLDEMQ 468 55998..568*******99887.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (472 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 65.41 // Query: UQO37966.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-31 95.8 2.2 1.4e-31 95.8 2.2 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.15 0.15 54 84 .. 147 175 .. 134 195 .. 0.72 2 ? -3.0 0.1 0.52 0.52 50 69 .. 282 301 .. 273 322 .. 0.51 3 ! 95.8 2.2 1.4e-31 1.4e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.15 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n UQO37966.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNA 175 3...2388999999999999999999876654 PP == domain 2 score: -3.0 bits; conditional E-value: 0.52 CBM32.hmm 50 kvvltw.aengrikdykvevS 69 + ++ + ++ +++ y+++v UQO37966.1|CBM32 282 GTNYVFfSS-TTAGGYQLYVG 301 444443322.33445555544 PP == domain 3 score: 95.8 bits; conditional E-value: 1.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t UQO37966.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagagsQWISVDLGAVKRIDHVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTSNGGSYTHVT 436 334555566.99********877*****64145679********************877...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ UQO37966.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.33 // Query: UQN72036.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-31 94.5 5.2 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQN72036.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQN72036.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQN72036.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.68 // Query: UZU01375.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-31 93.5 3.6 7e-31 93.5 3.6 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.1 0.08 0.08 10 29 .. 126 143 .. 122 183 .. 0.68 2 ? -1.9 0.0 0.23 0.23 54 88 .. 147 179 .. 138 195 .. 0.69 3 ! 93.5 3.6 7e-31 7e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.08 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 ss+a+ ++++++a Dg +t UZU01375.1|CBM32 126 SSGATRNEDPKFAADG--KT 143 4444555778888888..33 PP == domain 2 score: -1.9 bits; conditional E-value: 0.23 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttdgt 88 + + g++k+ ++++ + g +t v++ +n + g+ UZU01375.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVSLTNAPAGS 179 3...23889999999999999999998876644343 PP == domain 3 score: 93.5 bits; conditional E-value: 7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ UZU01375.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ UZU01375.1|CBM32 436 TLpNLN--AQGRYVRMLGTKRAT-QWGYSLDEMQ 466 666777..568*******98877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 40.67 // Query: UQO97257.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-31 94.5 5.2 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQO97257.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQO97257.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQO97257.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.72 // Query: UQN86157.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 5.1 3.8e-31 94.3 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.3 3.5 3.8e-31 3.8e-31 7 122 .. 349 466 .. 344 468 .. 0.81 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQN86157.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.3 bits; conditional E-value: 3.8e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQN86157.1|CBM32 349 AASASYNAQ-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 334455555.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQN86157.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.67 // Query: UQO82368.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 3.5 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQO82368.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQO82368.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQO82368.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.82 // Query: WDR87416.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-31 93.7 3.9 6e-31 93.7 3.9 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.1 0.08 0.08 10 29 .. 126 143 .. 122 183 .. 0.68 2 ? -1.9 0.0 0.23 0.23 54 88 .. 147 179 .. 138 195 .. 0.69 3 ! 