# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM32/fasta_for_each_cluster/cluster_350.txt # target HMM database: merged_hmms/CBM32.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM32/CBM32_cluster_350.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: XMG34086.1|CBM32|GH92 [L=1256] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-36 109.9 9.7 1.1e-25 76.7 1.6 3.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 76.7 1.6 1.1e-25 1.1e-25 6 122 .. 76 198 .. 71 200 .. 0.79 2 ! 36.5 1.4 3.2e-13 3.2e-13 15 108 .. 1143 1240 .. 1135 1250 .. 0.74 Alignments for each domain: == domain 1 score: 76.7 bits; conditional E-value: 1.1e-25 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt 88 +a s ++++gg+ a n+vD +p+t+W +++ w+++ L +p ++++ lt a+ + +++kd+ +++S Dg+tWt ++++++++ g+ XMG34086.1|CBM32|GH92 76 TA-SDENTGGGEVAVNLVDANPDTKWLAWEptGWVQFQLSEPVAITHYALTSANdaSeRDPKDWALQGSADGQTWTNIDQQTGQSFGS 162 33.4556677799***************95678******************7334556********************9988876666 PP CBM32.hmm 89 ..te.titfdkpvtaryvRltvtkratnawgasiaEl 122 ++ t ++++pvt ry+Rl+vt++ ++ + ++aEl XMG34086.1|CBM32|GH92 163 rfEThTYQLAAPVTYRYYRLNVTAN-NGGPILQLAEL 198 5533355777************543.22355888886 PP == domain 2 score: 36.5 bits; conditional E-value: 3.2e-13 CBM32.hmm 15 ggggaenavDgdpntrWssagqwltvdLgkp.ttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.te.titf 94 g+g+ ++++D+ +t + ++ +++ L+++ v+ ++lt + + +++ +++++S+Dg tWtt+++++++t + + t++f XMG34086.1|CBM32|GH92 1143 GTGSDAALFDNTSKTQAQVST--VQYQLNAAgDPVSYYTLTS-GaqPgADPTAWTLQGSNDGVTWTTLDSRSGQTF-QwRDqTRPF 1224 55778999**96556555554..******8879********5.343469*******************99887653.232437799 PP CBM32.hmm 95 d..kpvtaryvRltvt 108 + p + + +R++++ XMG34086.1|CBM32|GH92 1225 QvaHPGSYTQYRVQFS 1240 9777777788888883 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1256 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.24 // Query: UJF35191.1|CBM32 [L=1268] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-19 57.1 3.6 4.6e-19 55.3 3.6 1.9 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 55.3 3.6 4.6e-19 4.6e-19 11 111 .. 104 217 .. 99 235 .. 0.75 Alignments for each domain: == domain 1 score: 55.3 bits; conditional E-value: 4.6e-19 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt..teti 92 ++++++++a++++D +pnt+W a+ +l++++g ++ v+k+ + a+ + +++++++ve+S+Dg++Wt+++e++n++ t++ UJF35191.1|CBM32 104 KENPPSETADKLFDSSPNTKWLGAQptnvwVQLQFKYGDTQAVQKYAMVSANdaQtRDPQNWRVEGSNDGSNWTVLDEQTNQSFsARfqTKEY 196 55677899***************7344533349****************7334667*********************9999875444742233 PP CBM32.hmm 93 tfd..kpvtaryvRltvtkra 111 t++ k ++ y+Rl + +++ UJF35191.1|CBM32 197 TIAdeKVAEYAYYRLFILSNS 217 444556667899999995533 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1268 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.59 // Query: XHS36048.1|CBM32 [L=180] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-22 66.8 0.4 1.7e-22 66.4 0.4 1.1 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.4 0.4 1.7e-22 1.7e-22 4 112 .. 45 166 .. 40 176 .. 0.73 Alignments for each domain: == domain 1 score: 66.4 bits; conditional E-value: 1.7e-22 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag.......qwltvdLgkpttvdkvvltw..ae..n.grikdykvevStDgktWttvaekgnt 84 ass s+++a++g++++++D+d +t+W++++ +w+ +d++k+ ++ +v +t a n +k++k+e+StDg+t+t + e n+ XHS36048.1|CBM32 45 ASSF--SADEAPNGTPDKLIDNDSKTYWHTDYsvvtpypHWVLIDMKKEVKMISVGVTNryAAtpNaVGMKKFKLEGSTDGTTFTSLGEF-NF 134 3333..55666769****************744566789**********99999999955422565788******************744.55 PP CBM32.hmm 85 td.gtteti.tfd.kpvta.ryvRltvtk..ra.t 112 + + +f+ + +++ ry++lt+ + ra t XHS36048.1|CBM32 135 AIsN---DLqNFPvSSAKGyRYLKLTALEpqRAgT 166 4433...3448888555655*******55223333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (180 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 40.92 // Query: UOQ90330.1|CBM0|CBM32|GH92 [L=2062] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-28 84.9 16.5 9.4e-21 60.8 0.1 5.3 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.8 0.1 9.4e-21 9.4e-21 8 111 .. 84 196 .. 79 214 .. 0.78 2 ? -0.7 0.0 0.098 0.098 35 55 .. 335 361 .. 300 373 .. 0.64 3 ! 3.0 0.1 0.007 0.007 5 34 .. 709 740 .. 705 759 .. 0.73 4 ! 27.9 0.7 1.4e-10 1.4e-10 16 109 .. 1169 1269 .. 1161 1299 .. 0.71 5 ? -0.7 0.2 0.098 0.098 35 108 .. 1621 1709 .. 1599 1734 .. 0.60 Alignments for each domain: == domain 1 score: 60.8 bits; conditional E-value: 9.4e-21 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgntt 85 ++s +++++++a ++ Dg+++++W w +++L +p+ + +++lt + + ++++d++v +S++g++Wt+v+++++++ UOQ90330.1|CBM0|CBM32|GH92 84 TASGENPPNETAVKLADGNAGSKWLIFAstGWAQYELAAPHPIEAYTLTSgDDaPdRDPRDFRVLGSDNGTDWTVVDTRSGES 166 457778898*************999963357******************6522557********************9977655 PP CBM32.hmm 86 d.gt..tetitfdkpvta.ryvRltvtkra 111 g t+t+t+++p a ry+Rl +t+++ UOQ90330.1|CBM0|CBM32|GH92 167 FtGRgqTRTFTLAAPSAAcRYYRLDITANH 196 4454422355555776678*******7644 PP == domain 2 score: -0.7 bits; conditional E-value: 0.098 CBM32.hmm 35 g..qw..ltvdLgkp..ttvdkvvltw 55 + qw +tvdLg+ +tv++v l++ UOQ90330.1|CBM0|CBM32|GH92 335 WpdQWnkVTVDLGSLagRTVTGVLLDY 361 2455556******54348888888775 PP == domain 3 score: 3.0 bits; conditional E-value: 0.007 CBM32.hmm 5 ssaessssaaggggaenavDgd...pntrWssa 34 sa+++s++++ + +++vDg+ +n +W ++ UOQ90330.1|CBM0|CBM32|GH92 709 VSATTGSATDT-ATNAKLVDGKiyvNNGFWDTY 740 56777777777.99*******954334599985 PP == domain 4 score: 27.9 bits; conditional E-value: 1.4e-10 CBM32.hmm 16 gggaenavDgdpnt..rWssagqwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..t 89 g + +++vD++ nt + s++ lt + +p tv +++lt + + ++++++StDg++Wt+++ ++++ t UOQ90330.1|CBM0|CBM32|GH92 1169 GTSTAALVDDSMNTatTFDSGSAVLTWTSQsGPVTVGQYTLTG-AaRdAAPASWTLSGSTDGENWTELDHRDGEA-FAwpT 1247 3678999***98862256664234677777689*********4.244699******************8875433.22433 PP CBM32.hmm 90 etitfd..kpvtaryvRltvtk 109 +t++f+ ++ + +Rl+v++ UOQ90330.1|CBM0|CBM32|GH92 1248 QTRPFSadSDGVFTSLRLEVSS 1269 5778885533335888888833 PP == domain 5 score: -0.7 bits; conditional E-value: 0.098 CBM32.hmm 35 g...qwltvdLgkpttvdkvvltwae......n.grikdykvevS.tDg..ktWttvaekgnttdgt...tetitfd..kp 97 g q+ +v+ g t v++v + + + + +y+v+v +Dg + ttv + ++ + t +i +d + UOQ90330.1|CBM0|CBM32|GH92 1621 GaaeQSAVVNWGDGTAVSSVPVVD-GavtgehAyTVAGTYTVSVTvDDGirSASTTVEIVVDE--PApvyTPEIAVDptQV 1698 144567888999999999997773.23333333577779999999555643222333222121..1122222444444355 PP CBM32.hmm 98 vtaryvRltvt 108 +++ +R+t+t UOQ90330.1|CBM0|CBM32|GH92 1699 APGGTIRVTGT 1709 55677777775 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (2062 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 147.13 // Query: WFE98896.1|CBM32|GH92 [L=1870] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-26 77.0 33.3 2.4e-20 59.5 6.4 5.2 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.5 6.4 2.4e-20 2.4e-20 5 111 .. 90 204 .. 87 221 .. 0.78 2 ? -2.0 0.0 0.25 0.25 36 72 .. 346 387 .. 314 428 .. 0.70 3 ? 0.2 0.1 0.053 0.053 6 34 .. 701 731 .. 696 747 .. 0.70 4 ! 33.0 2.4 3.6e-12 3.6e-12 12 122 .. 1163 1279 .. 1159 1281 .. 0.71 5 ? -3.8 3.8 0.94 0.94 45 81 .. 1698 1734 .. 1583 1782 .. 0.59 Alignments for each domain: == domain 1 score: 59.5 bits; conditional E-value: 2.4e-20 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd. 86 s+ ++s+++++ + a+n+ D+d +t+W + w+t+ + +p tv++++lt a+ + +++kd+ v++StDg++Wt+++++++++ WFE98896.1|CBM32|GH92 90 SAVTASDEYQPREIAANLADDDSSTKWLVFQttGWVTYRFAEPVTVKRYSLTSANdaPsRDPKDFVVQGSTDGTSWTDLDKRSGEKFd 177 45566788899999**************974467******************7334547********************998766554 PP CBM32.hmm 87 gt..tetitfdkpvta.ryvRltvtkra 111 g t++ +++ ++ta y+Rl+vt+++ WFE98896.1|CBM32|GH92 178 GRfaTNRYSVT-NTTAyAYYRLNVTANS 204 55533334555.45666*******7754 PP == domain 2 score: -2.0 bits; conditional E-value: 0.25 CBM32.hmm 36 qw..ltvdLgkpt...tvdkvvltwae.n.grikdykvevStDg 72 qw ++ dLg++ t+d++ l + n + + d +++++ D+ WFE98896.1|CBM32|GH92 346 QWnlVQADLGTVArgkTIDRILLA--YdNpQATGDTQFQGWLDD 387 566689999987434488888888..333366677777766654 PP == domain 3 score: 0.2 bits; conditional E-value: 0.053 CBM32.hmm 6 saessssaaggggaenavDgd...pntrWssa 34 sa +++s+++ ++ +++vDg+ +n +W ++ WFE98896.1|CBM32|GH92 701 SAPTGASTPT-QTGAKIVDGQiyvNNGFWDTY 731 5554555555.99*******844334599885 PP == domain 4 score: 33.0 bits; conditional E-value: 3.6e-12 CBM32.hmm 12 saaggggaenavDgdpnt..rWssag.qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..te 90 +a+gg++a++++D++ +t ++sa+ q d g+ ++ + +++t + g++ d+++++S+Dg tWttv++++++ ++ WFE98896.1|CBM32|GH92 1163 TATGGQDASKLFDDSSTTqlTFASATpQITWADRGGKQKPTYYTVTS-GaAaGDPADWRLQGSNDGLTWTTVDSRSDQVF-RwrNQ 1246 3456689*******9887444555445444569*************5.33359********************9987654.34444 PP CBM32.hmm 91 titfd..kpvtaryvRltvtkratnawgasiaEl 122 t++++ kp + +Rl vtk+ +a +++aE+ WFE98896.1|CBM32|GH92 1247 TRPYSidKPGRFAQFRLAVTKTV-GAAQTNLAEI 1279 55555448887777888886643.3344666665 PP == domain 5 score: -3.8 bits; conditional E-value: 0.94 CBM32.hmm 45 pttvdkvvltwae.n.grikdykvevStDgktWttvaek 81 +tt +++++ + + +++v+v tD + t+va++ WFE98896.1|CBM32|GH92 1698 VTTGGAITVD--GsGfAAGEQVTVSVGTDPSRTTKVAAS 1734 2333333333..112233445555555554444455433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1870 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.70 // Query: ABV99297.1|CBM32|GH92 [L=1422] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-27 82.8 6.8 1.8e-18 53.4 2.4 3.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.4 2.4 1.8e-18 1.8e-18 8 111 .. 81 192 .. 75 215 .. 0.81 2 ! 29.8 0.1 3.6e-11 3.6e-11 43 111 .. 1195 1266 .. 1166 1283 .. 0.72 Alignments for each domain: == domain 1 score: 53.4 bits; conditional E-value: 1.8e-18 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.. 88 +++ +++++++ +++Dgd++t+W + w+ L++p tv ++ lt a+ + +++kd+++++StDg tW+t++++++++ ++ ABV99297.1|CBM32|GH92 81 TANGDNPPNETVRRVIDGDATTKWLVFEptGWVRAQLETPATVVHYALTSANdvPeRDPKDWELQGSTDGDTWVTLDTQTGQDFPErf 168 5677888889****************74467******************7335657*********************98876554457 PP CBM32.hmm 89 te.titfdkpvtaryvRltvtkra 111 ++ + +f++ ++ ++Rl++t+++ ABV99297.1|CBM32|GH92 169 QTkEYRFSNSTEYLHYRLNITANH 192 443779998888999999996644 PP == domain 2 score: 29.8 bits; conditional E-value: 3.6e-11 CBM32.hmm 43 gkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..kpvtaryvRltvtkra 111 g+p +v++++lt + +++ +++++S Dg tWtt+++++n++ t +t++f+ + ++ry+ ++ t+ ABV99297.1|CBM32|GH92 1195 GAPEKVTHYTLTS-GpdDgTDPVGWSLQGSYDGDTWTTIDSRTNEQ-FTwrLQTRSFAveQ--PGRYLHYRLTSEG 1266 6899********5.3443599*******************999865.55443466777435..5799999996533 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1422 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 156.43 // Query: WAL98474.1|CBM0|CBM32|GH92 [L=1281] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-26 77.8 10.9 2.3e-20 59.5 2.2 3.7 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.5 2.2 2.3e-20 2.3e-20 7 112 .. 83 198 .. 77 210 .. 0.74 2 ? -1.8 0.2 0.21 0.21 17 47 .. 718 752 .. 708 808 .. 0.57 3 ? -2.0 0.0 0.25 0.25 59 78 .. 1101 1121 .. 1081 1135 .. 0.77 4 ! 21.9 0.0 1.1e-08 1.1e-08 19 105 .. 1173 1263 .. 1161 1278 .. 0.71 Alignments for each domain: == domain 1 score: 59.5 bits; conditional E-value: 2.3e-20 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a s+++a++g+ a+n+vDg ++++W + w ++dL++p +v ++ lt a+ +++kd+++ +StDg tWt+++e++++ WAL98474.1|CBM0|CBM32|GH92 83 A-SGENAGSGEVAANLVDGEATSKWLTFAkdGWAEFDLDEPAKVVTYALTSANdhAeRDPKDWTLKGSTDGRTWTVLDERKGE 164 3.4666777789*******999*****74467******************7334546********************998766 PP CBM32.hmm 85 td.gtte..titfd..kpvta.ryvRltvtkrat 112 g ++ + +f+ ++++a ++Rl vt+++ WAL98474.1|CBM0|CBM32|GH92 165 AFdGRHKtkKYDFAkpDDAKAySHFRLDVTANNG 198 6556643223355566566777*******66442 PP == domain 2 score: -1.8 bits; conditional E-value: 0.21 CBM32.hmm 17 ggaenavDgdp...ntrWssag.qwltvdLgkptt 47 ++ +++v g+p n +W ++ +w + L +p++ WAL98474.1|CBM0|CBM32|GH92 718 HTGAKIVEGKPyvnNGFWDTYRtTWPAYSLLTPKK 752 66666666664221236666433344444444433 PP == domain 3 score: -2.0 bits; conditional E-value: 0.25 CBM32.hmm 59 grikdykvevS.tDgktWttv 78 + +k++ v++ +gktW+ WAL98474.1|CBM0|CBM32|GH92 1101 NSAKNVYVQGLkVNGKTWKST 1121 56888888888789****865 PP == domain 4 score: 21.9 bits; conditional E-value: 1.1e-08 CBM32.hmm 19 aenavDgdpntrWssagqwltvdLgkpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekgnttdgt..tetit 93 +++D++ t s+ v L + ++v++t + + ++ + +++S Dg++W++++++++++ ++t+ WAL98474.1|CBM0|CBM32|GH92 1173 EGALFDDSSATEATSD---AAVPLPVSAKTKAVQYTLtSPadKaKAPRGWVLQGSADGEKWRDLDKRTSESF-AwaQQTRA 1249 5678888666665554...799999999999*****9733445799******************99886543.24444667 PP CBM32.hmm 94 fd..kpvtaryvRl 105 f+ p ++Rl WAL98474.1|CBM0|CBM32|GH92 1250 FTiaHPGAYGHYRL 1263 76434443355555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1281 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 133.73 // Query: UJF34875.1|CBM0|CBM32|GH92 [L=1824] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-29 87.6 27.4 1e-18 54.2 5.9 5.1 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 54.2 5.9 1e-18 1e-18 10 122 .. 28 147 .. 21 149 .. 0.78 2 ? 2.5 0.3 0.01 0.01 10 42 .. 655 690 .. 647 720 .. 0.71 3 ! 40.2 4.2 2.2e-14 2.2e-14 10 122 .. 1128 1247 .. 1119 1249 .. 0.73 4 ? -0.3 0.1 0.076 0.076 13 51 .. 1548 1584 .. 1542 1632 .. 0.59 Alignments for each domain: == domain 1 score: 54.2 bits; conditional E-value: 1e-18 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd. 86 ++++++ a n++D ++n++W + w ++++++p+t+ k+ lt a+ +++k++++++S++g++Wt++++++n++ UJF34875.1|CBM0|CBM32|GH92 28 RGENTPNEIAINLTDANTNSKWLDFNktSWAQFKFDQPRTIVKYALTSANdaAgRDPKNWTLQGSNNGTDWTVLDTRTNQSFs 110 344455599***************75578******************7334546***********************998876 PP CBM32.hmm 87 gt.teti.tfdkpvta.ryvRltvtkra.tnawgasiaEl 122 g +++ +f++ +ta y++l + + ++++ ++aE+ UJF34875.1|CBM0|CBM32|GH92 111 GRfATNVyDFAN-TTAyLYYKLDI--TLnNGENIIQLAEV 147 667445559985.5565*******..44233455888887 PP == domain 2 score: 2.5 bits; conditional E-value: 0.01 CBM32.hmm 10 sssaaggggaenavDgd...pntrWssag.qwltvdL 42 s+s+a+ ++ +++vDg+ +n +W ++ +w + L UJF34875.1|CBM0|CBM32|GH92 655 STSTAT-QTCAKVVDGKsyvNNGFWDTYRtTWPAYTL 690 333444.89*******854334599996445655555 PP == domain 3 score: 40.2 bits; conditional E-value: 2.2e-14 CBM32.hmm 10 sssaaggggaenavDgdpnt..rWssagqwltvdLgkp.ttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnt 84 s+++++ n++D++ +t +sa+ wl++d+ k + + ++lt ++ +++ ++ + +S+Dg++Wt+++e++n+ UJF34875.1|CBM0|CBM32|GH92 1128 SAGTTA-AVLGNMFDNNSGTsgAMASATPWLQYDFTKSkEKANMYTLTSsSGnAnTDPASWALKGSNDGQNWTVLDERTNE 1207 333334.6799*****99984445554379******7748999999997532435*********************99886 PP CBM32.hmm 85 tdgt..tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 + +t+ f+ ++ + +Rl++t++ + ++s+aE+ UJF34875.1|CBM0|CBM32|GH92 1208 A-FSwrGQTRAFAihTAGEYSSYRLEITANGGG-ASTSLAEV 1247 5.44433466888777788999*****554433.44899987 PP == domain 4 score: -0.3 bits; conditional E-value: 0.076 CBM32.hmm 13 aaggggaenavDgdpnt.rWssagqwltvdLgkpttvdkv 51 +a+ +++++a+Dg +t ++ +lt+ L ++t+ + + UJF34875.1|CBM0|CBM32|GH92 1548 SAS-QAPTAALDGISQTtPGQTF--DLTYALSSVTNATYF 1584 344.7899999994443133332..355555555554444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1824 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 146.90 // Query: WHM35955.1|CBM32|GH92 [L=1283] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-28 83.6 8.7 4.3e-22 65.1 2.7 3.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.1 2.7 4.3e-22 4.3e-22 4 109 .. 94 206 .. 91 223 .. 0.73 2 ? 1.5 0.1 0.021 0.021 12 37 .. 718 747 .. 712 784 .. 0.77 3 ! 18.1 0.0 1.6e-07 1.6e-07 39 95 .. 1195 1255 .. 1165 1280 .. 0.70 Alignments for each domain: == domain 1 score: 65.1 bits; conditional E-value: 4.3e-22 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd 86 a a++++ +++g+ en+vDg+p+t+W + + wl++dL++p +v ++ lt a+ +++kd+++ +S Dg+tWtt+++++++t WHM35955.1|CBM32|GH92 94 AVRASAEN-DGSGEVKENLVDGQPSTKWLAFQptAWLEFDLDSPVKVVTYALTSANdaApRDPKDWTLKGSADGSTWTTLDTRSGETF 180 44444344.455599***************86678******************7334547*********************9876655 PP CBM32.hmm 87 gt..te.titfdkpvtaryvRltvtk 109 ++ ++ t +f+ + +Rl++t WHM35955.1|CBM32|GH92 181 SSrfQTkTYDFAGSTAYARYRLEITR 206 33463336677733323666777744 PP == domain 2 score: 1.5 bits; conditional E-value: 0.021 CBM32.hmm 12 saaggggaenavDgd...pntrWssag.qw 37 +++++++ +++vDg+ +n +W ++ +w WHM35955.1|CBM32|GH92 718 QDTPTHTGAKIVDGKvyvNNGFWDTYRtTW 747 4556699*******8553346999853334 PP == domain 3 score: 18.1 bits; conditional E-value: 1.6e-07 CBM32.hmm 39 tvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd 95 v+L + ++v++t + + + + +++S+Dg++W++++++++++ +++t+ f WHM35955.1|CBM32|GH92 1195 SVELPVASATRAVRYTLtSAdRaKAPEGWVLQGSSDGTKWVDLDKRSGESFaWDKQTRVFG 1255 5778888888889999863344699******************987654432223344444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1283 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 135.24 // Query: XGK08571.1|CBM32|GH92 [L=1120] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1120 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 803.01 // Query: XPP19676.1|CBM32|GH92 [L=1903] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-25 75.3 7.4 1.8e-16 46.9 3.1 3.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.9 3.1 1.8e-16 1.8e-16 8 109 .. 81 191 .. 76 209 .. 0.75 2 ! 28.6 0.1 8.6e-11 8.6e-11 43 122 .. 1218 1301 .. 1183 1305 .. 0.72 Alignments for each domain: == domain 1 score: 46.9 bits; conditional E-value: 1.8e-16 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStD.gktWttvaekgnttd.gt 88 ++s+++a+g++a n+ Dg+p ++W + + ++t+ L++p+t +++lt a+ + ++++d+++ +StD g+tWttv+++++t g XPP19676.1|CBM32|GH92 81 TASAENAPGETAVNLSDGNPASKWLAFErtATVTYLLDSPQTAATWSLTSANdaPtRDPRDVTLLGSTDgGTTWTTVDQRSGTAFaGR 168 345667787*****************744668*****************7334557*************679*****99877666555 PP CBM32.hmm 89 te.titfdkpvta..ryvRltvtk 109 t++f+ pv+a +Rl +t+ XPP19676.1|CBM32|GH92 169 -GaTVDFAVPVPAayDAYRLDITA 191 .33778885565413667777754 PP == domain 2 score: 28.6 bits; conditional E-value: 8.6e-11 CBM32.hmm 43 gkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 +p tv++++lt ++ + ++ +++e+StDg+tW +++e++ +t ++ +t++f+ +p + ++R+t t+++ +a ++El XPP19676.1|CBM32|GH92 1218 SGPVTVSRYTLT-NGptGsAAPTGWTLEGSTDGTTWLPLDERAAQTFPSaLQTRPFTvtDPRPFSWYRITTTGTTD-GRAATLSEL 1301 4789********.43554699*******************998877655434556666688888*******66543.344666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1903 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 162.61 // Query: XIJ12826.1|CBM32|GH92 [L=1410] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.4e-25 73.7 18.0 2.8e-20 59.3 3.2 3.9 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.3 3.2 2.8e-20 2.8e-20 10 122 .. 94 214 .. 86 216 .. 0.76 2 ? -1.2 0.1 0.14 0.14 15 37 .. 711 737 .. 703 765 .. 0.74 3 ? -1.4 0.0 0.17 0.17 50 78 .. 1082 1110 .. 1068 1131 .. 0.69 4 ! 21.5 2.1 1.4e-08 1.4e-08 18 109 .. 1163 1257 .. 1156 1282 .. 0.69 Alignments for each domain: == domain 1 score: 59.3 bits; conditional E-value: 2.8e-20 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt...t 89 ++ a++g+ en+vDg+ nt+W w t+++++++t++k+ l a+ + +++k++++++S +g++Wt++++++++t ++ t XIJ12826.1|CBM32|GH92 94 GEYAESGEVKENLVDGSVNTKWLVFAttGWATFKFDEARTIKKYALSSANdsPeRDPKNWTLQGSANGTDWTVLDTRAGETFPErfqT 181 445566699**************963367******************7334547*********************9887665443532 PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEl 122 +t ++++p + ++++l vt ++ +++ +++aE+ XIJ12826.1|CBM32|GH92 182 KTYEIAAPQSFQHYKLDVTLNNGSTNIVQLAEV 214 35566677788*******554422355888887 PP == domain 2 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 15 ggggaenavDgd...pntrWssag.qw 37 ++ + +++vDg+ +n +W ++ +w XIJ12826.1|CBM32|GH92 711 PTKTGAKIVDGKvyvNNGFWDTYRtTW 737 4478899****8553345999863344 PP == domain 3 score: -1.4 bits; conditional E-value: 0.17 CBM32.hmm 50 kvvltwaen.grikdykvevS.tDgktWttv 78 k+v++ + +++k++ v++ +gk W++ XIJ12826.1|CBM32|GH92 1082 KLVIN--APkNNAKNIYVQGVkVNGKAWNKT 1110 55555..223789999999776899999865 PP == domain 4 score: 21.5 bits; conditional E-value: 1.4e-08 CBM32.hmm 18 gaenavDgdpntrWssagqwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt.te.titfd..kp 97 + +++vD++ +t ++ + ++ +++ ++ ++ + + ++ +++ +S DgktW v+++++++ + ++ t++f+ +p XIJ12826.1|CBM32|GH92 1163 STAALVDNNSSTSAVVKS--FDFKASDVKEKAEFYTLTNGkTgTSPTAWELKGSYDGKTWASVDKRSGEN-FQwQQyTRSFKiaSP 1245 578899998888655553..5555555544444433323344699******************9876543.334453558887788 PP CBM32.hmm 98 vtaryvRltvtk 109 + ++Rl++t+ XIJ12826.1|CBM32|GH92 1246 GRYNFYRLEFTG 1257 889999999965 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1410 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 138.58 // Query: XEM51073.1|CBM32|GH92 [L=1438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-33 100.9 19.2 4e-23 68.4 1.7 3.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.4 1.7 4e-23 4e-23 3 122 .. 87 213 .. 85 215 .. 0.77 2 ? 1.6 0.2 0.02 0.02 11 37 .. 717 746 .. 708 786 .. 0.67 3 ! 38.1 5.2 9.6e-14 9.6e-14 12 123 .. 1180 1293 .. 1176 1294 .. 0.77 Alignments for each domain: == domain 1 score: 68.4 bits; conditional E-value: 4e-23 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgntt 85 t+ssa+ s++++gg+ +n++Dg ++t+W s++ w +v L +pt+++++ l + +++kd+++++S+D tWt++++++++ XEM51073.1|CBM32|GH92 87 TESSAS-SENTSGGEVVSNLFDGTTDTKWLSWDptAWAQVTLSEPTSITHYALSSaNDfDnRDPKDWTLQGSNDALTWTDLDKQADQA 173 666765.66666669****************96689******************7522535********************9888866 PP CBM32.hmm 86 dgt...te.titfdkpvta.ryvRltvtkratnawgasiaEl 122 t ++ + ++++p a +++Rl+vt ++ + + +++El XEM51073.1|CBM32|GH92 174 F-TarfQQkDYPLAAPSAAfKFFRLNVTRNN-GGPILQLSEL 213 4.334633356777666677*******5532.2344666665 PP == domain 2 score: 1.6 bits; conditional E-value: 0.02 CBM32.hmm 11 ssaaggggaenavDgdp..nt.rWssag.qw 37 ++ +++++ +++vDg++ n+ +W ++ +w XEM51073.1|CBM32|GH92 717 AD-TPTQTGSKIVDGQTyvNNgFWDTYRtTW 746 34.445899******6422223788853334 PP == domain 3 score: 38.1 bits; conditional E-value: 9.6e-14 CBM32.hmm 12 saaggggaenavDgdpntrWssag.qwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tet 91 +++g ++a+++vD+ ++r ++a +++ L+++ v++++lt + + g++k++++ +S DgktW ++++++n+ + ++t XEM51073.1|CBM32|GH92 1180 TSDG-SDAKALVDN--TSRTQAAVtGAVQYQLNNTdEAVTNYTLTS-QtGaGDPKSWTLKGSYDGKTWAVADQQTNQA-FSwrQQT 1260 3455.89*******..44555542236******7769********4.3446******************888887865.4454456 PP CBM32.hmm 92 itfd..kpvtaryvRltvtkratnawgasiaEla 123 + f+ +p+ +++l+vt+++t+a+ a++aE++ XEM51073.1|CBM32|GH92 1261 RAFKvaNPAHYAHYKLEVTATSTGAP-AQLAEFE 1293 6888778888999*****88888666.9****95 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1438 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.88 // Query: XPP16506.1|CBM32|GH92 [L=1903] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-25 75.3 7.4 1.8e-16 46.9 3.1 3.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.9 3.1 1.8e-16 1.8e-16 8 109 .. 81 191 .. 76 209 .. 0.75 2 ! 28.6 0.1 8.6e-11 8.6e-11 43 122 .. 1218 1301 .. 1183 1305 .. 0.72 Alignments for each domain: == domain 1 score: 46.9 bits; conditional E-value: 1.8e-16 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStD.gktWttvaekgnttd.gt 88 ++s+++a+g++a n+ Dg+p ++W + + ++t+ L++p+t +++lt a+ + ++++d+++ +StD g+tWttv+++++t g XPP16506.1|CBM32|GH92 81 TASAENAPGETAVNLSDGNPASKWLAFErtATVTYLLDSPQTAATWSLTSANdaPtRDPRDVTLLGSTDgGTTWTTVDQRSGTAFaGR 168 345667787*****************744668*****************7334557*************679*****99877666555 PP CBM32.hmm 89 te.titfdkpvta..ryvRltvtk 109 t++f+ pv+a +Rl +t+ XPP16506.1|CBM32|GH92 169 -GaTVDFAVPVPAayDAYRLDITA 191 .33778885565413667777754 PP == domain 2 score: 28.6 bits; conditional E-value: 8.6e-11 CBM32.hmm 43 gkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 +p tv++++lt ++ + ++ +++e+StDg+tW +++e++ +t ++ +t++f+ +p + ++R+t t+++ +a ++El XPP16506.1|CBM32|GH92 1218 SGPVTVSRYTLT-NGptGsAAPTGWTLEGSTDGTTWLPLDERAAQTFPSaLQTRPFTvtDPRPFSWYRITTTGTTD-GRAATLSEL 1301 4789********.43554699*******************998877655434556666688888*******66543.344666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1903 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 162.15 // Query: XLR78699.1|CBM0|CBM32|GH92 [L=1435] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-32 96.3 18.6 2.7e-21 62.5 1.7 4.2 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.5 1.7 2.7e-21 2.7e-21 4 112 .. 87 203 .. 84 214 .. 0.76 2 ? 1.4 0.3 0.022 0.022 9 37 .. 714 745 .. 706 793 .. 0.70 3 ? -1.0 0.0 0.13 0.13 59 77 .. 1100 1119 .. 1082 1137 .. 0.79 4 ! 40.3 2.6 2.1e-14 2.1e-14 12 122 .. 1178 1289 .. 1174 1291 .. 0.75 Alignments for each domain: == domain 1 score: 62.5 bits; conditional E-value: 2.7e-21 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaek 81 sa+ s++++gg+ a+n++Dg+++t+W s++ ++t+ L +pt+++++ + a+ + ++++d+++++S+D + Wt+++++ XLR78699.1|CBM0|CBM32|GH92 87 DVSAT-SENTGGGEVAANLIDGSTGTKWLSWDptASVTFALSAPTSITHYAVSSANdfPgRDPRDWTLQGSNDAQRWTDLDKQ 168 55665.555666699***************956678*****************7334657********************987 PP CBM32.hmm 82 gnttdgt..te.titfdkpvta.ryvRltvtkrat 112 ++++ + ++ + ++++p a y+Rl+vt ++ XLR78699.1|CBM0|CBM32|GH92 169 SGQSFASrfQQnDYKLAAPSAAfAYYRLNVTRNNG 203 77665334733366777666667*******65432 PP == domain 2 score: 1.4 bits; conditional E-value: 0.022 CBM32.hmm 9 ssssaaggggaenavDgdp..nt.rWssag.qw 37 +++++a+ + +++vDg++ n+ +W ++ +w XLR78699.1|CBM0|CBM32|GH92 714 TGADTAT-RTGSKIVDGQTyvNNgFWDTYRtTW 745 3444555.899******6422223788853334 PP == domain 3 score: -1.0 bits; conditional E-value: 0.13 CBM32.hmm 59 grikdykvevS.tDgktWtt 77 + +k++ v++ +gk+Wt XLR78699.1|CBM0|CBM32|GH92 1100 NSAKNVYVQGLkVNGKNWTS 1119 56888899988789****96 PP == domain 4 score: 40.3 bits; conditional E-value: 2.1e-14 CBM32.hmm 12 saaggggaenavDgdpntrWssag.qwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt 88 +++g ++a++++D+ ++r +++ +++ L+++ v++++lt + + g++k++++ +S DgktWt+++++++++ + XLR78699.1|CBM0|CBM32|GH92 1178 TSDG-SDASALLDN--TSRTQAKVtGAVQYQLKSAdEAVTHYTLTS-GtGaGDAKSWTLKGSYDGKTWTVADQQTGQSFPW 1254 3455.89*******..55555642236******6669********4.3446******************888777665433 PP CBM32.hmm 89 .tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 ++t+ f+ +p+ y+Rl+vt++a +a +aE+ XLR78699.1|CBM0|CBM32|GH92 1255 rQQTRAFAvkNPAHYAYYRLEVTATA--GGPATLAEF 1289 445667777699999*******6644..334788988 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1435 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.79 // Query: WIB15897.1|CBM32|GH92 [L=1965] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-27 80.3 18.9 1.3e-18 53.9 5.1 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.9 5.1 1.3e-18 1.3e-18 9 112 .. 85 197 .. 79 211 .. 0.74 2 ? -2.5 0.1 0.37 0.37 36 72 .. 338 380 .. 313 406 .. 0.64 3 ! 33.3 2.3 3e-12 3e-12 17 122 .. 1182 1293 .. 1168 1295 .. 0.69 Alignments for each domain: == domain 1 score: 53.9 bits; conditional E-value: 1.3e-18 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g.qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt.t 89 + +++++++ a+ + Dg+++++W + + +t+ L++p t+++++lt a+ + ++++ +++e+StDg+tWttv++++ +t g + WIB15897.1|CBM32|GH92 85 ADAENPPNEVAASLADGNAGSKWLAFrNtGVVTYRLDQPETLRAYSLTSANdaPgRDPSAWTLEGSTDGTTWTTVDTQTAQTFsGRgK 172 3556788899***************631346*****************7334557*********************999777656642 PP CBM32.hmm 90 etitfd..kpvtaryvRltvtkra.t 112 t t++ +p + +Rl++tk++ WIB15897.1|CBM32|GH92 173 -TNTYTaaTPGSYDRYRLRITKNSgD 197 .4455533677778888888886532 PP == domain 2 score: -2.5 bits; conditional E-value: 0.37 CBM32.hmm 36 qw..ltvdLg..kpttvdkvvltw..aen.grikdykvevStDg 72 qw + + Lg + +tvdkv +t+ + g+ + k++++ D+ WIB15897.1|CBM32|GH92 338 QWnsIRIPLGalAGKTVDKVLFTYddD-AaGTSASTKFQGWVDD 380 343488888843448999999997531.3477777777777664 PP == domain 3 score: 33.3 bits; conditional E-value: 3e-12 CBM32.hmm 17 ggaenavDgd..pntrWssagqwltvdLg.kpttvdkvvltw.aen.grikdykvevStDgktWttvaekgnttdgt....tetit 93 + +++D+ + t +ssa+ +t + +p tvd+++lt a + g+++++k+e+S+Dg+tW+++ ++++ t + t+ +t WIB15897.1|CBM32|GH92 1182 TAVGALTDNEslTATTFSSATPAITWKSSqGPVTVDQYTLTTaA-SgGQPTSWKLEGSSDGSTWVPLSTVAKSTF-DaplqTRPTT 1265 56777788753323556664235888887689*********642.349*******************98774332.2345422224 PP CBM32.hmm 94 fdkpvtaryvRltvtkratnawgasiaEl 122 ++ p+ +++Rl vt+++t++ si E+ WIB15897.1|CBM32|GH92 1266 IEHPAALTWYRLSVTGTSTGKA-PSIGEF 1293 4455546*******99887654.689888 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1965 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 163.26 // Query: BGA68408.1|CBM32|GH92 [L=490] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-11 31.2 0.5 1.3e-11 31.2 0.5 2.1 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.8 0.2 0.93 0.93 62 78 .. 125 142 .. 112 156 .. 0.60 2 ? -2.7 0.0 0.42 0.42 60 76 .. 314 331 .. 294 351 .. 0.60 3 ! 31.2 0.5 1.3e-11 1.3e-11 21 107 .. 387 477 .. 378 487 .. 0.74 Alignments for each domain: == domain 1 score: -3.8 bits; conditional E-value: 0.93 CBM32.hmm 62 kdykvevS.tDgktWttv 78 d++ve S D W BGA68408.1|CBM32|GH92 125 GDWRVESSkYDPRVWGHD 142 466777664465555433 PP == domain 2 score: -2.7 bits; conditional E-value: 0.42 CBM32.hmm 60 rikdykvevS.tDgktWt 76 +k++ v++ +gk W+ BGA68408.1|CBM32|GH92 314 SAKNVYVQGLkVNGKRWN 331 455555555444555554 PP == domain 3 score: 31.2 bits; conditional E-value: 1.3e-11 CBM32.hmm 21 navDgdpntrWssagqwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gt..tetitfd..kpvta 100 +++D++ t ++ tvdL + + ++v++t ++ ++ +++++S Dg++W+t++++++ d +t+ f+ kp + BGA68408.1|CBM32|GH92 387 ALFDNSSAT--GATV--STVDLPVAGDAKAVQYTLtSSdHaKAPTGWTLQGSADGTSWKTLDKRADDADaFRwdRQTRAFSvdKPGKY 470 577774444..2332..49***************973344599******************998875554447523445555599988 PP CBM32.hmm 101 ryvRltv 107 ++Rl+ BGA68408.1|CBM32|GH92 471 GHYRLVL 477 9999887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (490 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.59 // Query: XIA18157.1|CBM32|GH92 [L=1123] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-11 28.6 0.0 2e-09 24.2 0.0 2.