93.7 3.9 6e-31 6e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.08 CBM32.hmm 10 sssaaggggaenavDgdpnt 29 ss+a+ ++++++a Dg +t WDR87416.1|CBM32 126 SSGATRNEDPKFAADG--KT 143 4444555778888888..33 PP == domain 2 score: -1.9 bits; conditional E-value: 0.23 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnttdgt 88 + + g++k+ ++++ + g +t v++ +n + g+ WDR87416.1|CBM32 147 K---QnGDVKQGTLSYTSAGPVFTSVVSLTNAPAGS 179 3...23889999999999999999998876644343 PP == domain 3 score: 93.7 bits; conditional E-value: 6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s g +w+ vdLg++++v++v l+w a+ + y++++S+D+ +Wttv++++n + g ++ WDR87416.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPeGagvgtEWISVDLGAVKKVSSVDLYWdAG---ALVYQIQTSNDNANWTTVYSTNNGVSyG-HV 435 334455666.99********8769****642457899*******************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +++ryvR+ +tkrat +wg+s+ E++ WDR87416.1|CBM32 436 TLpNLN--AQGRYVRMIGTKRAT-QWGYSLDEMQ 466 666777..568*******88877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 41.66 // Query: BEU73864.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-30 92.0 4.3 2e-30 92.0 4.3 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.0 0.22 0.22 59 85 .. 150 176 .. 124 198 .. 0.66 2 ? -1.6 0.1 0.2 0.2 22 32 .. 300 310 .. 240 336 .. 0.60 3 ! 92.0 4.3 2e-30 2e-30 6 123 .. 353 471 .. 347 472 .. 0.80 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 59 grikdykvevStDgktWttvaekgntt 85 g++ + ++++ + g +t v++ +nt BEU73864.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTA 176 666777788888888888888776643 PP == domain 2 score: -1.6 bits; conditional E-value: 0.2 CBM32.hmm 22 avDgdpntrWs 32 + D +++ rWs BEU73864.1|CBM32 300 LGDASTGQRWS 310 22222222333 PP == domain 3 score: 92.0 bits; conditional E-value: 2e-30 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ +a++a+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + BEU73864.1|CBM32 353 SA--SSSYNSSLSADKAFDGDTvNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTNIYTTSNGIA-YgH 439 33..344445589********758*****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ BEU73864.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 65.75 // Query: UQO45050.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-31 94.5 5.2 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQO45050.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQO45050.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQO45050.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.91 // Query: XKP14867.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -2.1 0.1 0.27 0.27 103 103 .. 286 286 .. 233 328 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XKP14867.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -2.1 bits; conditional E-value: 0.27 CBM32.hmm 103 v 103 v XKP14867.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XKP14867.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XKP14867.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 65.20 // Query: XKO94967.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 59 95 .. 150 186 .. 124 199 .. 0.69 2 ? -1.7 0.1 0.2 0.2 105 105 .. 288 288 .. 233 329 .. 0.55 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ XKO94967.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667778888888888889898877654333.2133555 PP == domain 2 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 105 l 105 + XKO94967.1|CBM32 288 F 288 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + XKO94967.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ XKO94967.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 63.86 // Query: BEU48398.1|CBM32 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-31 93.7 3.5 5.9e-31 93.7 3.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.1 0.14 0.14 59 95 .. 150 186 .. 122 199 .. 0.68 2 ? -2.2 0.1 0.29 0.29 103 103 .. 286 286 .. 234 326 .. 0.56 3 ! 93.7 3.5 5.9e-31 5.9e-31 6 123 .. 353 471 .. 348 472 .. 0.79 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 59 grikdykvevStDgktWttvaekgnttdgtte.titfd 95 g++ + ++++ + g +t v++ +nt t e + +f+ BEU48398.1|CBM32 150 GDVMQATLSYTSTGPIFTSVVDITNTAPAT-EnSMPFA 186 667777888888888888888877654333.2133554 PP == domain 2 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 103 v 103 v BEU48398.1|CBM32 286 V 286 2 PP == domain 3 score: 93.7 bits; conditional E-value: 5.9e-31 CBM32.hmm 6 saessssaaggggaenavDgdp.ntrWss..ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt.t 89 sa sss++++ ga+na+Dgd+ ntrW s ++ qwl vdLg+++t+++v l+w a+ +k+y +++S+Dg +Wt +++++n + BEU48398.1|CBM32 353 SA--SSSYNSSLGAANAFDGDTaNTRWDSieGSaagtQWLMVDLGTVRTINGVDLYWdAG---AKTYAIQTSSDGVNWTSIYSTSNGIA-YgH 439 33..344445589********7359****65114579********************878...******************98776443.234 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+++t+rat +wg+si E++ BEU48398.1|CBM32 440 AVLsNLR--GSGRYVRMYGTQRAT-QWGYSIDEMQ 471 4444887..468*******99887.8*******86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.78 // Query: UUX41237.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-31 95.1 3.3 2.2e-31 95.1 3.3 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.1 0.074 0.074 53 85 .. 146 176 .. 124 198 .. 0.68 2 ! 95.1 3.3 2.2e-31 2.2e-31 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgntt 85 ++ + g++k+ ++++ + g +t v++ +n + UUX41237.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 23...23778888888888888888887766543 PP == domain 2 score: 95.1 bits; conditional E-value: 2.2e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ UUX41237.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKTISSIDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887654433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ +ryvR+++tkrat +wg+s+ E++ UUX41237.1|CBM32 436 TLpNLN--GHGRYVRMYGTKRAT-QWGYSLDEMQ 466 666777..458*******99877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 91.44 // Query: XKT13092.1|CBM32 [L=469] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-31 94.1 4.6 7.5e-31 93.4 2.5 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.09 0.09 53 83 .. 146 174 .. 123 196 .. 0.67 2 ! 93.4 2.5 7.5e-31 7.5e-31 7 123 .. 347 465 .. 342 466 .. 0.82 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.09 CBM32.hmm 53 ltwaen.grikdykvevStDgktWttvaekgn 83 ++ + g++k+ ++++ + g +t v++ +n XKT13092.1|CBM32 146 FK---QnGDVKQATLSYTSAGPVFTSVVSLTN 174 22...237777778887777777777776554 PP == domain 2 score: 93.4 bits; conditional E-value: 7.5e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++ ++++ l+w a+ + y++++S+D+ +Wtt+++++n + g ++ XKT13092.1|CBM32 347 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGATKAISSIDLYWdAG---ALVYQIQTSNDNANWTTIYSTSNGVSyG-HV 434 334455666.99********8769****73356789********************877...9*****************9887755433.46 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ryvR+ +tkrat +wg+s+ E++ XKT13092.1|CBM32 435 TLpNLK--GQGRYVRMIGTKRAT-QWGYSLDEMQ 465 666777..458*******88877.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (469 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 82.64 // Query: UQN77770.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-31 94.5 5.2 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQN77770.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQN77770.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQN77770.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.90 // Query: UQN57581.1|CBM32 [L=471] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-31 94.4 3.5 3.6e-31 94.4 3.5 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.72 0.72 48 75 .. 281 310 .. 277 320 .. 0.58 2 ! 94.4 3.5 3.6e-31 3.6e-31 7 122 .. 349 466 .. 344 468 .. 0.82 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 48 vdkvvltw.aengrikdykvevSt..DgktW 75 v++ ++ + ++ +++ y+++v + gk W UQN57581.1|CBM32 281 VNGTNYLFfSS-TTAGGYQLYVGDvtTGKRW 310 55555555433.4566666666632235555 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++t+++v l+w a+ + y++++S+D+ +Wtt+++++n +++++t UQN57581.1|CBM32 349 AASASYNAS-MTPDKAFDGNTTsTRWDSPeGtgvdpQWISVDLGAVKTINSVDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVSYQHVT 437 344556677.9*********8769****64246889********************877...9*****************9886643343456 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 +++ ++ryvR+ +tkrat +wg+s++ + UQN57581.1|CBM32 438 LpNLN--GRGRYVRMLGTKRAT-QWGYSLYQM 466 65666..679*******99877.8****9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (471 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.80 // Query: WKZ87603.1|CBM32 [L=472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-30 90.2 4.8 7.4e-30 90.2 4.8 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.1 0.0 0.54 0.54 13 28 .. 