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.4 0.0 0.16 0.16 23 56 .. 141 201 .. 130 244 .. 0.63 2 ? -0.2 0.0 0.072 0.072 10 37 .. 543 573 .. 535 594 .. 0.69 3 ! 24.2 0.0 2e-09 2e-09 10 107 .. 999 1102 .. 995 1117 .. 0.69 Alignments for each domain: == domain 1 score: -1.4 bits; conditional E-value: 0.16 CBM32.hmm 23 vDgdpntrWss...............ag........qw..ltvdLgkp...ttvdkvvltw.a 56 +D+ ++r ss +g qw l vd g++ +t++++vl + + XIA18157.1|CBM32|GH92 141 FDD--GSRLSSrgardqhrlgasaraQGegrvlypdQWnyLAVDVGAVaagRTIKRIVLAHdG 201 555..5555554444444443333330033445556555599999976335699999999541 PP == domain 2 score: -0.2 bits; conditional E-value: 0.072 CBM32.hmm 10 sssaaggggaenavDgdp...ntrWssag.qw 37 ++++++ + +++vDg+p n +W ++ w XIA18157.1|CBM32|GH92 543 GKDTPT-RTGARIVDGKPyvnNGFWDTYRtAW 573 444444.8999*****9633145999863334 PP == domain 3 score: 24.2 bits; conditional E-value: 2e-09 CBM32.hmm 10 sssaaggggaenavDgdpnt.rWssag.qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..t 89 +ss+++ g +++D+d + a+ +++ + +p++v ++lt + ++ +++++S Dg++W+t+++++++ XIA18157.1|CBM32|GH92 999 TSSTPTIAGLPALFDNDSASeAVLPATsTTIAWHYAAPRRVALLTLTS-AaRaAAPSGWQLQASVDGHHWRTLDTRQQQR-FAwpR 1082 444555567788999976653444433456999999***********5.234589******************9986533.33432 PP CBM32.hmm 90 etitfd..kpvtaryvRltv 107 +t+ f+ +p + ++Rl + XIA18157.1|CBM32|GH92 1083 QTRAFAvpAPGEYAHYRLHF 1102 45577744666778888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1123 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 146.62 // Query: WBX74989.1|CBM0|CBM32 [L=1291] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-67 211.8 39.7 1e-29 89.7 1.3 5.5 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.0 1.6 0.061 0.061 19 74 .. 187 264 .. 178 331 .. 0.63 2 ! 89.7 1.3 1e-29 1e-29 6 123 .. 360 481 .. 355 482 .. 0.83 3 ! 47.5 2.2 1.2e-16 1.2e-16 11 122 .. 512 629 .. 506 631 .. 0.77 4 ! 48.1 1.7 7.7e-17 7.7e-17 11 122 .. 661 778 .. 655 780 .. 0.77 5 ! 48.4 3.4 6.5e-17 6.5e-17 13 122 .. 812 927 .. 804 929 .. 0.74 Alignments for each domain: == domain 1 score: 0.0 bits; conditional E-value: 0.061 CBM32.hmm 19 aenavDgdpntrWssag..............qwltvdLgkp.ttvdkvvltw..ae.....n..grikdykvevStDgkt 74 a+ ++D n++W ++ ++ ++L++ +t+d ++++ ++ + + ++dy+ +vS+D ++ WBX74989.1|CBM0|CBM32 187 ADVTIDA--NSKWLKGYngsaffinylndnyIDFAYKLNQScKTIDPWTFKKatEQivngkTieQLWNDYTTSVSNDREK 264 5556677..88888842233344444544334578888866579999988865411333342357777999999999743 PP == domain 2 score: 89.7 bits; conditional E-value: 1e-29 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekg.ntt 85 + ++ss ++++++ +n++D++++trWss+ + +w+ vdL+++ +v +v++ w + + +kdy++++S++g++W+t+++ + n++ WBX74989.1|CBM0|CBM32 360 TVTASSVEKNEFDLSNVIDNNEGTRWSSNfSdnEWIAVDLESESEVCAVTISWfSCcsImMGAKDYDIQTSDNGENWKTIKTITdNFD 447 55678888999*****************853689*******************843433689******************99773543 PP CBM32.hmm 86 dgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + + i+++ tar++R++++kr+ n++g+si+El+ WBX74989.1|CBM0|CBM32 448 NFN--FIPIN--KTARHIRIKGIKRSLNNFGYSINELK 481 222..34555..579***********889*******86 PP == domain 3 score: 47.5 bits; conditional E-value: 1.2e-16 CBM32.hmm 11 ssaaggggaenavDgdpntrWssa.g.qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gtte.t 91 +++++++g n+vD++ +t++ + g +++ +++ k++ +++++lt a+ + +++k++ +e+S+Dg +Wt +++k+n + + +e + WBX74989.1|CBM0|CBM32 512 NDSPSNEGVGNLVDNSSDTKYLTFkGnTTVSYNFAKNYVISGYSLTSANdaPeRDPKKWVLEGSNDGLNWTAIDTKDNNSFlNRKEkK 599 55677799***********9999633568*****************7334547********************999886666664433 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 + t++++ vR+++t+++ +++aEl WBX74989.1|CBM0|CBM32 600 VfTVSSNLAYESVRFKFTNTS--GAIFQLAEL 629 335555555699*****5533..233677776 PP == domain 4 score: 48.1 bits; conditional E-value: 7.7e-17 CBM32.hmm 11 ssaaggggaenavDgdpntrWssa.g.qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gtte.t 91 +++++++g n+vD++ +t++ + g +++++++ k++ +++++lt a+ + +++k++ +e+S+Dg +Wt +++k+n + + +e + WBX74989.1|CBM0|CBM32 661 NDSPSNEGVGNLVDNSSDTKYLTFkGnTTVIYNFAKNYVISGYSLTSANdaPeRDPKRWVLEGSNDGLNWTAIDTKDNNSFlNRKEkK 748 55677799***********9999633568*****************7334547********************999886666664433 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEl 122 + t++++ vR+++t+++ + +++aEl WBX74989.1|CBM0|CBM32 749 VfTVSSNLAYESVRFKFTNTS--GTIFQLAEL 778 33555555569******5544..233777776 PP == domain 5 score: 48.4 bits; conditional E-value: 6.5e-17 CBM32.hmm 13 aaggggaenavDgdpntrWssa.g.qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gttetitf 94 +++ + n+vD++ +t++ + g +++ +++ + + +++++lt a+ + +++k++ +e+S+Dg +Wt++++++n + + +e++tf WBX74989.1|CBM0|CBM32 812 SPSAELVGNLVDNNSDTKYLTFkGnTTVSYNFTQSYVISGYSLTSANdaPeRDPKSWVLEGSNDGVNWTVIDTRDNNSFsNRKEKKTF 899 44556689*********9999633568*****************7334547*********************9987555444444466 PP CBM32.hmm 95 d.kpvt.aryvRltvtkratnawgasiaEl 122 + ++++ + vR+++t+++ +++aEl WBX74989.1|CBM0|CBM32 900 TvSNISdFKSVRFKFTNNS--GSIFQLAEL 927 66344326*******4432..223666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1291 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 118.10 // Query: BDU21944.1|CBM32|GH92 [L=1136] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-13 36.5 1.4 1.8e-12 34.0 1.4 2.4 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.0 1.4 1.8e-12 1.8e-12 14 123 .. 1019 1130 .. 1007 1131 .. 0.68 Alignments for each domain: == domain 1 score: 34.0 bits; conditional E-value: 1.8e-12 CBM32.hmm 14 aggggaenavDgdpn.trWss.agqwltvdLgkpttvdkvvltw.aen.grikdykvevStDgktWttvaekgnttdgt..tetit 93 +g+ +a++a+ ++++ t s + ++ + L ++++v+ ++lt a+ ++++d+ +e+StDgk+Wt+++++++++ +t+ BDU21944.1|CBM32|GH92 1019 DGDAAAAKAISDNTSdTEASLkN-GEVRLQLPAAQQVQMYTLTSsAKAgSDPSDWVLEGSTDGKHWTVIDKRQGEQF-AwrRQTRA 1102 33345555555554435322221.36*****************6422359*******************98765443.23334667 PP CBM32.hmm 94 fd..kpvtaryvRltvtkratnawgasiaEla 123 f p + y+R v ++a+g+ +aE++ BDU21944.1|CBM32|GH92 1103 FGvaHPGNYSYYRWHV----QGAHGVVVAEIE 1130 777788899***9999....345666677765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1136 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 145.83 // Query: WNG18272.1|CBM32|GH92 [L=1313] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-31 94.5 13.2 1.4e-21 63.4 3.6 3.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.4 3.6 1.4e-21 1.4e-21 6 123 .. 107 231 .. 103 232 .. 0.80 2 ! 35.0 2.0 8.8e-13 8.8e-13 11 122 .. 1194 1307 .. 1185 1309 .. 0.75 Alignments for each domain: == domain 1 score: 63.4 bits; conditional E-value: 1.4e-21 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt 88 + +++ +++++++a+++ Dgd n++W + + w++++L +p v+++ l a+ +++ +++e+S+Dg++Wt +++++n++ + WNG18272.1|CBM32|GH92 107 EVAANGENPPNETADRIADGDVNSKWLTFTstGWVQFKLAQPIAVKRYALSSANdaAeRDPAAWTLEGSQDGTSWTALDQRSNQSFAD 194 44567888898*****************74478******************7334446********************9998877643 PP CBM32.hmm 89 ..te.titfdkpvta.ryvRltvtkratnawgasiaEla 123 ++ t +f++ +ta y+Rl+vt++++++ ++iaEl+ WNG18272.1|CBM32|GH92 195 rfEThTYEFTN-TTAyPYYRLNVTANHSGNI-VQIAELQ 231 46343668885.5666*******77665544.9999985 PP == domain 2 score: 35.0 bits; conditional E-value: 8.8e-13 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag..qwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..t 89 +s++g +++n++D+ tr s + l++ + + ++v+ ++lt + + +++ +++++S+Dg ++tt+++++ +t t WNG18272.1|CBM32|GH92 1194 TSSDG-TNISNLFDDTSATRVSFTAedPVLQYQFASGgRQVTFYTLTS-GtGtVDPTGWTLSGSNDGVNFTTLDQRSAQTF-RwrT 1276 23345.78*******888*9988633556******555*********5.333589******************99886554.2334 PP CBM32.hmm 90 etitfd..kpvtaryvRltvtkratnawgasiaEl 122 +t+ f +p t y+Rl t+a g+s+aE+ WNG18272.1|CBM32|GH92 1277 QTRAFRvaTPGTYAYYRLAL----TGAAGMSLAEV 1307 4445555489999*****99....44678999997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1313 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.65 // Query: BEP45094.1|CBM32|GH92 [L=994] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-14 38.4 6.9 2.5e-13 36.8 5.5 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.0 0.28 0.28 91 109 .. 216 232 .. 195 266 .. 0.67 2 ! 36.8 5.5 2.5e-13 2.5e-13 11 122 .. 871 989 .. 865 991 .. 0.70 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 91 titfdkpvt.aryvRltvtk 109 +it + + a y+R+t+ + BEP45094.1|CBM32|GH92 216 EITPT---DhAAYFRFTAPA 232 33333...227999999933 PP == domain 2 score: 36.8 bits; conditional E-value: 2.5e-13 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag..qwltvdLg..kpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekgnttdgt.. 88 ss+a+ g+ +n+ D + +t W s++ w++ d +p +v k+ ++ ++++++k+ +S+Dg W+t++e++n++ t BEP45094.1|CBM32|GH92 871 SSSAT-GQLANVYDRNSDTAWRSTSanAWIEADAAtgQPASVPKIYTLTsGTqdAgQDPRSWKLKASKDGVAWVTLDERSNES-FTwr 956 34455.79***************86689*999987336677777755544224437*********************998865.5554 PP CBM32.hmm 89 tetitfd.kpvt..aryvRltvtkratnawgasiaEl 122 ++t++f+ k+ t ++R+++ ++t++ + +aE+ BEP45094.1|CBM32|GH92 957 QQTRPFAlKAGTesYSKYRIEF--DNTGT--MTVAEF 989 4577999966662245555555..43433..456776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (994 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.18 // Query: XLM93819.1|CBM32|GH92 [L=1162] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-14 39.3 0.8 3.8e-13 36.2 0.1 2.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.7 0.0 0.85 0.85 96 107 .. 359 370 .. 338 382 .. 0.71 2 ? -0.1 0.1 0.064 0.064 9 35 .. 576 604 .. 569 623 .. 0.70 3 ! 36.2 0.1 3.8e-13 3.8e-13 17 121 .. 1044 1154 .. 1033 1157 .. 0.69 Alignments for each domain: == domain 1 score: -3.7 bits; conditional E-value: 0.85 CBM32.hmm 96 kpvtaryvRltv 107 ++++a y+R+++ XLM93819.1|CBM32|GH92 359 ETARADYYRVRF 370 556799999998 PP == domain 2 score: -0.1 bits; conditional E-value: 0.064 CBM32.hmm 9 ssssaaggggaenavDgd...pntrWssag 35 +++++ag + +++vDg+ +n +W ++ XLM93819.1|CBM32|GH92 576 TGKASAG-ATGAAVVDGKvyvNNGFWDTYR 604 4555566.899******8553345998853 PP == domain 3 score: 36.2 bits; conditional E-value: 3.8e-13 CBM32.hmm 17 ggaenavDgdpn..trWssa.gqwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd 95 +a++++D+d++ tr s l ++++p tv+ ++lt + g+++ + +++S+Dg +Wtt++e++++ ++t+ f+ XLM93819.1|CBM32|GH92 1044 KQAAALFDDDATtsTRLSGPmP-LLSWNFKAPATVRLYTLTS-AaRrGDPQAWALQGSNDGAQWTTLDERSGQVF-AwrKQTRAFA 1126 5799*****9773357777431.4999**************5.2445*********************9876553.3334577888 PP CBM32.hmm 96 ..kpvtaryvRltv..tkratnawgasiaE 121 ++ a y R++ ++ +++ g +aE XLM93819.1|CBM32|GH92 1127 iaEA--AAYSRYRLrlLADGAGQGGIELAE 1154 5333..455555441133334445566666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1162 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 133.79 // Query: XIG22829.1|CBM32|GH92 [L=1153] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-13 36.4 0.2 1.6e-12 34.1 0.0 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.0 0.29 0.29 13 34 .. 572 596 .. 567 611 .. 0.67 2 ! 34.1 0.0 1.6e-12 1.6e-12 17 121 .. 1037 1145 .. 1024 1148 .. 0.72 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 13 aaggggaenavDgd...pntrWssa 34 ++g+ + +++vDg +n +W ++ XIG22829.1|CBM32|GH92 572 SDGERSGARIVDGRvyvNNGFWDTY 596 456688999****744334588885 PP == domain 2 score: 34.1 bits; conditional E-value: 1.6e-12 CBM32.hmm 17 ggaenavDgdpnt..rWssagqwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt.tetitfdkp 97 +a +++D+d++t r + l ++++p tv+ ++lt + + g++ + +++S+Dg++Wtt++e+ +++ + +t+ f+ + XIG22829.1|CBM32|GH92 1037 KQAGALFDDDATTsaRLNAPMPLLAWNFKTPATVRLYTLTS-SdKpGDAAAWALQGSNDGQQWTTLDERRDQDFPWrRQTRAFAIA 1121 568999***99985555553135899**************4.3456*********************9887654333347799977 PP CBM32.hmm 98 vtaryvRltvtkra..tnawgasiaE 121 ++a y R++ r +a g +aE XIG22829.1|CBM32|GH92 1122 APAAYSRYRL--RLagEGAGGIELAE 1145 7888888887..33223334455555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1153 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.58 // Query: BFT27131.1|CBM32|GH92 [L=1401] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-24 71.6 1.6 1.5e-23 69.9 0.4 2.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.9 0.4 1.5e-23 1.5e-23 7 119 .. 94 213 .. 88 218 .. 0.77 2 ? -3.4 0.0 0.68 0.68 36 48 .. 605 617 .. 595 618 .. 0.80 3 ? -3.2 0.0 0.61 0.61 46 65 .. 1186 1209 .. 1167 1233 .. 0.50 Alignments for each domain: == domain 1 score: 69.9 bits; conditional E-value: 1.5e-23 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gt 88 a s+++a++g+ en+vDg p+t+W + + w+++dL+kp +v ++ lt + ++++d+++e+S Dgk+W++v+++++++ g BFT27131.1|CBM32|GH92 94 A-SGENAGAGEVKENLVDGEPGTKWLTFQptGWVEFDLDKPVKVVTYALTSaNDyDeRDPRDWTLEGSADGKDWKPVDTRTDESFaGR 180 3.4555566689***************75567******************8522456**********************998777666 PP CBM32.hmm 89 tetitfd..kpvtaryvRltvtkratnawg.asi 119 et++fd p++ +++Rl+vt ++ +a+g +i BFT27131.1|CBM32|GH92 181 FETRSFDvaRPAEYQHFRLEVTRNN-GAPGvLQI 213 34667776688899*******5532.23333555 PP == domain 2 score: -3.4 bits; conditional E-value: 0.68 CBM32.hmm 36 qwltvdLgkpttv 48 wl +d gk +tv BFT27131.1|CBM32|GH92 605 GWLRFDAGKDRTV 617 59********998 PP == domain 3 score: -3.2 bits; conditional E-value: 0.61 CBM32.hmm 46 ttvdkvvltw..ae.n.grikdyk 65 + v+ v++t a + g ++ ++ BFT27131.1|CBM32|GH92 1186 RPVRPVQYTLtsAAdRtGAPSGWT 1209 233333333332112234444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1401 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 146.98 // Query: XPG67029.1|CBM32|GH92 [L=994] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-13 37.8 7.0 2.4e-13 36.8 4.7 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.7 0.0 0.21 0.21 91 109 .. 216 232 .. 192 269 .. 0.67 2 ! 36.8 4.7 2.4e-13 2.4e-13 11 122 .. 871 989 .. 865 991 .. 0.69 Alignments for each domain: == domain 1 score: -1.7 bits; conditional E-value: 0.21 CBM32.hmm 91 titfdkpvt.aryvRltvtk 109 +it + + a y+R+t+ + XPG67029.1|CBM32|GH92 216 EITPT---DhAAYFRFTAPA 232 33333...227999999933 PP == domain 2 score: 36.8 bits; conditional E-value: 2.4e-13 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag..qwltvdLg..kpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekgnttdgt.. 88 ss+a+ g+ +n+ D + +t W s++ w++ d +p +v k+ ++ ++++++k+ +S+Dg W+t++e++n++ XPG67029.1|CBM32|GH92 871 SSSAA-GQLANVYDRNSDTAWRSTSanAWIEADAAtgQPASVPKIYTLTsGTqdAgQDPRSWKLKASKDGVAWVTLDERSNESF-Awr 956 34455.78***************86689*999987336677777755544224437*********************9988654.343 PP CBM32.hmm 89 tetitfd.kpvt..aryvRltvtkratnawgasiaEl 122 ++t++f+ k+ t ++R+++ ++t++ + +aE+ XPG67029.1|CBM32|GH92 957 QQTRPFAlKAGTesYSKYRIEF--DNTGT--MTVAEF 989 5577999966662245555555..43433..456776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (994 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.31 // Query: XPG54870.1|CBM32|GH92 [L=1009] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-13 35.1 0.8 8.2e-13 35.1 0.8 3.4 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.087 0.087 87 108 .. 236 255 .. 214 273 .. 0.64 2 ? -3.6 0.1 0.82 0.82 24 35 .. 464 475 .. 454 487 .. 0.70 3 ? -0.4 0.6 0.082 0.082 14 35 .. 574 595 .. 564 632 .. 0.77 4 ! 35.1 0.8 8.2e-13 8.2e-13 10 122 .. 881 1001 .. 874 1003 .. 0.70 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.087 CBM32.hmm 87 gttetitfdkpvtaryvRltvt 108 gt ++it ++ a y+R+t+ XPG54870.1|CBM32|GH92 236 GTRTEITPTD--HAAYFRFTAA 255 2212444432..389****993 PP == domain 2 score: -3.6 bits; conditional E-value: 0.82 CBM32.hmm 24 DgdpntrWssag 35 Dg +trW+s g XPG54870.1|CBM32|GH92 464 DGGWTTRWASPG 475 665568999863 PP == domain 3 score: -0.4 bits; conditional E-value: 0.082 CBM32.hmm 14 aggggaenavDgdpntrWssag 35 ++ g +n++Dg + W+ ++ XPG54870.1|CBM32|GH92 574 NSATGYANIFDGASTGTWAGGW 595 3446789*****6554888753 PP == domain 4 score: 35.1 bits; conditional E-value: 8.2e-13 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag..qwltv.dLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt. 88 s++a+++ g +n++D t Wss+ w++ g++++v ++lt + + +++ +++ +S+Dg +Wtt+++++++ XPG54870.1|CBM32|GH92 881 STTASNTTGLKNLNDRTSLTEWSSGAgaAWIQGsTAGTARKVAIYTLTS-SskTgQDPAGWTLKGSNDGIDWTTLDTRQGEV-FAw 964 444556689*******6559****8458899761566889999999996.23446********************9987543.333 PP CBM32.hmm 89 teti.tfd..kpvtaryvRltvtkratnawgasiaEl 122 +++ +f +p +Rl++ + + ++s++E+ XPG54870.1|CBM32|GH92 965 RRQVrPFVvkAPGAYSTYRLEIGGGVGGGGAVSLSEF 1001 2344466654555458899999433233345888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1009 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 118.23 // Query: XCH29048.1|CBM0|CBM32|GH92 [L=1806] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-28 85.8 30.6 4.6e-22 65.0 2.3 5.7 7 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.0 2.3 4.6e-22 4.6e-22 8 112 .. 102 215 .. 97 228 .. 0.77 2 ? -3.7 0.0 0.87 0.87 24 54 .. 355 379 .. 336 392 .. 0.60 3 ? -2.4 0.0 0.33 0.33 61 83 .. 646 666 .. 613 683 .. 0.67 4 ! 3.0 0.1 0.0072 0.0072 5 34 .. 721 752 .. 717 770 .. 0.72 5 ? -1.4 0.0 0.17 0.17 10 32 .. 1107 1129 .. 1102 1147 .. 0.63 6 ! 32.6 4.2 4.9e-12 4.9e-12 13 122 .. 1190 1305 .. 1177 1307 .. 0.70 7 ? -0.9 0.2 0.11 0.11 18 81 .. 1665 1736 .. 1653 1771 .. 0.57 Alignments for each domain: == domain 1 score: 65.0 bits; conditional E-value: 4.6e-22 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgntt 85 ++s+++ +++ga+n+ Dg+ +t+W + w+ +++ +p ++ ++++t + +++k++++e+S+Dg+tWt+++++++++ XCH29048.1|CBM0|CBM32|GH92 102 TASAQNLPNEGAANLADGSSGTKWLAFAstGWVRYEFTEPVSFVAYSMTSgDDaAgRDPKTWTIEGSNDGSTWTPLDQRTDED 184 3344556669****************63367******************7522446*********************998876 PP CBM32.hmm 86 d.gtte..titfdkpvta.ryvRltvtkrat 112 + ++ ++++d+p++a +y+Rl+vt+++ XCH29048.1|CBM0|CBM32|GH92 185 FpNRQQtrSFELDEPTEAyTYLRLNVTANSG 215 6555432255666999999*******66442 PP == domain 2 score: -3.7 bits; conditional E-value: 0.87 CBM32.hmm 24 DgdpntrWssagqwltvdLgkp...ttvdkvvlt 54 D W s + +dLg + +tvd+v l XCH29048.1|CBM0|CBM32|GH92 355 DQ-----WNS----VRIDLGDVaagKTVDQVLLG 379 33.....544....89999966223466666665 PP == domain 3 score: -2.4 bits; conditional E-value: 0.33 CBM32.hmm 61 ikdykvevStDgktWttvaekgn 83 k+ ++ev gkt+t+v++ + XCH29048.1|CBM0|CBM32|GH92 646 RKNLDLEVT--GKTFTEVKAAAA 666 456667766..999999965433 PP == domain 4 score: 3.0 bits; conditional E-value: 0.0072 CBM32.hmm 5 ssaessssaaggggaenavDgd...pntrWssa 34 sa+++s++++ ++ +++vDg+ +n +W ++ XCH29048.1|CBM0|CBM32|GH92 721 VSATTGSATDT-QTNAKIVDGKiyvNNGFWDTY 752 57777788777.99*******954334599885 PP == domain 5 score: -1.4 bits; conditional E-value: 0.17 CBM32.hmm 10 sssaaggggaenavDgdpntrWs 32 ++s ++ + + avDg ++t s XCH29048.1|CBM0|CBM32|GH92 1107 NNSVDNVYVQSLAVDGEARTSTS 1129 34445559999*****8876433 PP == domain 6 score: 32.6 bits; conditional E-value: 4.9e-12 CBM32.hmm 13 aaggggaenavDgdpntr..WssagqwltvdLgkpt.tvdkvvltw.aen.grikdykvevStDgktWttvaekgnttdgt 88 +a+ +a++++D+ +tr +++++ ++t ++ + tv +++lt a++ ++ +++e+S+Dg+tWtt++e+++++ XCH29048.1|CBM0|CBM32|GH92 1190 DAA-TSAAALTDNTSGTRttFATTTPSITWAGNGIRpTVESYTLTSgASGtASPSAWTLEGSDDGETWTTLDERSGEQ-FR 1268 333.6799999997766511444324577777777569*******65224599******************9987644.33 PP CBM32.hmm 89 ..tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 +t++f+ +p+ +R+tvt+ + ++ + s+aE+ XCH29048.1|CBM0|CBM32|GH92 1269 waLQTRPFTvaEPTAFAQYRVTVTAAS-GSGALSLAEV 1305 3334668887688755*******5544.3455899997 PP == domain 7 score: -0.9 bits; conditional E-value: 0.11 CBM32.hmm 18 gaenavDgdpn..trWssag...qwltvdLgkpttvdkvvltw.aen.grikdykvevS.tDgktWttvaek 81 +a ++Dg+ + +++ag +++vd g + +v +v +t +++ + + d++v++ gk ++ v ++ XCH29048.1|CBM0|CBM32|GH92 1665 AAGTVTDGSVSgaHAYAAAGtytAYVVVDDGWTSQVVEVPVTVtEGQpQLAIDVTVSTRcLAGKAYVAVRAE 1736 466667776553223444322455677777777777777666532223444444444444456777666433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1806 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 134.59 // Query: WXA09423.1|CBM32|GH92 [L=1284] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-28 86.5 11.5 7.3e-22 64.4 1.5 3.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.4 1.5 7.3e-22 7.3e-22 7 122 .. 100 221 .. 94 223 .. 0.75 2 ? 1.5 0.2 0.021 0.021 8 43 .. 723 761 .. 716 823 .. 0.75 3 ! 25.4 0.2 8.2e-10 8.2e-10 39 109 .. 1197 1273 .. 1176 1282 .. 0.71 Alignments for each domain: == domain 1 score: 64.4 bits; conditional E-value: 7.3e-22 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt 88 a s+++a++g+ en+vDg +++W + + wl++dL +p + ++ lt a+ + +++kd+++ +S +g++Wtt++++++++ + WXA09423.1|CBM32|GH92 100 A-SGENASAGEIKENLVDGEVTSKWLTFDttAWLEFDLSEPVEAVRYALTSANdaPgRDPKDWTLKGSANGSDWTTLDSRADQKFsSR 186 4.3444455589*******999*****74478*********8888888886334557*********************9998776344 PP CBM32.hmm 89 te..titfdkpvta.ryvRltvtkratnawgasiaEl 122 ++ ++tfd+ ta r++Rl++t +a ++ ++aE+ WXA09423.1|CBM32|GH92 187 QQtrEFTFDN-GTAyRHFRLEITRNAGDDL-LQLAEV 221 3323557774.5566*******76554334.777776 PP == domain 2 score: 1.5 bits; conditional E-value: 0.021 CBM32.hmm 8 essssaaggggaenavDgd...pntrWssag.qwltvdLg 43 ++++++++ + +++vDg+ +n +W ++ +w + L WXA09423.1|CBM32|GH92 723 AAGKNTPT-RTGAKIVDGKvyvNNGFWDTYRtTWPAYSLL 761 34455555.8999*****8553346999964456555554 PP == domain 3 score: 25.4 bits; conditional E-value: 8.2e-10 CBM32.hmm 39 tvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..kpvtaryvRltvtk 109 vdL ++ ++v++t ++ + ++ + +++S Dg++W++++ +++++ t +t+ f+ +p t ++Rl++ + WXA09423.1|CBM32|GH92 1197 SVDLPVTKAGRAVQYTLtSSdRsKAPTGWVLQGSRDGESWKDLDRRSGES-FTwdRQTRVFSvhTPGTYEHYRLVADG 1273 6999999999******974344699******************9876644.444333446665599999*****9933 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1284 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 133.09 // Query: XQL96380.1|CBM32|GH92 [L=887] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-07 16.6 0.0 9.5e-07 15.5 0.0 1.6 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 15.5 0.0 9.5e-07 9.5e-07 42 107 .. 801 871 .. 771 885 .. 0.63 Alignments for each domain: == domain 1 score: 15.5 bits; conditional E-value: 9.5e-07 CBM32.hmm 42 Lgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..kpvtaryvRltv 107 Lg++ + + ++lt + + g++ +++e+S Dg++W ++e++++ +t++f+ +p + ++ Rl+v XQL96380.1|CBM32|GH92 801 LGEALQARFLTLTS-SaaTgGDPIAWRLEGSRDGQHWDLLDERAGQR-FRwrRQTRPFEiaSPRPCTHHRLVV 871 34444455555553.234469*******************9987754.3343346688877888889999988 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (887 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 134.10 // Query: XSC32809.1|CBM0|CBM32|GH92 [L=1840] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-29 88.2 18.0 2.5e-20 59.4 3.1 4.7 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.4 3.1 2.5e-20 2.5e-20 6 111 .. 70 183 .. 66 206 .. 0.80 2 ? 1.6 0.0 0.02 0.02 6 34 .. 680 710 .. 675 728 .. 0.70 3 ! 33.3 1.7 3e-12 3e-12 12 122 .. 1142 1258 .. 1139 1260 .. 0.68 4 ? -2.3 0.1 0.32 0.32 15 48 .. 1673 1703 .. 1666 1707 .. 0.69 Alignments for each domain: == domain 1 score: 59.4 bits; conditional E-value: 2.5e-20 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgn 83 + ++s+++++++ a+++ Dg+p+t+W + + w ++ L++p v +++lt a+ + ++++d++v++StDg++W++++ +++ XSC32809.1|CBM0|CBM32|GH92 70 AVTASAENPPNEIAARLADGNPSTKWLAFNptGWAVYQLKAPAAVVQYSLTSANdaPsRDPRDFTVQGSTDGSQWVDLDRRTG 152 4455677888899***************75567******************7334547*********************9998 PP CBM32.hmm 84 ttd.gt..tetitfdkpvta.ryvRltvtkra 111 +t g t+t +f++ +ta ++Rl+vt+++ XSC32809.1|CBM0|CBM32|GH92 153 QTFsGRfaTNTYSFTN-TTAyGFYRLNVTANS 183 8876667545779985.5565*******7644 PP == domain 2 score: 1.6 bits; conditional E-value: 0.02 CBM32.hmm 6 saessssaaggggaenavDgd...pntrWssa 34 sa ++ss+++ ++ +++vDg +n +W ++ XSC32809.1|CBM0|CBM32|GH92 680 SAPTGSSTPT-NTGAKLVDGLiyvNNGFWDTY 710 6666777777.9********633234588875 PP == domain 3 score: 33.3 bits; conditional E-value: 3e-12 CBM32.hmm 12 saaggggaenavDgdpntrWssag..qw..ltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttd 86 +a+gg++a++++D+ t a+ + + gk+ + + +++t + n g++ d+k+++S Dg +Wttv++++++ XSC32809.1|CBM0|CBM32|GH92 1142 TATGGQDASKLFDDTSATQMTFATgtPQigWAYRSGKQ-KPTYYTITS-GaNpGDPADWKLQGSRDGVSWTTVDSRKDEVF 1220 3456689******9777754443123230134555554.556666773.3456*********************9887554 PP CBM32.hmm 87 .gttetitfd..kpvtaryvRltvtkratnawgasiaEl 122 + ++t++f+ p + + +Rl+vtk+ + +++aE+ XSC32809.1|CBM0|CBM32|GH92 1221 tYRNQTRPFQvgHPGKFTQFRLVVTKTVGG-AQTNLAEI 1258 33356889999999999*******775433.33667775 PP == domain 4 score: -2.3 bits; conditional E-value: 0.32 CBM32.hmm 15 ggggaenavDgdpntrWssagqwltvdLgkp.ttv 48 +++ + avDg t + ++ +++ v+Lg+ tv XSC32809.1|CBM0|CBM32|GH92 1673 RTSSSAVAVDG---TGFTAG-EQVSVKLGTDdVTV 1703 44677889999...766665.35999999653555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1840 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 168.44 // Query: XDS31318.1|CBM32|GH92 [L=1282] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-28 84.9 12.7 2.9e-22 65.6 3.1 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.6 3.1 2.9e-22 2.9e-22 4 111 .. 93 207 .. 90 220 .. 0.75 2 ? -0.1 0.1 0.068 0.068 14 37 .. 719 746 .. 712 811 .. 0.76 3 ! 23.5 0.2 3.2e-09 3.2e-09 19 109 .. 1178 1270 .. 1163 1280 .. 0.70 Alignments for each domain: == domain 1 score: 65.6 bits; conditional E-value: 2.9e-22 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd 86 a a++++ +++g+ en+vDg+p+t+W + wl++dL++p +v ++ lt a+ ++++d+++ +S Dg+tWtt+++++++t XDS31318.1|CBM32|GH92 93 AVRASAEN-DGSGEVKENLVDGQPSTKWLAFAptAWLEFDLDSPVKVVTYALTSANdaApRDPRDWTLKGSADGTTWTTLDTRSGETF 179 44444344.455599***************75578******************7334547*********************9887665 PP CBM32.hmm 87 .gt.te.titfdkpvta.ryvRltvtkra 111 + ++ + +f++ ta ++Rl++t ++ XDS31318.1|CBM32|GH92 180 aSRfQTkSYDFANS-TAyAHYRLEITRNS 207 33353325577754.455*******6643 PP == domain 2 score: -0.1 bits; conditional E-value: 0.068 CBM32.hmm 14 aggggaenavDgd...pntrWssag.qw 37 +++ + +++vDg+ +n +W ++ +w XDS31318.1|CBM32|GH92 719 TPTRTGAKIVDGKvyvNNGFWDTYRtTW 746 4457889999998553345898853345 PP == domain 3 score: 23.5 bits; conditional E-value: 3.2e-09 CBM32.hmm 19 aenavDgdpntrWssagqwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd..kpvt 99 a ++D+ +t s ++ ++ L ++t+ +++lt + + ++ + +++S+Dg++W++++++++++ +++t+ f+ p + XDS31318.1|CBM32|GH92 1178 AGPLFDNTSSTAASFDS--AELPLASATRAAQYTLTS-SdRtKAPTGWVLQGSSDGTKWVDLDKRSGESFaWDKQTRVFSvaRPGS 1260 55577876666544444..899999***********5.344599******************987765433333444555337777 PP CBM32.hmm 100 aryvRltvtk 109 ++Rl+ t+ XDS31318.1|CBM32|GH92 1261 YGHYRLVSTS 1270 7888888744 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1282 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 136.96 // Query: BFO16419.1|CBM32|GH92 [L=623] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-09 23.1 3.3 4.4e-08 19.8 0.1 3.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.8 0.1 4.4e-08 4.4e-08 63 112 .. 2 55 .. 1 67 [. 0.70 2 ? -3.3 0.0 0.66 0.66 21 48 .. 440 463 .. 434 465 .. 0.63 3 ! 2.7 0.3 0.0091 0.0091 12 37 .. 556 585 .. 547 618 .. 0.73 Alignments for each domain: == domain 1 score: 19.8 bits; conditional E-value: 4.4e-08 CBM32.hmm 63 dykvevStDgktWttvaekgnttdgt..te.titfdkpvtaryvRltvtkra.t 112 d+++ +S Dg++W+t++++++++ g+ ++ t +++++++ ++ Rl +t ++ + BFO16419.1|CBM32|GH92 2 DWTLKGSADGENWQTLDTRSGESFGErfQTkTYDLAETAEFKHWRLDFTRNNgA 55 799**************987665555453325566677888*******665432 PP == domain 2 score: -3.3 bits; conditional E-value: 0.66 CBM32.hmm 21 navDgdpntrWssagqwltvdLgkpttv 48 +++Dg +n + l +d gk +tv BFO16419.1|CBM32|GH92 440 KVTDGAAN-GVKG---HLRFDAGKDRTV 463 66677322.2222...389999999888 PP == domain 3 score: 2.7 bits; conditional E-value: 0.0091 CBM32.hmm 12 saaggggaenavDgd...pntrWssag.qw 37 +++++++ +++vDg+ +n +W ++ +w BFO16419.1|CBM32|GH92 556 ADTPTHTGAKIVDGKvyvNNGFWDTYRtTW 585 3455599*******8553346999863344 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (623 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 109.69 // Query: WFE54570.1|CBM32|GH92 [L=1870] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-27 81.9 28.3 1.9e-20 59.8 6.0 5.2 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.8 6.0 1.9e-20 1.9e-20 5 111 .. 90 204 .. 87 221 .. 0.78 2 ? -2.0 0.0 0.25 0.25 36 72 .. 346 387 .. 314 428 .. 0.70 3 ? 0.2 0.1 0.053 0.053 6 34 .. 701 731 .. 696 747 .. 0.70 4 ! 33.0 2.4 3.6e-12 3.6e-12 12 122 .. 1163 1279 .. 1159 1281 .. 0.71 5 ? -0.5 0.6 0.09 0.09 21 79 .. 1704 1758 .. 1626 1831 .. 0.65 Alignments for each domain: == domain 1 score: 59.8 bits; conditional E-value: 1.9e-20 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd. 86 s+ ++s+++++ + a+n+ D+d +t+W + w+t+ + +p tv++++lt a+ + +++kd+ v++StDg++Wt+++++++++ WFE54570.1|CBM32|GH92 90 SAVTASDEYQPREIAANLADDDSSTKWLVFQttGWVTYRFAEPVTVKRYSLTSANdaPsRDPKDFVVQGSTDGTSWTDLDKRSGEKFg 177 45566788899999**************974467******************7334547********************998776664 PP CBM32.hmm 87 gt..tetitfdkpvta.ryvRltvtkra 111 g t++ +++ ++ta y+Rl+vt+++ WFE54570.1|CBM32|GH92 178 GRfaTNRYSVT-NTTAyAYYRLNVTANS 204 55533333555.45666*******7754 PP == domain 2 score: -2.0 bits; conditional E-value: 0.25 CBM32.hmm 36 qw..ltvdLgkpt...tvdkvvltwae.n.grikdykvevStDg 72 qw ++ dLg++ t+d++ l + n + + d +++++ D+ WFE54570.1|CBM32|GH92 346 QWnlVQADLGTVArgkTIDRILLA--YdNpQATGDTQFQGWLDD 387 566689999987434488888888..333366677777766654 PP == domain 3 score: 0.2 bits; conditional E-value: 0.053 CBM32.hmm 6 saessssaaggggaenavDgd...pntrWssa 34 sa +++s+++ ++ +++vDg+ +n +W ++ WFE54570.1|CBM32|GH92 701 SAPTGASTPT-QTGAKIVDGQiyvNNGFWDTY 731 5554555555.99*******844334599885 PP == domain 4 score: 33.0 bits; conditional E-value: 3.6e-12 CBM32.hmm 12 saaggggaenavDgdpnt..rWssag.qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..te 90 +a+gg++a++++D++ +t ++sa+ q d g+ ++ + +++t + g++ d+++++S+Dg tWttv++++++ ++ WFE54570.1|CBM32|GH92 1163 TATGGQDASKLFDDSSTTqlTFASATpQITWADRGGKQKPTYYTVTS-GaAaGDPADWRLQGSNDGLTWTTVDSRSDQVF-RwrNQ 1246 3456689*******9887444555445444569*************5.33359********************9987654.34444 PP CBM32.hmm 91 titfd..kpvtaryvRltvtkratnawgasiaEl 122 t++++ kp + +Rl vtk+ +a +++aE+ WFE54570.1|CBM32|GH92 1247 TRPYSidKPGRFAQFRLAVTKTV-GAAQTNLAEI 1279 55555448887777888886643.3344666665 PP == domain 5 score: -0.5 bits; conditional E-value: 0.09 CBM32.hmm 21 navDgdpntrWssagqwltvdLg.kpttvdkvvltwaengrikdykvevStDgk..tWttva 79 +vDg + ++++ +++tv g p + +kv a + +++v +S+D + + + a WFE54570.1|CBM32|GH92 1704 ITVDG---SGFAAG-EQVTVSVGtDPSRTTKVAAS-A--KGTVRVSVPTSDDAQpgRYAVTA 1758 33333...222222.12444444333344444333.1..22444444444442211344333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1870 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 123.68 // Query: XKD75420.1|CBM32 [L=457] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-20 59.9 2.5 1.8e-20 59.9 2.5 1.