129 142 .. 123 176 .. 0.63 2 ? -2.6 0.0 0.39 0.39 39 51 .. 297 309 .. 269 329 .. 0.51 3 ! 90.2 4.8 7.4e-30 7.4e-30 6 123 .. 351 468 .. 345 469 .. 0.81 Alignments for each domain: == domain 1 score: -3.1 bits; conditional E-value: 0.54 CBM32.hmm 13 aaggggaenavDgdpn 28 ++ ++++++ +Dg + WKZ87603.1|CBM32 129 QTRNEDPKFSTDG--K 142 3344778888888..3 PP == domain 2 score: -2.6 bits; conditional E-value: 0.39 CBM32.hmm 39 tvdLgkpttvdkv 51 ++ Lg + t +++ WKZ87603.1|CBM32 297 QLYLGDASTGQRW 309 2222222222222 PP == domain 3 score: 90.2 bits; conditional E-value: 7.4e-30 CBM32.hmm 6 saessssaaggggaenavDgdpn.trWss.ag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 sa sss +a+ g+++a+Dg+++ trW s +g qwl vdLg+++t+++v l+w a+ +k y++++S+Dg +Wt ++++++ + g ++ WKZ87603.1|CBM32 351 SA-SSSYSAS-LGPAYAFDGNTTsTRWDSvEGvagaQWLMVDLGATRTITGVDLYWdAG---AKVYSIQTSNDGVSWTSIYSTSSGASwG-HT 437 33.3555556.99********8769****6224569********************878...******************9876644434.45 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ ++ryvR+++t+rat +wg+s+ E++ WKZ87603.1|CBM32 438 SLtNLK--GSGRYVRMYGTQRAT-QWGYSLDEMQ 468 444888..568*******99887.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (472 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.47 // Query: XUT45817.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-31 95.3 3.6 3.6e-31 94.4 1.8 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.9 0.0 0.12 0.12 54 85 .. 147 176 .. 125 196 .. 0.72 2 ! 94.4 1.8 3.6e-31 3.6e-31 7 123 .. 348 466 .. 343 467 .. 0.83 Alignments for each domain: == domain 1 score: -0.9 bits; conditional E-value: 0.12 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgntt 85 + + g++k+ ++++ + g +t v++ +n + XUT45817.1|CBM32 147 K---QnGDVKQATLSYTSAGPVFTSVVSLTNAP 176 3...23889999999999999999998766543 PP == domain 2 score: 94.4 bits; conditional E-value: 3.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssag......qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 a+s+s +a+ ++++a+Dg+++ trW s + qw+ vdLg+++t++++ l+w a+ + y++++S+D+ +Wtt+++++n g ++ XUT45817.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTsTRWDSPEgagvdpQWISVDLGAVKTINGIDLYWdAG---ALVYQIQTSNDNVNWTTIYSTNNGVAyG-HV 435 334455666.99********8769****73356789********************877...9*****************9887644323.67 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 i +++ +ryvR+++tkrat wg+s+ E++ XUT45817.1|CBM32 436 AIpNLN--GHGRYVRMYGTKRAT-PWGYSLDEMQ 466 888998..458*******88876.8******986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.61 // Query: UIY59324.1|CBM32 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-32 96.6 2.5 7.9e-32 96.6 2.5 2.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.0 0.091 0.091 54 84 .. 147 175 .. 134 196 .. 0.73 2 ? -3.0 0.1 0.5 0.5 50 69 .. 282 301 .. 273 323 .. 0.51 3 ! 96.6 2.5 7.9e-32 7.9e-32 7 123 .. 348 466 .. 343 467 .. 0.82 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.091 CBM32.hmm 54 twaen.grikdykvevStDgktWttvaekgnt 84 + + g++k+ ++++ + g +t v++ +n UIY59324.1|CBM32 147 K---QnGDVKQATLSYTSAGPAFTSVVSLTNA 175 3...3389999999999999999999887654 PP == domain 2 score: -3.0 bits; conditional E-value: 0.5 CBM32.hmm 50 kvvltw.aengrikdykvevS 69 + ++ + ++ +++ y+++v UIY59324.1|CBM32 282 GTNYVFfSS-TTAGGYQLYVG 301 444443322.33445555544 PP == domain 3 score: 96.6 bits; conditional E-value: 7.9e-32 CBM32.hmm 7 aessssaaggggaenavDgdpn.trWssa.g.....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttet 91 a+s+s +a+ ++++a+Dg+++ trW s g qw+ vdLg+++++d+v l+w a+ + y++++S+D+ +Wtt+++++n ++t++t UIY59324.1|CBM32 348 AASASYNAS-LTPDKAFDGNTTgTRWDSPeGagvgsQWVSVDLGAVKRIDHVDLYWdAG---ALAYQIQTSNDNANWTTIYSTSNGGSYTHVT 436 334555566.99********877*****64245789********************878...9*****************9877643344556 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+ +tkrat +wg+s++E++ UIY59324.1|CBM32 437 LpNLN--GSGRYVRMLGTKRAT-QWGYSLYEMQ 466 66666..678*******98877.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.35 // [ok]