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.0 0.53 0.53 45 67 .. 172 199 .. 168 234 .. 0.53 2 ! 59.9 2.5 1.8e-20 1.8e-20 10 121 .. 331 450 .. 321 453 .. 0.76 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.53 CBM32.hmm 45 pttvdkvvltwae.....n.grikdykve 67 + +++ v++t + + ++ ++y+v XKD75420.1|CBM32 172 EEDIHYVSITN-GggtvlEvRNRRNYNVT 199 56667777763.12233334444444443 PP == domain 2 score: 59.9 bits; conditional E-value: 1.8e-20 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag....qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt..teti 92 +s+a+ ++a++++D+++nt++ g w+++ + +p+ + ++++t a+ ++ kd+++++S+Dg+ W t+++++++t + t++ XKD75420.1|CBM32 331 DNSNAN-ENAAKLIDNNINTKFLQPGfvgsSWFQLTFSEPQLIGAYTITSANdaAdRDLKDWNLQGSDDGSIWITLDTRAGETFaNRflTKRY 422 455566.89***********98886445688******************7334546*********************9988777566644455 PP CBM32.hmm 93 tfdkpvta.ryvRltvtkratnawg.asiaE 121 +f++ ++a +y+Rl+vt+++ g ++aE XKD75420.1|CBM32 423 DFET-AKAyKYYRLNVTNNN--GSGvIQLAE 450 7774.5666*******5432..222255555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (457 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.90 // Query: WNG30111.1|CBM32|GH92 [L=895] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-19 55.6 2.6 1.8e-18 53.4 2.6 2.2 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.4 2.6 1.8e-18 1.8e-18 7 121 .. 768 889 .. 763 892 .. 0.75 Alignments for each domain: == domain 1 score: 53.4 bits; conditional E-value: 1.8e-18 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLg.kpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt 88 a s+++a++g+ga+ +D+d t+W + + w+ + L +++tv+ ++lt a+ + ++++++++++S+Dg+tW+t++++++++ + WNG30111.1|CBM32|GH92 768 A-SADNAGSGEGAAQGFDDDSLTKWLAFQstPWIRYQLSgGAKTVKMYTLTSANdfPgRDPRSWSLQASNDGSTWVTLDTRTGQDFPW 854 3.3455566699*******988*****75579******9788*********7334657*********************998764433 PP CBM32.hmm 89 .tetitfd..kpvta.ryvRltvtkratnawgasiaE 121 +t+ f+ +++ a +Rl++++++ + +++aE WNG30111.1|CBM32|GH92 855 rYQTRAFAvnNNT-AySQYRLQINETHG-DSITQLAE 889 3235566663555.44*******55432.23356666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (895 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 162.39 // Query: XPG60717.1|CBM32|GH92 [L=961] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-13 35.0 2.7 8.8e-13 35.0 2.7 3.3 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.9 0.0 0.11 0.11 87 109 .. 192 212 .. 172 227 .. 0.64 2 ? -4.0 0.1 1 1 24 35 .. 419 430 .. 414 442 .. 0.70 3 ? -0.9 0.6 0.12 0.12 15 34 .. 530 549 .. 521 586 .. 0.76 4 ! 35.0 2.7 8.8e-13 8.8e-13 10 122 .. 837 953 .. 830 955 .. 0.70 Alignments for each domain: == domain 1 score: -0.9 bits; conditional E-value: 0.11 CBM32.hmm 87 gttetitfdkpvtaryvRltvtk 109 gt ++it ++ a y+R+t+ + XPG60717.1|CBM32|GH92 192 GTRTEITPTD--HAAYFRFTAAA 212 2212444332..389****9933 PP == domain 2 score: -4.0 bits; conditional E-value: 1 CBM32.hmm 24 DgdpntrWssag 35 Dg +trW+s g XPG60717.1|CBM32|GH92 419 DGGWTTRWASPG 430 665569999963 PP == domain 3 score: -0.9 bits; conditional E-value: 0.12 CBM32.hmm 15 ggggaenavDgdpntrWssa 34 + g +n++Dg + W + XPG60717.1|CBM32|GH92 530 SATGYANIFDGTSTGTWTGG 549 335679*****544367664 PP == domain 4 score: 35.0 bits; conditional E-value: 8.8e-13 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag...qwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt.te 90 ++ a++ g +n++D t Wss++ w++ +++tv ++lt ++ + +++ +++ +S+Dg +Wtt+++++++ + XPG60717.1|CBM32|GH92 837 TT-ASNATGLKNLNDRTSLTEWSSGTsgaAWIQGSTAtTARTVAIYTLTSSNkTgQDPAGWTLKGSNDGINWTTLDTRQGEV-FAwRR 922 33.334478*******6559****8556899998888455888888888533447********************9987543.33323 PP CBM32.hmm 91 ti.tfd..kpvtaryvRltvtkratnawgasiaEl 122 ++ +f +p +Rl++ +++ ++s++E+ XPG60717.1|CBM32|GH92 923 QVrPFVvkTPGAYSSYRLEI----AGSGAVSLSEF 953 44466654555458999999....33344788887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (961 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 130.97 // Query: WIX76281.1|CBM0|CBM32|GH92 [L=1435] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-35 106.9 15.3 3.2e-22 65.5 1.6 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.5 1.6 3.2e-22 3.2e-22 3 112 .. 86 203 .. 84 214 .. 0.76 2 ? 1.8 0.2 0.017 0.017 7 37 .. 712 745 .. 706 781 .. 0.68 3 ! 46.5 1.5 2.4e-16 2.4e-16 12 123 .. 1178 1290 .. 1171 1291 .. 0.76 Alignments for each domain: == domain 1 score: 65.5 bits; conditional E-value: 3.2e-22 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvae 80 t++sa ss++++gg+ +n+ Dg ++t+W s++ w ++ L +p ++++ lt a+ + ++++d+++++S+D ++Wt++++ WIX76281.1|CBM0|CBM32|GH92 86 TEASA-SSENTDGGEVSANLADGATDTKWLSWEptAWAQLTLSEPVAITHYALTSANdfPgRDPQDWTLQGSNDAQQWTDLDK 167 55666.466677779****************96789******************7334657********************98 PP CBM32.hmm 81 kgnttdgt...te.titfdkpvta.ryvRltvtkrat 112 +++++ + +e + ++++p a ry+Rl vt ++ WIX76281.1|CBM0|CBM32|GH92 168 QSGQSF-DarfQEhQYKLAAPSAAyRYYRLDVTRNHG 203 777654.234644455666555566*******66433 PP == domain 2 score: 1.8 bits; conditional E-value: 0.017 CBM32.hmm 7 aessssaaggggaenavDgd...pntrWssag.qw 37 a++++++a+ ++ +++vDg+ +n +W ++ +w WIX76281.1|CBM0|CBM32|GH92 712 AKAGADTAT-QTGSKIVDGQiyvNNGFWDTYRtTW 745 444555556.899******8543345999963334 PP == domain 3 score: 46.5 bits; conditional E-value: 2.4e-16 CBM32.hmm 12 saaggggaenavDgdpntrWssagqwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt. 88 +++g ++a++++D++ +t + +g +t+ L+++ v++++lt + g++k++++e+S DgktW ++++++++t + WIX76281.1|CBM0|CBM32|GH92 1178 TSHG-SSAAALIDNSSRTEAKVTG-AVTYQLNSTdEAVTHYTLTS-PkGaGDPKSWQLEGSYDGKTWAVADQQTGQTFPWr 1255 3345.88*******6555433333.6******7769********4.34469*****************8888877665333 PP CBM32.hmm 89 tetitfd..kpvtaryvRltvtkratnawgasiaEla 123 ++t+ f+ +p+ y+Rltvt++ t+ + as+aE++ WIX76281.1|CBM0|CBM32|GH92 1256 QQTRAFAvaNPAHYAYYRLTVTDS-TGGP-ASLAEFE 1290 45778887799999*******553.4345.99***95 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1435 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.55 // Query: WXB15735.1|CBM32|GH92 [L=1283] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-29 88.7 11.7 3.6e-20 58.9 1.0 3.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.9 1.0 3.6e-20 3.6e-20 5 123 .. 68 192 .. 64 193 .. 0.78 2 ? -1.2 0.0 0.15 0.15 16 46 .. 702 736 .. 694 755 .. 0.75 3 ! 34.8 1.4 1e-12 1e-12 13 111 .. 1162 1269 .. 1149 1280 .. 0.70 Alignments for each domain: == domain 1 score: 58.9 bits; conditional E-value: 3.6e-20 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd. 86 +a++++++ag + a+n+ Dgd +++W + + w+ ++L +p + ++ l a+ + +++kd+++++S Dg tW++++ +++++ WXB15735.1|CBM32|GH92 68 VTASKEHTSAG-EIADNLSDGDVRSKWLAFEstGWVAYKLAAPVAIVRYALASANdaPeRDPKDWTFQGSHDGDTWVDLDRRTDQSFg 154 44443444455.99***************74467******************7334547*********************99998876 PP CBM32.hmm 87 gt..tetitfdkpvta.ryvRltvtkratnawgasiaEla 123 g t++++f+ ++ta ++Rl++t++++++ +++aEl+ WXB15735.1|CBM32|GH92 155 GRfeTRQFEFT-NTTAyLHYRLKITANHSGNI-VQLAELQ 192 66633466776.56666*******77655444.8999875 PP == domain 2 score: -1.2 bits; conditional E-value: 0.15 CBM32.hmm 16 gggaenavDgd...pntrWssag.qwltvdLgkpt 46 g++ +vDg+ +n +W ++ +w + L +p WXB15735.1|CBM32|GH92 702 AGAPPTVVDGKvyvNNGFWDTYRsTWAAYALLTPS 736 5678899***8553456999975568877776665 PP == domain 3 score: 34.8 bits; conditional E-value: 1e-12 CBM32.hmm 13 aaggggaenavDgdpnt...rWssagqwltvdLgkpttvdkvvltwae...n.grikdykvevStDgktWttvaekgnttdgt..t 89 ++ + ++++D++ t ++sa+ w++ + + +v+ ++lt + g+++d+ +e+S+Dg+ Wt+++ ++ +t WXB15735.1|CBM32|GH92 1162 GDA-TDVARLFDDSSATapvVFASATPWVQCKTAGGERVRFYSLTS-SkdaAgGDPTDWVLEGSSDGTAWTPLDPRTAQTF-AwrS 1244 222.4599*****888855435554379*****************7.224446********************99886654.2333 PP CBM32.hmm 90 etitfd...kpvtaryvRltvtkra 111 +t+ f+ + +t +y+R+++t ++ WXB15735.1|CBM32|GH92 1245 QTRAFKvpdTGATYTYYRIRITRST 1269 44455554766678*******6533 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1283 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 118.92 // Query: XUZ86414.1|CBM32|GH92 [L=1284] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-26 78.5 8.2 3.3e-19 55.8 0.4 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 55.8 0.4 3.3e-19 3.3e-19 9 122 .. 101 221 .. 94 223 .. 0.76 2 ? 1.0 0.1 0.029 0.029 9 40 .. 724 758 .. 717 786 .. 0.71 3 ! 24.2 0.2 1.9e-09 1.9e-09 18 107 .. 1180 1271 .. 1173 1281 .. 0.71 Alignments for each domain: == domain 1 score: 55.8 bits; conditional E-value: 3.3e-19 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.te 90 s+++a+gg++ en+vDg +++W + wl+++ +p + ++ lt a+ + +++kd+++ +S Dg++Wt +++++++t g+ ++ XUZ86414.1|CBM32|GH92 101 SGENASGGETKENLVDGELTSKWLVFEktAWLEFEVSEPVKAVRYALTSANdaPgRDPKDWTLKGSADGSHWTALDSREGETFGSrQQ 188 4566777899**************975578********97777777775335557*********************988766655433 PP CBM32.hmm 91 ..titfdkpvtaryvRltvtkratnawgasiaEl 122 ++ fd+ + r++Rl++t +a ++ +++aE+ XUZ86414.1|CBM32|GH92 189 trEFGFDNSTGYRHFRLEITRNAGDDL-VQLAEV 221 125566655556*******77554344.888887 PP == domain 2 score: 1.0 bits; conditional E-value: 0.029 CBM32.hmm 9 ssssaaggggaenavDgd...pntrWssag.qwltv 40 ++++ +++ + +++vDg+ +n +W ++ +w + XUZ86414.1|CBM32|GH92 724 TGEN-TPTRTGAKIVDGKvyvNNGFWDTYRtTWPAY 758 3444.445899******9553446999964445444 PP == domain 3 score: 24.2 bits; conditional E-value: 1.9e-09 CBM32.hmm 18 gaenavDgdpntrWssagqwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..k 96 g ++++D+ +t+ + vdL ++v++t + + + ++ +++++S Dg +W++++ +++++ t +t+ f+ + XUZ86414.1|CBM32|GH92 1180 GGTALLDDTSGTHTAF----TSVDLPVKDPGRAVQYTLtSAdRgDAPSGWTLQGSADGAHWKDLDRRSDQS-FTwdRQTRVFSvrA 1260 5667788855566554....4799999999999999987334469*******************9888765.44433355666446 PP CBM32.hmm 97 pvtaryvRltv 107 p + ++Rl++ XUZ86414.1|CBM32|GH92 1261 PGRYGHYRLVA 1271 66556677766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1284 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 135.96 // Query: CAM1111097.1|CBM32|GH92 [L=1152] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-08 20.5 0.0 7.1e-08 19.2 0.0 1.7 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.2 0.0 7.1e-08 7.1e-08 22 124 .] 1029 1137 .. 1019 1137 .. 0.69 Alignments for each domain: == domain 1 score: 19.2 bits; conditional E-value: 7.1e-08 CBM32.hmm 22 avDgdpnt.rWssag.qwltvdLg.kpttvdkvvltw.aen.grikdykvevStDgktWttvaekgnttdgt..tetitfd..k 96 + Dgd+ t ++ ++ v + ++++v ++lt a + + d+++++S Dg+ W++++ + ++ ++ + f + CAM1111097.1|CBM32|GH92 1029 LADGDAATsSVLDGShPTIDVHFTdGARRVLMYTLTSaA-TgHGPGDWQLQGSRDGSRWHVLDRRHGEA-FRwpQQLRAFGvtE 1110 668877762333322445999998788999999999651.3367******************9876543.33533433666558 PP CBM32.hmm 97 pvtaryvRltvtkra.tnawgasiaElae 124 p + y+Rl++ ++ ++a +++++E+++ CAM1111097.1|CBM32|GH92 1111 PGDYIYYRLRI--DNgNDAGPVALSEIQW 1137 88899999999..5533344488888875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1152 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.10 // Query: WRQ80518.1|CBM32|GH92 [L=1284] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-24 73.3 1.4 5.3e-18 51.9 0.7 3.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.9 0.7 5.3e-18 5.3e-18 10 109 .. 102 213 .. 96 229 .. 0.75 2 ! 18.5 0.0 1.2e-07 1.2e-07 49 97 .. 1208 1260 .. 1202 1281 .. 0.65 Alignments for each domain: == domain 1 score: 51.9 bits; conditional E-value: 5.3e-18 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt...t 89 ++++++g++ en+vD +p+t+W + w+++d ++p +v ++ lt a+ +++ d+++ +S Dgk Wt+++++++++ + t WRQ80518.1|CBM32|GH92 102 GENTGAGETKENLVDLQPSTKWLTFAptAWIEFDTDEPIEVARYALTSANdfAgRDPADWTLKGSADGKRWTVLDTRKGESFAKrfeT 189 455666699***************75578******************7334546********************99876554334542 PP CBM32.hmm 90 etitfd......kpvtaryvRltvtk 109 +t+d +p++ ++Rl++ WRQ80518.1|CBM32|GH92 190 --KTYDvaagtaEPTPYAHYRLEIAR 213 ..233322455788888999999922 PP == domain 2 score: 18.5 bits; conditional E-value: 1.2e-07 CBM32.hmm 49 dkvvltwae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd..kp 97 +++lt + + ++ +++++S Dg+ W+t++ +++++ + +t+ f+ p WRQ80518.1|CBM32|GH92 1208 VQYTLTS-SaAaQAPSGWTLQGSLDGTAWKTLDRRSGESFaWDRQTRAFTvaRP 1260 5566663.233489******************9876644323233556663344 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1284 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 168.24 // Query: BDZ48352.1|CBM32|GH92 [L=1681] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-26 77.7 23.9 1.3e-17 50.6 9.1 4.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 50.6 9.1 1.3e-17 1.3e-17 8 113 .. 83 196 .. 78 213 .. 0.79 2 ? 0.4 0.0 0.045 0.045 35 56 .. 332 365 .. 309 410 .. 0.67 3 ! 31.6 4.0 1e-11 1e-11 11 114 .. 1165 1274 .. 1155 1290 .. 0.68 Alignments for each domain: == domain 1 score: 50.6 bits; conditional E-value: 1.3e-17 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt. 88 ++s+++a+++ a+n+ D+++ ++W + + ++t+ L++++t+ k++lt a+ + +++ d++v +S+Dg+tWtt++++++++ g BDZ48352.1|CBM32|GH92 83 TASAENAPDEVAANLADNNAASKWLAFEttATITYTLDSAQTLAKYSLTSANdsSgRDPVDFTVAGSSDGSTWTTLDTQTGQSFsGRg 170 4566788889****************744678*****************7334547*********************99887765667 PP CBM32.hmm 89 .tetitfdkpvtaryvRltvtkratn 113 t++ +++kp+ + +Rl +tk+a + BDZ48352.1|CBM32|GH92 171 aTDSYSVTKPAAYTTYRLSITKNAGD 196 5556688888877*******885532 PP == domain 2 score: 0.4 bits; conditional E-value: 0.045 CBM32.hmm 35 g.....qw..ltvdLgkp..ttvdkvvltw...a 56 qw + +dLgk +t++kv +t+ + BDZ48352.1|CBM32|GH92 332 KilyadQWnsVKIDLGKLqgKTITKVLFTYdnpS 365 03334544449*****774479999999964221 PP == domain 3 score: 31.6 bits; conditional E-value: 1e-11 CBM32.hmm 11 ssaaggggaenavDgdpnt..rWssag.qwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt.t 89 +s++g + ++++D+d ++ +++ + + ++ + +p tv++++lt ++ + + ++ +k+e+S+Dgk+W tv++++++t + t BDZ48352.1|CBM32|GH92 1165 TSNDG-TDLAALTDDDSTSsvTFAT-SdPAISFESDaGPATVTSYTLT-NGaTgSSPTAWKLEGSSDGKKWITVDQRKGQTWPWqT 1247 33444.6689999998664222333.1346888888779*********.4354699******************986543322223 PP CBM32.hmm 90 etitfd..kpvta.ryvRltvtkratna 114 +t++f+ p a ++Rl +t+++ ++ BDZ48352.1|CBM32|GH92 1248 QTRPFEiaHPS-AfAHYRLSITATTDGK 1274 57788875554.45*******7755332 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1681 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.65 // Query: WNG37177.1|CBM0|CBM32|GH92 [L=1341] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-26 79.4 19.9 1.6e-20 60.0 1.1 3.8 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.3 1.4 0.65 0.65 10 42 .. 57 106 .. 49 118 .. 0.47 2 ! 60.0 1.1 1.6e-20 1.6e-20 5 120 .. 134 256 .. 130 260 .. 0.79 3 ? -2.1 0.0 0.28 0.28 51 81 .. 1140 1170 .. 1134 1187 .. 0.66 4 ! 31.6 1.5 1e-11 1e-11 11 122 .. 1222 1335 .. 1214 1337 .. 0.73 Alignments for each domain: == domain 1 score: -3.3 bits; conditional E-value: 0.65 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g...............qwl.tvdL 42 ++++++g ++++ +D d++t s+ + +w+ tv+L WNG37177.1|CBM0|CBM32|GH92 57 GTDTDAGTDPDAGTDTDAGTDGGSTeTpqdfyssfeaadpqpTWIsTVEL 106 44455557777778887776433321121222111122233434333333 PP == domain 2 score: 60.0 bits; conditional E-value: 1.6e-20 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekg 82 +s ++s ++++++ a ++ Dgd +++W + + w+ +L +p v+++ + a+ + ++++ +++e+S+Dg++Wt +++++ WNG37177.1|CBM0|CBM32|GH92 134 TSVTASGENPPDEIAPRIADGDLTSKWLTFTstGWVRCELAQPIAVKRYAISSANdaPeRDPSAWTLEGSQDGTSWTALDQRS 216 46667888999999***************74478******************7334547********************9988 PP CBM32.hmm 83 nttdgt...te.titfdkpvta.ryvRltvtkratnawgasia 120 n++ + ++ t +f++ +ta ry+Rl+vt++++++ +ia WNG37177.1|CBM0|CBM32|GH92 217 NESF-SarfEThTYEFTN-TTAyRYYRLNVTANHSGNI-LQIA 256 8664.3346343668885.5666*******77554433.6665 PP == domain 3 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 51 vvltwaen.grikdykvevS.tDgktWttvaek 81 ++++ + + +k++ v++ +g+ +t+ + + WNG37177.1|CBM0|CBM32|GH92 1140 ITINA--PnNSPKNVYVQALkVNGTAYTKTYVT 1170 55662..12668888888886789888887533 PP == domain 4 score: 31.6 bits; conditional E-value: 1e-11 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag..qwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttd 86 ss++g ++++++D+ +t s + ++ + + ++++v+ ++lt + + ++ +++++S+Dg t+tt++e++ +t WNG37177.1|CBM0|CBM32|GH92 1222 SSSDG-TNPSALFDNTSTTSVSFTAenPSVLYHFTsGARQVTFYTLTS-GtTaVDPMGWTLSGSNDGVTFTTLDERSAQTF 1300 34456.78******9777766664234457777775889********4.334588*******************9986553 PP CBM32.hmm 87 gt..tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 + t+t+ f +p +y+Rl+ t+a g+s+aEl WNG37177.1|CBM0|CBM32|GH92 1301 -SwrTQTRAFRvaNPGAYTYYRLEL----TGAAGMSLAEL 1335 .34434445555488767*******....45678999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1341 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 123.34 // Query: XJU85707.1|CBM0|CBM32|GH92 [L=1269] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-27 83.1 14.4 1.7e-21 63.1 1.5 4.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.1 1.5 1.7e-21 1.7e-21 7 112 .. 94 207 .. 88 222 .. 0.78 2 ? 0.9 0.8 0.031 0.031 12 37 .. 711 740 .. 702 774 .. 0.72 3 ! 25.4 0.3 8.7e-10 8.7e-10 21 106 .. 1166 1255 .. 1153 1266 .. 0.69 Alignments for each domain: == domain 1 score: 63.1 bits; conditional E-value: 1.7e-21 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a+ +++++gg+ en+ D+ p+t+W + w+++dL++pt++ k+ lt a+ + ++++d+++ +S Dg++W+t+++++++ XJU85707.1|CBM0|CBM32|GH92 94 AS-AENTNGGEVKENLADNEPGTKWLTFAptGWVEFDLDAPTKIVKYALTSANdhSeRDPRDWTLKGSADGESWQTLDTRSGE 175 33.344556699***************74457******************7334546*********************98765 PP CBM32.hmm 85 tdgt..te.titfdkpvtaryvRltvtkra.t 112 t g+ t+ t +++++++ +++Rl++tk++ + XJU85707.1|CBM0|CBM32|GH92 176 TFGEpfTTkTYDLAEAAEFQHFRLEITKNNgA 207 5555443325566699999*******875533 PP == domain 2 score: 0.9 bits; conditional E-value: 0.031 CBM32.hmm 12 saaggggaenavDgd...pntrWssag.qw 37 +++++++ +++vDg+ +n +W ++ +w XJU85707.1|CBM0|CBM32|GH92 711 ENTPTETGAKVVDGKvyvNNGFWDTYRtTW 740 44556999******8553346999863345 PP == domain 3 score: 25.4 bits; conditional E-value: 8.7e-10 CBM32.hmm 21 navDgdpntrWssagqwltvdLg.kpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekgnttd.gttetitfd 95 +++D+ ++ ++ vdL + ++v++t ++ + + +k+++S DgktW+t++ +++++ + +t+ f+ XJU85707.1|CBM0|CBM32|GH92 1166 ALFDN--TSATDATV--TSVDLPvADEGAKAVQYTLtSSadHtRAPAGWKLQGSADGKTWRTLDRRSGESFaWDRQTRAFS 1242 56666..33334443..5799996668899999999733444699******************987765433333355776 PP CBM32.hmm 96 ..kpvtaryvRlt 106 +p t ++Rl+ XJU85707.1|CBM0|CBM32|GH92 1243 vkSPGTYAKYRLV 1255 5466665555655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1269 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.95 // Query: ULU23859.1|CBM32|GH92 [L=1127] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-13 35.2 0.2 8.1e-12 31.9 0.1 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.084 0.084 35 53 .. 163 193 .. 137 207 .. 0.56 2 ! 31.9 0.1 8.1e-12 8.1e-12 19 123 .. 1013 1122 .. 998 1123 .. 0.67 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.084 CBM32.hmm 35 g.......qw..ltvdLgkpt...tvdkvvl 53 + qw l +dLg++ tv +++l ULU23859.1|CBM32|GH92 163 SsrvlhdnQWnaLDIDLGAVAagkTVAAIEL 193 0223333444449999998752225555555 PP == domain 2 score: 31.9 bits; conditional E-value: 8.1e-12 CBM32.hmm 19 aenavDgdpnt.rWssag.qwltvdLgkpttvdkvvltw.aen..grikdykvevStDgktWttvaekgnttdgt.tetitfd..k 96 a ++ D+ +t ++ +++dL++p++v ++lt a + ++++ +++e+S+D+ +W t++e+ +++ + +t+ f ULU23859.1|CBM32|GH92 1013 ARALSDNTSDTeALLRGSePAVQLDLKQPRQVAMYTLTSgA-QagRDPQAWTLEGSNDNVHWMTLDERRDESFPWrRQTRAFGvaH 1097 334444433453222222456*****************642.2369*******************998775543333466777657 PP CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEla 123 p + ++R ++++ ++++g +++E++ ULU23859.1|CBM32|GH92 1098 PGNYSHYRWRAEH--ASSHGIALSEME 1122 7777777777733..334667777765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1127 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 127.99 // Query: URL60318.1|CBM32|GH92 [L=1104] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-15 44.2 1.0 1.6e-13 37.4 0.0 3.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.3 0.0 0.048 0.048 18 54 .. 117 176 .. 105 232 .. 0.63 2 ? 2.2 0.1 0.013 0.013 9 37 .. 525 556 .. 518 588 .. 0.72 3 ! 37.4 0.0 1.6e-13 1.6e-13 13 122 .. 988 1099 .. 979 1101 .. 0.73 Alignments for each domain: == domain 1 score: 0.3 bits; conditional E-value: 0.048 CBM32.hmm 18 gaenavDgdpntrWss.............ag..........qw..ltvdLgkpttvdkvvlt 54 + + ++D+ ++r s+ +g qw + vdLg++ + ++v+ URL60318.1|CBM32|GH92 117 SVDLVFDD--GSRLSAtgahdqhgvpataKGqgegrvlypdQWnyVSVDLGAVAKGRRVRAI 176 56666666..666555444444444433300334455566655569*****88654444433 PP == domain 2 score: 2.2 bits; conditional E-value: 0.013 CBM32.hmm 9 ssssaaggggaenavDgdp...ntrWssag.qw 37 +++++++ ++ +++vDg+p n +W ++ w URL60318.1|CBM32|GH92 525 AGENTPT-HTGARIVDGKPyvnNGFWDTYRtAW 556 4455555.9********9633145999963334 PP == domain 3 score: 37.4 bits; conditional E-value: 1.6e-13 CBM32.hmm 13 aaggggaenavDgdpntrWss..agqwltvdLgkpttvdkvvltw.aen.grikdykvevStDgktWttvaekgnttd.gttetit 93 a++g++++a+D+d +t + + l L +p v+ +++t a+ ++ +k+e+S Dgk+Wt+++e++n+t + +t+ URL60318.1|CBM32|GH92 988 GAAKGSPKAAIDNDSGTELALraG-AVLRDRLPSPAVVSLYTITSpAKAaEAPSGWKLEGSADGKQWTVLDERKNETFpWNRQTRA 1072 455589********9995444213.35999**************65323589*******************988765533324668 PP CBM32.hmm 94 fd..kpvtaryvRltvtkratnawgasiaEl 122 f+ +p r +Rlt+ ++ +a++aE+ URL60318.1|CBM32|GH92 1073 FAvaDPQAFRQYRLTFAGS----ATAKVAEV 1099 887666544*******332....33666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1104 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 121.66 // Query: UNP31342.1|CBM32|GH92 [L=1146] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-13 35.0 1.6 1.5e-12 34.3 0.1 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.4 0.1 0.71 0.71 11 34 .. 562 587 .. 554 596 .. 0.62 2 ! 34.3 0.1 1.5e-12 1.5e-12 15 107 .. 1026 1122 .. 1015 1141 .. 0.69 Alignments for each domain: == domain 1 score: -3.4 bits; conditional E-value: 0.71 CBM32.hmm 11 ssaaggggaenavDgd...pntrWssa 34 +s+a+ + +++ Dg+ +n +W ++ UNP31342.1|CBM32|GH92 562 ASSAT-RTGAAVMDGQvyvNNGFWDTY 587 34444.778899999754334588875 PP == domain 2 score: 34.3 bits; conditional E-value: 1.5e-12 CBM32.hmm 15 ggggaenavDgdpnt..rWssag.qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetit 93 +g +a++++D+d +t r s +l ++++p t + ++lt + + g+++ + +++S+Dg +Wtt++e+ ++ +t+ UNP31342.1|CBM32|GH92 1026 NGKQAAALFDDDSTTsaRLSG-PmPSLSWNFKAPATARLYTLTS-SnKrGDAQAWALQASNDGAQWTTLDERRDQRF-AwrRQTRA 1108 34679******9887545544.1346*****************5.3346*********************9887653.34334778 PP CBM32.hmm 94 fd..kpvtaryvRltv 107 f+ + +a y R++ UNP31342.1|CBM32|GH92 1109 FAiaQ--PAAYSRYRL 1122 98445..566666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1146 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 138.09 // Query: XNW67317.1|CBM32|GH92 [L=1113] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-15 42.3 0.8 4.4e-13 36.0 0.0 3.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.3 0.0 0.049 0.049 19 67 .. 126 206 .. 113 246 .. 0.57 2 ? 1.6 0.1 0.019 0.019 10 35 .. 535 562 .. 527 593 .. 0.73 3 ! 36.0 0.0 4.4e-13 4.4e-13 18 121 .. 1002 1107 .. 991 1110 .. 0.75 Alignments for each domain: == domain 1 score: 0.3 bits; conditional E-value: 0.049 CBM32.hmm 19 aenavDgdpntrWss.............ag..........qw..ltvdLgkp...ttvdkvvltw...ae.n..grikdykve 67 + ++D+ ++r s+ +g qw + vdLg++ ++v++++l a+ + g+ d+++ XNW67317.1|CBM32|GH92 126 VDLVFDD--GSRLSAsgardqhrvpataKGqgegrvlypdQWnyVSVDLGAVakgRRVRGIELVVnapAGkSfeGYLDDVRIG 206 5666666..6666554444444444433003344555566555599****872234677777765433113123555555555 PP == domain 2 score: 1.6 bits; conditional E-value: 0.019 CBM32.hmm 10 sssaaggggaenavDgdp...ntrWssag 35 ++++++ ++ +++vDg+p n +W ++ XNW67317.1|CBM32|GH92 535 GENTDT-HTGARIVDGKPyvnNGFWDTYR 562 455556.99*******9633145999853 PP == domain 3 score: 36.0 bits; conditional E-value: 4.4e-13 CBM32.hmm 18 gaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgtte.titfd..k 96 + +++ D+d +t ++ +++ + L++p tv +++t + ++++++++S Dgk+Wtt++e+ ++ + ++ t+ f+ + XNW67317.1|CBM32|GH92 1002 KLAAVADNDSSTEFALPRgkTTVDYRLDTPATVAVYTITS-GaAlPAPSHWTLQGSADGKQWTTLDERHDERFPWHRqTRAFAlkQ 1086 4677889999998877533567*****************5.334678*******************99764333344355666669 PP CBM32.hmm 97 pvtaryvRltvtkratnawgasiaE 121 p++ + +Rl+ + + + ++aE XNW67317.1|CBM32|GH92 1087 PASYKQYRLVLDA----DAPGAVAE 1107 9999****99933....22344555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1113 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 127.45 // Query: WGK49111.1|CBM0|CBM32|GH92 [L=1269] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-27 82.8 13.7 1.6e-21 63.3 1.3 3.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.3 1.3 1.6e-21 1.6e-21 7 112 .. 94 207 .. 88 221 .. 0.78 2 ? 0.9 0.8 0.031 0.031 12 37 .. 711 740 .. 702 774 .. 0.72 3 ! 24.5 0.2 1.6e-09 1.6e-09 21 106 .. 1166 1255 .. 1153 1266 .. 0.69 Alignments for each domain: == domain 1 score: 63.3 bits; conditional E-value: 1.6e-21 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a+ +++++gg+ en+ D+ p+t+W + w+++dL++pt++ k+ lt a+ + ++++d+++ +S Dg++W+t+++++++ WGK49111.1|CBM0|CBM32|GH92 94 AS-AENTNGGEVKENLADNEPGTKWLTFAptGWVEFDLDAPTKIVKYALTSANdhSeRDPRDWTLKGSADGESWQTLDTRSGE 175 33.344556699***************74457******************7334546*********************98765 PP CBM32.hmm 85 tdgt..te.titfdkpvtaryvRltvtkra.t 112 t g+ t+ t +++++++ +++Rl++tk++ + WGK49111.1|CBM0|CBM32|GH92 176 TFGEpfTTkTYDLAEAAEFQHFRLEITKNNgA 207 5555443325566699999*******875533 PP == domain 2 score: 0.9 bits; conditional E-value: 0.031 CBM32.hmm 12 saaggggaenavDgd...pntrWssag.qw 37 +++++++ +++vDg+ +n +W ++ +w WGK49111.1|CBM0|CBM32|GH92 711 ENTPTETGAKVVDGKvyvNNGFWDTYRtTW 740 44556999******8553346999863345 PP == domain 3 score: 24.5 bits; conditional E-value: 1.6e-09 CBM32.hmm 21 navDgdpntrWssagqwltvdLg.kpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekgnttd.gttetitfd 95 +++D+ ++ ++ vdL + + +++++t ++ + + +k+++S DgktW+t++ +++++ + +t+ f+ WGK49111.1|CBM0|CBM32|GH92 1166 ALFDD--TSATDATV--ASVDLPvADKGAKALQYTLtSSadRtKAPAGWKLQGSADGKTWRTLDRRSGESFaWDRQTRAFS 1242 55666..33334443..6899996668999999998733454699******************987765433333355776 PP CBM32.hmm 96 ..kpvtaryvRlt 106 +p t ++Rl+ WGK49111.1|CBM0|CBM32|GH92 1243 vkSPGTYAKYRLV 1255 5466665555655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1269 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 86.87 // Query: AGU11690.1|CBM32 [L=519] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-14 40.5 0.0 3.6e-14 39.5 0.0 1.5 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.5 0.0 3.6e-14 3.6e-14 12 111 .. 319 423 .. 308 437 .. 0.71 Alignments for each domain: == domain 1 score: 39.5 bits; conditional E-value: 3.6e-14 CBM32.hmm 12 saaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgtteti.tfd..k 96 s++g + a+n++ +++W + +l++ Lg++ v++++lt + + ++++d+ +e+S Dg tWt +++++++ g e+i +f+ + AGU11690.1|CBM32 319 SEWG-EVADNLLRS--GNKWLAHRngADLEFTLGAAAVVTAYRLTSgNDfTeRDPSDWVLEGSHDGITWTLLDSRTDERFGRREEIlEFEfaN 408 3344.667777766..789**9634678*****************7533657*********************99876555534555666545 PP CBM32.hmm 97 pvtaryvRltvtkra 111 ++ ++Rl++t + AGU11690.1|CBM32 409 SASYLHYRLRITRNR 423 555677777775543 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (519 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.79 // Query: WYW18626.1|CBM32|GH92 [L=853] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-11 30.1 0.5 9.4e-11 28.5 0.0 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.1 0.27 0.27 17 34 .. 308 328 .. 303 339 .. 0.66 2 ! 28.5 0.0 9.4e-11 9.4e-11 51 108 .. 775 834 .. 745 849 .. 0.77 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.27 CBM32.hmm 17 ggaenavDgd...pntrWssa 34 + +++vDg +n +W ++ WYW18626.1|CBM32|GH92 308 RTGAKVVDGEmyvNNGFWDTY 328 567999***844334599885 PP == domain 2 score: 28.5 bits; conditional E-value: 9.4e-11 CBM32.hmm 51 vvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfdkpvtaryvRltvt 108 ++lt ++ + g+++++ +e+S+Dg++Wt +++++++t +t++f+ +v+ary R++ WYW18626.1|CBM32|GH92 775 YTLT-SGsRrGDPRSWVLEGSDDGEHWTLLDQREGETF-RwrRQTRPFALAVPARYARYRLR 834 4455.334469*******************99876553.3323588***8899***999882 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (853 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 123.47 // Query: WKB36470.1|CBM32|GH92 [L=231] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-10 27.0 1.8 4.8e-10 26.2 0.5 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.3 0.0 0.074 0.074 62 79 .. 13 30 .. 2 65 .. 0.55 2 ! 26.2 0.5 4.8e-10 4.8e-10 17 82 .. 99 171 .. 67 204 .. 0.76 Alignments for each domain: == domain 1 score: -0.3 bits; conditional E-value: 0.074 CBM32.hmm 62 kdykvevStDgktWttva 79 ++y +v +g+++ WKB36470.1|CBM32|GH92 13 NKYIQSVTLNGQNYSNTT 30 444445555555554331 PP == domain 2 score: 26.2 bits; conditional E-value: 4.8e-10 CBM32.hmm 17 ggaenavDgdpnt..rWssagqwltvdLg.kpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekg 82 + +++D + +t + s + ++ v ++ + ++v+ ++lt a+ + +++k +++++S+Dgk+W+t + + WKB36470.1|CBM32|GH92 99 RSYGALFDHNSDTatLFRSHYPSIPVTFKkGKQRVTMYTLTSsANggGtSDPKGWTLSGSNDGKKWETWTSAA 171 556789999988522555542459999994558********87335557***************998875433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (231 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 55.81 // Query: WHT23536.1|CBM32|GH92 [L=1427] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-30 91.0 16.6 1.2e-22 66.9 3.6 4.1 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.9 3.6 1.2e-22 1.2e-22 6 122 .. 85 208 .. 81 210 .. 0.78 2 ? -2.7 0.0 0.41 0.41 57 81 .. 620 647 .. 592 665 .. 0.57 3 ? 1.4 0.1 0.023 0.023 10 41 .. 708 743 .. 700 793 .. 0.75 4 ! 29.7 0.3 4e-11 4e-11 14 122 .. 1169 1278 .. 1161 1280 .. 0.72 Alignments for each domain: == domain 1 score: 66.9 bits; conditional E-value: 1.2e-22 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.g 87 +a+s+++++gg+ +n++Dg+ +++W + + w+ + L ++ v+k+ + a+ +++kd+++ +S+Dg +Wttv++++++ + WHT23536.1|CBM32|GH92 85 TAASAENTSGGEVRDNLFDGSLSSKWLAFErtGWVSLTLSEAVPVQKYAVSSANdaAeRDPKDWTLKGSNDGANWTTVDSRTGQAFaK 172 3334455666699***************74467******************7334546*********************999877644 PP CBM32.hmm 88 ttetitfd.kpvta.ryvRltvtkra.tnawgasiaEl 122 +et+tf+ +++ta +++Rl + +a ++a+ ++aEl WHT23536.1|CBM32|GH92 173 RHETKTFTlDNTTAyQHYRLDI--TAnNGAPIIQLAEL 208 466666666567777*******..55233466889887 PP == domain 2 score: -2.7 bits; conditional E-value: 0.41 CBM32.hmm 57 e..n..grikdykvevStDgktWttvaek 81 + + + k+ +evSt + t+ v+e+ WHT23536.1|CBM32|GH92 620 SllSveQAKKNLALEVSTSD-TFDSVKER 647 12312356677777777665.67666654 PP == domain 3 score: 1.4 bits; conditional E-value: 0.023 CBM32.hmm 10 sssaaggggaenavDgd...pntrWssag.qwltvd 41 + +++++ + +++vDg+ +n +W ++ +w + WHT23536.1|CBM32|GH92 708 TGQDTPERTGAKVVDGKiyvNNGFWDTYRtTWPAYS 743 3444555999******95433469999644454444 PP == domain 4 score: 29.7 bits; conditional E-value: 4e-11 CBM32.hmm 14 aggggaenavDgdpntrWssag.qwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetit 93 a+ g +++vD++ t + +g w+++ ++p v+ ++lt + g++ + + +S Dg +W +v+e+++++ + t+ WHT23536.1|CBM32|GH92 1169 AS-TGLDALVDNSSATETAFNGsGWVQFQPKTPiEPVSFYTLTS-GkAaGDPAGWVLKGSYDGRNWAVVDERKGEKF-AwrQHTKA 1251 34.7899*****8776444433459******9978999999994.33359*******************99876543.24333668 PP CBM32.hmm 94 fd..kpvtaryvRltvtkratnawgasiaEl 122 f+ kp + +Rl+ t++ g+s+aE+ WHT23536.1|CBM32|GH92 1252 FKvaKPGRYSQYRLEL----TGTAGFSVAEV 1278 8844665555555555....55678999997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1427 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.09 // Query: XDA93540.1|CBM32 [L=1090] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-28 85.9 17.3 1.1e-17 50.8 0.6 4.1 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 50.8 0.6 1.1e-17 1.1e-17 15 83 .. 91 164 .. 83 198 .. 0.81 2 ! 9.9 0.2 5.1e-05 5.1e-05 74 122 .. 259 310 .. 254 312 .. 0.58 3 ! 33.0 3.3 3.8e-12 3.8e-12 12 89 .. 334 416 .. 321 453 .. 0.77 4 ? -2.9 0.0 0.49 0.49 66 80 .. 1035 1050 .. 1025 1069 .. 0.69 Alignments for each domain: == domain 1 score: 50.8 bits; conditional E-value: 1.1e-17 CBM32.hmm 15 ggggaenavDgdpntrWssag.qwltvdLgkpttvdkvvltwae.n..grikdykvevStDgktWttvaekg.n 83 + +ga +++Dg +t+W s+g +++d+g+ptt+d++++ a+ + ++++++ +e+StDg+tW+tv++++ + XDA93540.1|CBM32 91 SAEGAGKLIDGTVDTKWYSGGrDAVVFDFGAPTTIDSYNFATANdSldRTPTQWLFEGSTDGTTWVTVDNRDlG 164 3478***************86667*****************83343469*******************987533 PP == domain 2 score: 9.9 bits; conditional E-value: 5.1e-05 CBM32.hmm 74 tWttvaekg.nttdgt....tetitfd.kpvtaryvRltvtkratnawgasiaEl 122 t+ t+a+++ + gt ++ + ++ ++ t+ryv++t+t+ n + a+i E+ XDA93540.1|CBM32 259 TYYTLAATNtS---GTasasHKLRAVPgTTKTTRYVKFTGTTLRGNGTLAQIGEM 310 66777654313...3333444444666444557*******776644444888887 PP == domain 3 score: 33.0 bits; conditional E-value: 3.8e-12 CBM32.hmm 12 saaggggaenavDgdpntrWssag.qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gt.t 89 ++a+ ++ + ++D+d++t+W + + +++d+g++ ++ ++++t + + +++ ++ +e S+Dg +++ + +++n+++ ++ XDA93540.1|CBM32 334 ANAA-ETVASIIDNDYGTKWLNHNnRPIIFDFGTNVSIASYQITTgNDdGnRDAVRWILESSDDGVNYKLLEAVNNYPVpNErR 416 3334.789**************64456*****************8632535********************9999988755531 PP == domain 4 score: -2.9 bits; conditional E-value: 0.49 CBM32.hmm 66 vevStD..gktWttvae 80 ve+St g tWtt+ + XDA93540.1|CBM32 1035 VEYSTTlaG-TWTTFGA 1050 788866435.9*99943 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1090 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 69.71 // Query: XEZ43084.1|CBM32|GH92 [L=1305] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-25 76.1 13.7 1e-19 57.5 2.1 3.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 57.5 2.1 1e-19 1e-19 4 122 .. 107 231 .. 104 233 .. 0.76 2 ? -1.5 0.3 0.17 0.17 13 47 .. 740 778 .. 734 800 .. 0.67 3 ! 25.3 0.2 9e-10 9e-10 47 110 .. 1219 1286 .. 1186 1296 .. 0.70 Alignments for each domain: == domain 1 score: 57.5 bits; conditional E-value: 1e-19 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd 86 a a s++++a g+ en+ Dg ++t+W + + w+++ L +p t ++ lt a+ + ++++++++ +S Dg++Wt++++++++t XEZ43084.1|CBM32|GH92 107 AVRA-SGENTADGEVKENLADGENTTKWLTFQrtPWVEFTLAEPVTAVRYALTSANdaPaRDPRSWTLKGSADGQHWTVLDTREDETF 193 4445.4556666699*******999*****85678*********9999999996334557*********************9987665 PP CBM32.hmm 87 gt..tetitfd.kpvta.ryvRltvtkratnawgasiaEl 122 + + t++f+ + ta r++Rl +t + ++ ++++aE+ XEZ43084.1|CBM32|GH92 194 EKrfQ-TRQFTlEGRTAyRHFRLDITRNG-GDAATQLAEV 231 33342.446666455666*******5533.3466899997 PP == domain 2 score: -1.5 bits; conditional E-value: 0.17 CBM32.hmm 13 aaggggaenavDgd...pntrWssag.qwltvdLgkptt 47 ++++ + +++vDg +n +W ++ +w + L +p++ XEZ43084.1|CBM32|GH92 740 TTPTRTGARIVDGEvyvNNGFWDTYRtTWPAYSLLAPRQ 778 445578899999975533459998644566666655555 PP == domain 3 score: 25.3 bits; conditional E-value: 9e-10 CBM32.hmm 47 tvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..kpvtaryvRltvtkr 110 +v +++lt + + + ++ + +e+S+Dg +Wt + +++++ t +t+ f+ ++vt r++Rl+v++ XEZ43084.1|CBM32|GH92 1219 RVASYTLTS-SdRtRAPRGWVLEGSDDGREWTATDRRSGES-FTwdRQTRVFSlrSAVTYRHYRLKVIGG 1286 578888884.344599****************998776544.444423445555599**********553 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1305 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.45 // Query: XML57437.1|CBM0|CBM32|GH92 [L=1269] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-29 86.8 10.4 3.2e-21 62.3 0.7 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.3 0.7 3.2e-21 3.2e-21 9 112 .. 95 207 .. 88 220 .. 0.78 2 ? 1.9 0.3 0.015 0.015 12 44 .. 710 746 .. 701 794 .. 0.75 3 ! 26.7 0.2 3.2e-10 3.2e-10 21 107 .. 1166 1256 .. 1148 1266 .. 0.71 Alignments for each domain: == domain 1 score: 62.3 bits; conditional E-value: 3.2e-21 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd 86 s+++a+gg+ en+ D+ p+t+W + w+++dL++pt++ k+ lt a+ + ++++d+++ +S Dg+tW+t+++++++t XML57437.1|CBM0|CBM32|GH92 95 SGENAGGGEVKENLADNEPTTKWLTFAptGWVEFDLDAPTKIVKYALTSANdhPeRDPRDWTLKGSADGETWRTLDTRSGETF 177 4666777789***************74457******************7334547********************99876543 PP CBM32.hmm 87 gt...tetitfdkpvtaryvRltvtkra.t 112 ++ t+t +++++++ +++Rl++tk++ + XML57437.1|CBM0|CBM32|GH92 178 DEpfrTKTYDLAEAAEFQHFRLEFTKNNgA 207 32343335566699999*******875533 PP == domain 2 score: 1.9 bits; conditional E-value: 0.015 CBM32.hmm 12 saaggggaenavDgd...pntrWssag.qwltvdLgk 44 +++++++ +++vDg+ +n +W ++ +w + + + XML57437.1|CBM0|CBM32|GH92 710 ENTPTETGAKVVDGKvyvNNGFWDTYRtTWPAYSFLT 746 34556999******85533469999644565555555 PP == domain 3 score: 26.7 bits; conditional E-value: 3.2e-10 CBM32.hmm 21 navDgdpntrWssagqwltvdLg.kpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekgnttd.gttetitfd 95 +++D+ ++ ++a vdL + + +v++t + + + + +k+++S Dg+tW+t++e+++++ + +t+ f+ XML57437.1|CBM0|CBM32|GH92 1166 ALFDN--TSATEAAV--TSVDLPvSGKGAEAVQYTLtSPadGaQAPAGWKLQGSADGTTWRTLDERSGESFaWDRQTRAFS 1242 45565..22333332..5788886668888999998632444699******************998765543333355666 PP CBM32.hmm 96 ..kpvtaryvRltv 107 +p t +++Rl+ XML57437.1|CBM0|CBM32|GH92 1243 vkSPGTYQKYRLVL 1256 65888899999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1269 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 160.70 // Query: XED74419.1|CBM32|GH92 [L=1288] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-24 71.1 12.2 6e-20 58.2 0.4 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.2 0.4 6e-20 6e-20 9 122 .. 102 222 .. 95 225 .. 0.75 2 ? -0.8 0.8 0.11 0.11 14 42 .. 728 760 .. 721 798 .. 0.69 3 ! 18.8 0.3 9.3e-08 9.3e-08 21 107 .. 1182 1268 .. 1173 1282 .. 0.62 Alignments for each domain: == domain 1 score: 58.2 bits; conditional E-value: 6e-20 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.te 90 s+++a++g+ en+vDg t+W + + wl++ L +p + ++ lt a+ + ++++d+++ +S+Dg++Wt+++ ++++ + ++ XED74419.1|CBM32|GH92 102 SGENAEAGEVKENLVDGESATKWLTFDraAWLEFTLSEPVKAVRYALTSANdaPgRDPRDWTLKGSDDGSHWTVLDVREGQVFEKrHQ 189 3455566699*******999*****85578*********7777777775335557********************8777665533455 PP CBM32.hmm 91 titfd..kpvtaryvRltvtkratnawgasiaEl 122 t++f+ +v+ r++Rl + + +++ +++aE+ XED74419.1|CBM32|GH92 190 TREFSfgGTVSYRHYRLDIARN-SGDAVTQLAEV 222 555555588999*******333.33444777776 PP == domain 2 score: -0.8 bits; conditional E-value: 0.11 CBM32.hmm 14 aggggaenavDgd...pntrWssag.qwltvdL 42 +++ + +++vDg +n +W ++ +w + L XED74419.1|CBM32|GH92 728 TPTRTGAKVVDGEvyvNNGFWDTYRtTWPAYSL 760 444788999999754334588886344544444 PP == domain 3 score: 18.8 bits; conditional E-value: 9.3e-08 CBM32.hmm 21 navDgdpn..trWssagqwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttd.gttetitfdkpvtar 101 +++D+ t + + + + +v++++lt + + + + +S Dg++W tv+ +++++ + +t+ f+ +++r XED74419.1|CBM32|GH92 1182 ALTDDTSAtdTSFTT----ASLRVPAGSRVTSYTLTS-AdRaKAPDGWVLKGSADGEEWSTVDRRTGESFaWDRQTRVFSVRAPGR 1262 556664331133333....445555667899999995.234589******************998875543333455777334457 PP CBM32.hmm 102 yvRltv 107 y ++ XED74419.1|CBM32|GH92 1263 YGHYRL 1268 655444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1288 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 100.14 // Query: USX51236.1|CBM32|GH92 [L=1410] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-25 74.8 18.1 8.5e-20 57.7 2.2 4.0 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 57.7 2.2 8.5e-20 8.5e-20 13 122 .. 97 214 .. 87 216 .. 0.75 2 ? 1.6 0.2 0.02 0.02 10 37 .. 706 737 .. 698 768 .. 0.73 3 ? -3.3 0.0 0.63 0.63 50 78 .. 1082 1110 .. 1073 1126 .. 0.70 4 ! 24.2 1.5 2e-09 2e-09 18 109 .. 1163 1257 .. 1156 1283 .. 0.69 Alignments for each domain: == domain 1 score: 57.7 bits; conditional E-value: 8.5e-20 CBM32.hmm 13 aaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt.tetit 93 a++g+ en+vDg++n++W + w + +g+++t++k+ l a+ + +++k++++++S++g++Wt+v++++++t + t++ USX51236.1|CBM32|GH92 97 ADAGEVKENLVDGSINSKWLVFTstGWASFRFGEQQTIRKYALSSANdaPeRDPKNWTLQGSNNGTDWTVVDTRTGETFaERfQ-TKS 183 445589**************974467******************7334547*********************998766533342.334 PP CBM32.hmm 94 fd..kpvta.ryvRltvtkratnawgasiaEl 122 +d +p a +++l vt ++ +++ +++aE+ USX51236.1|CBM32|GH92 184 YDiaTPQ-AfSHYKLDVTLNNGGNNVMQLAEV 214 4433443.339999999665543455889987 PP == domain 2 score: 1.6 bits; conditional E-value: 0.02 CBM32.hmm 10 sssaaggggaenavDgd...pntrWssag.qw 37 + +++++++ +++vDg+ +n +W ++ +w USX51236.1|CBM32|GH92 706 TGQNTPTQTGAKIVDGKvyvNNGFWDTYRtTW 737 445555699*******8553346999863334 PP == domain 3 score: -3.3 bits; conditional E-value: 0.63 CBM32.hmm 50 kvvltwaen.grikdykvevS.tDgktWttv 78 k+v++ + + +k++ v++ +gk W++ USX51236.1|CBM32|GH92 1082 KLVINA--PkNSAKNIYVQGVkVNGKAWNKT 1110 455552..22567888888665789999764 PP == domain 4 score: 24.2 bits; conditional E-value: 2e-09 CBM32.hmm 18 gaenavDgdpntrWssagqwltvdLgkpttvdkvvltw..ae.n.grikdykvevStDgktWttvaekgnttdgt.te.titfd.. 95 g +++vD++ t +d++++ k +++ ++ + + ++ +++ +S DgktW tv+++++++ + ++ t++f+ USX51236.1|CBM32|GH92 1163 GTAALVDNNSATSAVVR----SFDFKAADAKEKAEFYTltNGkTgTSPSAWELKGSYDGKTWATVDKRTGEN-FQwQQyTRSFKia 1243 56788999766643333....45555555555555554433344699******************9987654.3344535588877 PP CBM32.hmm 96 kpvtaryvRltvtk 109 +p + ++Rl++t+ USX51236.1|CBM32|GH92 1244 SPGRYNFYRLEFTG 1257 88889999999965 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1410 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 161.89 // Query: XGA32213.1|CBM0|CBM32|GH92 [L=1418] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-24 71.6 3.9 9.7e-18 51.0 0.3 3.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.0 0.3 9.7e-18 9.7e-18 14 111 .. 99 204 .. 95 220 .. 0.81 2 ! 20.2 0.3 3.5e-08 3.5e-08 17 111 .. 1201 1311 .. 1192 1323 .. 0.67 Alignments for each domain: == domain 1 score: 51.0 bits; conditional E-value: 9.7e-18 CBM32.hmm 14 aggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.te 90 ++ ++ ++++D d n++W + +++++L++p v k+ lt a+ + +++k++++ +S+Dg++Wtt++++++++ ++ ++ XGA32213.1|CBM0|CBM32|GH92 99 PPRETKDKLIDRDVNSKWLIFEetAYIELELEEPDAVIKYALTSANdfPgRDPKNWELLGSNDGEDWTTLDTRTDEEFDDrHQ 181 566889*************9644567*****************7334657*********************999766533544 PP CBM32.hmm 91 .ti.tfdkpvtaryvRltvtkra 111 +i +f+++++ ++R+++t+++ XGA32213.1|CBM0|CBM32|GH92 182 tKIyEFENTIEYSHYRVEITANN 204 4888***9999********6533 PP == domain 2 score: 20.2 bits; conditional E-value: 3.5e-08 CBM32.hmm 17 ggaenavDgdpntrWssag..qwltvdLgkp.ttvdkvvltw....ae.....n.grikdykvevStDgktWttvaekgnt 84 g+ ++D+ t ++ w+++ + + ++ + ++lt ++ + +++++ + +S+Dg++W +++e+ n+ XGA32213.1|CBM0|CBM32|GH92 1201 GDTHLLFDNTSETELMLENnaPWIQYQFTEGkKEGSMYTLTSgdsvSSdepesQmADPQSWVLKGSNDGEDWIVLDERVNE 1281 45667778755564333324689******66277777788878766114577669********************987664 PP CBM32.hmm 85 tdgt..tetitfd..kpvtaryvRltvtkra 111 t + + t+ f+ +p + ++ l +t++ XGA32213.1|CBM0|CBM32|GH92 1282 TF-EwrNYTRAFEieNPGEYEFYQLDITENG 1311 43.2322244666658888899999996643 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1418 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 166.94 // Query: XPG90275.1|CBM32|GH92 [L=974] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-13 35.3 1.0 7.1e-13 35.3 1.0 3.5 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.2 0.0 0.072 0.072 87 109 .. 201 221 .. 176 242 .. 0.65 2 ? -3.5 0.1 0.77 0.77 24 35 .. 429 440 .. 418 452 .. 0.70 3 ? -0.4 0.6 0.079 0.079 14 35 .. 539 560 .. 529 597 .. 0.77 4 ! 35.3 1.0 7.1e-13 7.1e-13 10 122 .. 846 966 .. 839 968 .. 0.70 Alignments for each domain: == domain 1 score: -0.2 bits; conditional E-value: 0.072 CBM32.hmm 87 gttetitfdkpvtaryvRltvtk 109 gt ++it ++ a y+R+t+ + XPG90275.1|CBM32|GH92 201 GTRTEITPTD--HAAYFRFTAAA 221 2212444332..389****9933 PP == domain 2 score: -3.5 bits; conditional E-value: 0.77 CBM32.hmm 24 DgdpntrWssag 35 Dg +trW+s g XPG90275.1|CBM32|GH92 429 DGGWTTRWASPG 440 665568999863 PP == domain 3 score: -0.4 bits; conditional E-value: 0.079 CBM32.hmm 14 aggggaenavDgdpntrWssag 35 ++ g +n++Dg + W+ ++ XPG90275.1|CBM32|GH92 539 NSATGYANIFDGASTGTWAGGW 560 3446789*****6554888753 PP == domain 4 score: 35.3 bits; conditional E-value: 7.1e-13 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag..qwltv.dLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.te 90 s++a+++ g +n++D t Wss+ w++ g++++v ++lt + + +++ +++ +S+Dg +Wtt+++++++ + XPG90275.1|CBM32|GH92 846 STTASNTTGLKNLNDRTSLTEWSSGAgaAWIQGsTAGTARKVAIYTLTS-SskTgQDPAGWTLKGSNDGIDWTTLDTRQGEV-FAwRR 931 444556689*******6559****8458899761566889999999996.23446********************9987543.33323 PP CBM32.hmm 91 ti.tfd..kpvtaryvRltvtkratnawgasiaEl 122 ++ +f +p +Rl++ + + ++s++E+ XPG90275.1|CBM32|GH92 932 QVrPFVvkTPGAYSTYRLEIGGGVGGGGAVSLSEF 966 44466654555458899999443233445888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (974 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 140.31 // Query: WZO48131.1|CBM32|GH92 [L=2007] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-30 91.8 18.0 9.4e-22 64.0 0.5 5.3 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.0 0.5 9.4e-22 9.4e-22 5 111 .. 82 195 .. 78 210 .. 0.75 2 ? -0.0 0.1 0.062 0.062 35 55 .. 331 362 .. 293 384 .. 0.60 3 ! 3.3 0.1 0.006 0.006 5 34 .. 710 741 .. 706 760 .. 0.73 4 ! 32.4 1.0 5.7e-12 5.7e-12 14 109 .. 1169 1270 .. 1162 1296 .. 0.72 5 ? -3.9 0.1 1 1 16 26 .. 1742 1752 .. 1731 1753 .. 0.73 Alignments for each domain: == domain 1 score: 64.0 bits; conditional E-value: 9.4e-22 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd. 86 + +s+++++++ga+++ Dg+++t+W + w+++ L +p+ + +++lt + + +++kd++v++S++g++W+tv+e++++ WZO48131.1|CBM32|GH92 82 VT--ASDQNTPNEGAAFLADGNAGTKWLAFKnaAWVQYQLSAPQPMVRYTLTSgNDePdRDPKDFRVQGSNNGTDWVTVDERSGELFs 167 33..355566669****************74478******************7532557********************998765544 PP CBM32.hmm 87 gt.tetitfd..kpvta.ryvRltvtkra 111 g + t++f+ +p +a y+Rl v +++ WZO48131.1|CBM32|GH92 168 GRgE-TRSFTlaAPSDAfVYYRLDVLATK 195 5442.4455544888888*******4433 PP == domain 2 score: -0.0 bits; conditional E-value: 0.062 CBM32.hmm 35 g.......qw..ltvdLg..kpttvdkvvltw 55 + qw +tvdLg + +tvd + + + WZO48131.1|CBM32|GH92 331 QsnvlwpnQWnkVTVDLGsfAGRTVDDILFRY 362 022333455556******55558888887664 PP == domain 3 score: 3.3 bits; conditional E-value: 0.006 CBM32.hmm 5 ssaessssaaggggaenavDgd...pntrWssa 34 sa+s+s++++ ++ +++vDg+ +n +W ++ WZO48131.1|CBM32|GH92 710 VSATSGSATDT-QTNAKIVDGKiyvNNGFWDTY 741 57777888787.99*******954334599985 PP == domain 4 score: 32.4 bits; conditional E-value: 5.7e-12 CBM32.hmm 14 aggggaenavDgdpntrWssag..qwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttd.gttetit 93 +g + + +vD++ n++ +g +l+ + +p ++ +++lt + + ++++++e+S+Dg+tWt++++++++ +t+t++ WZO48131.1|CBM32|GH92 1169 DG-TPVASLVDDNMNSKVTFSGdtAELVWTSQsGPVSIGQYTLTS-AaKaDAPSSWTLEGSMDGTTWTELDSRDGQAFaWDTQTRP 1252 44.78999*****9987555423445666666599*********5.245699******************9987765433355789 PP CBM32.hmm 94 fd.kpvta.ryvRltvtk 109 f+ k+ ++ + +Rlt ++ WZO48131.1|CBM32|GH92 1253 FTaKNDDGyTSIRLTLQG 1270 997444444999999944 PP == domain 5 score: -3.9 bits; conditional E-value: 1 CBM32.hmm 16 gggaenavDgd 26 + +++avDgd WZO48131.1|CBM32|GH92 1742 IQVPKKAVDGD 1752 46799*****7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (2007 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 168.98 // Query: BFP51486.1|CBM32|GH92 [L=1306] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-26 78.9 17.2 1.3e-20 60.3 1.9 4.1 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.3 1.9 1.3e-20 1.3e-20 9 111 .. 127 237 .. 120 251 .. 0.76 2 ? 0.4 1.4 0.045 0.045 10 37 .. 745 776 .. 737 843 .. 0.76 3 ? -3.7 0.0 0.84 0.84 63 77 .. 1132 1147 .. 1109 1151 .. 0.62 4 ! 26.5 0.1 3.9e-10 3.9e-10 43 109 .. 1223 1295 .. 1195 1304 .. 0.72 Alignments for each domain: == domain 1 score: 60.3 bits; conditional E-value: 1.3e-20 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gtte 90 s++++agg+ en+vD p+++W + w+++dL++p +v ++ lt a+ +++kd+++ +S Dgk+Wt++++++++t + +e BFP51486.1|CBM32|GH92 127 SAENTAGGEVKENLVDVEPGSKWLTFAktGWVEFDLDEPVKVVTYALTSANdhAeRDPKDWTLKGSADGKEWTDLDTRSGETFaKRHE 214 345667779****************64457******************7334546*********************988766644454 PP CBM32.hmm 91 ..titfdkpvtaryvRltvtkra 111 + +f+ ++ +++Rl++t++ BFP51486.1|CBM32|GH92 215 tkSYDFAGDTAYQHFRLEITANG 237 224466655556*******6543 PP == domain 2 score: 0.4 bits; conditional E-value: 0.045 CBM32.hmm 10 sssaaggggaenavDgd...pntrWssag.qw 37 + +++++++ +++vDg +n +W ++ +w BFP51486.1|CBM32|GH92 745 TGENTPTQTGAKIVDGEvyvNNGFWDTYRtTW 776 44455558999*****8553345998863345 PP == domain 3 score: -3.7 bits; conditional E-value: 0.84 CBM32.hmm 63 dykvevS.tDgktWtt 77 ++ v++ +gk+Wt BFP51486.1|CBM32|GH92 1132 NIYVQGVkVNGKKWTS 1147 4444433378888885 PP == domain 4 score: 26.5 bits; conditional E-value: 3.9e-10 CBM32.hmm 43 gkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd..kpvtaryvRltvtk 109 g++ ++v++t + +k +++++StDg++Wt+++ +++++ +++t+ f+ +p +++Rl+ + BFP51486.1|CBM32|GH92 1223 GSASATKGVQYTLtSAaAdKAPKGWTLQGSTDGEKWTDLDRRSGQSFaWDKQTRVFSvaEPGVYQHYRLVLDG 1295 466777889999863334599******************9887765433344444444488878****99833 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1306 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.12 // Query: UUU30266.1|CBM0|CBM32|GH92 [L=1265] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-29 87.0 17.2 1.1e-22 67.1 1.6 4.1 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.1 1.6 1.1e-22 1.1e-22 8 115 .. 91 208 .. 85 217 .. 0.76 2 ? -3.6 0.0 0.78 0.78 71 81 .. 640 650 .. 595 662 .. 0.62 3 ? 1.0 0.5 0.031 0.031 14 43 .. 711 744 .. 704 770 .. 0.72 4 ! 27.9 0.5 1.4e-10 1.4e-10 20 109 .. 1163 1254 .. 1144 1263 .. 0.70 Alignments for each domain: == domain 1 score: 67.1 bits; conditional E-value: 1.1e-22 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgntt 85 +s+++++gg+ en+vDg p+t+W + + w ++dL++p +v ++ lt a+ + +++kd+++++StDgk+W++++++++++ UUU30266.1|CBM0|CBM32|GH92 91 ASGENTDGGEVKENLVDGEPGTKWLTFQptGWAEFDLDQPAKVVTYALTSANdfEtRDPKDWTLQGSTDGKEWKVLDTRSGES 173 35677888899***************75567******************7334657********************9987655 PP CBM32.hmm 86 dgt...te..titfdkpvtaryvRltvtkratnaw 115 + t+ +i+ d++++ r++Rl +tk++ ++ UUU30266.1|CBM0|CBM32|GH92 174 FEErfrTKsyDIPGDATAEYRHFRLDITKNNGASM 208 42245433234455566678*******77442223 PP == domain 2 score: -3.6 bits; conditional E-value: 0.78 CBM32.hmm 71 DgktWttvaek 81 Dg++++tv+++ UUU30266.1|CBM0|CBM32|GH92 640 DGTSFETVKDR 650 77777777655 PP == domain 3 score: 1.0 bits; conditional E-value: 0.031 CBM32.hmm 14 aggggaenavDgd...pntrWssag.qwltvdLg 43 +++++ +++vDg+ +n +W ++ +w + L UUU30266.1|CBM0|CBM32|GH92 711 TPTHTGAKIVDGKvyvNNGFWDTYRtTWPAYSLL 744 455999******9553456999964456555555 PP == domain 4 score: 27.9 bits; conditional E-value: 1.4e-10 CBM32.hmm 20 enavDgdpntrWssagqwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttetitfdk 96 ++D+ +t+ s + tv L +p ++v++t ++ ++ +++++StDg tW++++ +++++ + +t+ f+ UUU30266.1|CBM0|CBM32|GH92 1163 GELFDNTSSTKGSVK----TVPLPTPAGTKAVQYTLtSSdHtEAPTGWTLQASTDGATWKPLDRRSGESFaWDRQTRAFSV 1239 556777555665554....999*************973343599******************9887654333333557774 PP CBM32.hmm 97 pvt.a.ryvRltvtk 109 pv+ a ++Rl+ + UUU30266.1|CBM0|CBM32|GH92 1240 PVPkAyDHYRLVLDD 1254 443344999999933 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1265 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.67 // Query: WNG47600.1|CBM32|GH92 [L=1335] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-26 77.9 19.6 1.7e-20 60.0 1.2 3.8 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.2 1.2 0.6 0.6 11 42 .. 52 100 .. 44 112 .. 0.46 2 ! 60.0 1.2 1.7e-20 1.7e-20 5 120 .. 128 250 .. 124 255 .. 0.79 3 ? -2.1 0.0 0.28 0.28 51 81 .. 1134 1164 .. 1128 1181 .. 0.66 4 ! 29.9 1.4 3.3e-11 3.3e-11 12 122 .. 1217 1329 .. 1208 1331 .. 0.72 Alignments for each domain: == domain 1 score: -3.2 bits; conditional E-value: 0.6 CBM32.hmm 11 ssaaggggaenavDgdpntrWssa.g...............qwl.tvdL 42 +++++g ++++ +D d++t s+ + +w+ tv+L WNG47600.1|CBM32|GH92 52 TDTDAGTDPDAGTDTDAGTDGGSTeTpqdfyssfeaadpqpTWIsTVEL 100 4445557777777777776433321121222111122233434333333 PP == domain 2 score: 60.0 bits; conditional E-value: 1.7e-20 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdg 87 +s ++s ++++++ a ++ Dgd +++W + + w+ +L +p v+++ + a+ + ++++ +++e+S+Dg++Wt +++++n++ WNG47600.1|CBM32|GH92 128 TSVTASGENPPDEIAPRIADGDLTSKWLTFTstGWVRCELAQPIAVKRYAISSANdaPeRDPSAWTLEGSQDGTSWTALDQRSNESF- 214 46667888999999***************74478******************7334547********************99888664. PP CBM32.hmm 88 t...te.titfdkpvta.ryvRltvtkratnawgasia 120 + ++ t +f++ +ta ry+Rl+vt++++++ +ia WNG47600.1|CBM32|GH92 215 SarfEThTYEFTN-TTAyRYYRLNVTANHSGNI-LQIA 250 3346343668885.5666*******77554433.6665 PP == domain 3 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 51 vvltwaen.grikdykvevS.tDgktWttvaek 81 ++++ + + +k++ v++ +g+ +t+ + + WNG47600.1|CBM32|GH92 1134 ITINA--PnNSPKNVYVQALkVNGTAYTKTYVT 1164 55662..12668888888886789888887533 PP == domain 4 score: 29.9 bits; conditional E-value: 3.3e-11 CBM32.hmm 12 saaggggaenavDgdpntrWssag..qwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..te 90 s++g ++++++D+ +t s + ++ + + ++++v+ ++lt + + ++ +++++S+Dg t+tt++e++ +t + t+ WNG47600.1|CBM32|GH92 1217 SSDG-TNPSALFDNTSTTSVSFTAenPSVLYHFTsGARQVTFYTLTS-GtTaVDPMGWTLSGSNDGVTFTTLDERSAQTF-SwrTQ 1299 3345.78******9777766664234457777775889********4.334588*******************9986553.34434 PP CBM32.hmm 91 titfd..kpvtaryvRltvtkratnawgasiaEl 122 t+ f +p y+Rl+ t+a g+s+aEl WNG47600.1|CBM32|GH92 1300 TRAFRvaNPGAYAYYRLEL----TGAAGMSLAEL 1329 445555488767*******....45678999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1335 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 130.77 // Query: XPG69166.1|CBM32|GH92 [L=974] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-12 33.7 1.4 2.2e-12 33.7 1.4 3.4 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.0 0.083 0.083 87 108 .. 201 220 .. 179 239 .. 0.65 2 ? -3.5 0.1 0.77 0.77 24 35 .. 429 440 .. 418 452 .. 0.70 3 ? -0.4 0.6 0.079 0.079 14 35 .. 539 560 .. 529 597 .. 0.77 4 ! 33.7 1.4 2.2e-12 2.2e-12 10 122 .. 846 966 .. 840 968 .. 0.69 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.083 CBM32.hmm 87 gttetitfdkpvtaryvRltvt 108 gt ++it ++ a y+R+t+ XPG69166.1|CBM32|GH92 201 GTRTEITPTD--HAAYFRFTAA 220 2212444432..389****993 PP == domain 2 score: -3.5 bits; conditional E-value: 0.77 CBM32.hmm 24 DgdpntrWssag 35 Dg +trW+s g XPG69166.1|CBM32|GH92 429 DGGWTTRWASPG 440 665568999863 PP == domain 3 score: -0.4 bits; conditional E-value: 0.079 CBM32.hmm 14 aggggaenavDgdpntrWssag 35 ++ g +n++Dg + W+ ++ XPG69166.1|CBM32|GH92 539 NSATGYANIFDGASTGTWAGGW 560 3446789*****6554888753 PP == domain 4 score: 33.7 bits; conditional E-value: 2.2e-12 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag..qwltvdLg.kpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.te 90 +++a+++ g +n++D t Wss+ w++ ++++v ++lt + + +++ +++ +S+Dg +Wtt+++++++ + XPG69166.1|CBM32|GH92 846 ATTASNTTGLKNLNDRTSLTEWSSGAgaAWIQGSTTgTARKVAIYTLTS-SskTgQDPAGWTLKGSNDGIDWTTLDTRQGEV-FAwRR 931 233445589*******6559****8458899765542889999999995.23446********************9987543.33323 PP CBM32.hmm 91 ti.tfd..kpvtaryvRltvtkratnawgasiaEl 122 ++ +f +p +Rl++ + + ++s++E+ XPG69166.1|CBM32|GH92 932 QVrPFVvkTPGAYSTYRLEIGGGVGGGGAVSLSEF 966 44466654555458899999443233445888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (974 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 121.11 // Query: WUX66625.1|CBM0|CBM32|GH92 [L=1288] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-26 79.7 17.1 1.1e-19 57.3 1.5 4.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 57.3 1.5 1.1e-19 1.1e-19 9 118 .. 98 217 .. 93 223 .. 0.73 2 ? -1.8 2.4 0.22 0.22 17 49 .. 733 769 .. 722 864 .. 0.66 3 ! 31.3 0.4 1.2e-11 1.2e-11 17 107 .. 1183 1275 .. 1171 1286 .. 0.73 Alignments for each domain: == domain 1 score: 57.3 bits; conditional E-value: 1.1e-19 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd 86 s ++++gg++ en+vD p+t+W + w+++dL++p +v ++ lt a+ + ++++d+++++S Dgk+W++++ ++++t WUX66625.1|CBM0|CBM32|GH92 98 SDENTSGGETKENLVDVEPSTKWLAFRptGWVEFDLDGPAKVVTYALTSANdhPeRDPRDWTLQGSVDGKEWKDLDHRTGETF 180 3345667799***************74456******************7334547********************99887665 PP CBM32.hmm 87 gt..tetitfd...kpvta.ryvRltvtkra.tnawgas 118 g+ + t+++d +++ a ++Rl +t+++ + + +++ WUX66625.1|CBM0|CBM32|GH92 181 GQrfQ-TKSYDvaaSAAAAyPHYRLDITANNgA-TDATQ 217 55452.334443353344459999999665432.23344 PP == domain 2 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 17 ggaenavDgd...pntrWssag.qwltvdLgkpttvd 49 + +++vDg +n +W ++ +w + L +p++ WUX66625.1|CBM0|CBM32|GH92 733 RTGAKIVDGEvyvNNGFWDTYRtTWPAYSLLTPKKAG 769 5566666665332234666643345444444444433 PP == domain 3 score: 31.3 bits; conditional E-value: 1.2e-11 CBM32.hmm 17 ggaenavDgdpntrWssagqwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt..teti 92 g+ +++D+++ tr + vdL + ++v++t ++ + ++ +++e+S Dg++W+t++++++++ t +t+ WUX66625.1|CBM0|CBM32|GH92 1183 TGPGALFDDSAATRAPVE----SVDLPVASATRAVQYTLtSGtAdRAPTGWRLEGSADGTSWKTLDTRSQES-FTwdSQTR 1258 679999999999985444....7***************974444699******************9986543.44433466 PP CBM32.hmm 93 tfd..kpvtaryvRltv 107 f+ kp t +Rl+ WUX66625.1|CBM0|CBM32|GH92 1259 AFTiaKPGTYANYRLVS 1275 77755776666666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1288 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.83 // Query: WSD92134.1|CBM32|GH92 [L=1242] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-29 88.1 14.6 3.6e-22 65.4 0.6 3.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.4 0.6 3.6e-22 3.6e-22 7 111 .. 69 180 .. 63 193 .. 0.76 2 ? 0.2 0.2 0.053 0.053 15 37 .. 688 714 .. 684 732 .. 0.71 3 ! 29.7 0.7 4e-11 4e-11 22 106 .. 1141 1228 .. 1132 1239 .. 0.71 Alignments for each domain: == domain 1 score: 65.4 bits; conditional E-value: 3.6e-22 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt. 88 a s+++++gg+ en+vDg p+t+W + + w ++dL kp +v ++ lt a+ + ++++d+++ +StDgk+W+t++++++++ ++ WSD92134.1|CBM32|GH92 69 A-SAENTGGGEVKENLVDGEPGTKWLAFEstGWAEFDLAKPLKVVTYALTSANdfGeRDPRDWTLKGSTDGKDWKTLDTRSGESFDEr 155 3.3445667799***************74467******************7334657*********************9876543223 PP CBM32.hmm 89 .tetitfd..kpvtaryvRltvtkra 111 t+++d +p++ +++Rl++tk++ WSD92134.1|CBM32|GH92 156 fR-TKSYDiaDPAEYQHFRLEITKNN 180 31.445555599999*******7743 PP == domain 2 score: 0.2 bits; conditional E-value: 0.053 CBM32.hmm 15 ggggaenavDgd...pntrWssag.qw 37 ++++ +++vDg+ +n +W ++ +w WSD92134.1|CBM32|GH92 688 PTHTGAKIVDGKvyvNNGFWDTYRtTW 714 55999******8553346999963345 PP == domain 3 score: 29.7 bits; conditional E-value: 4e-11 CBM32.hmm 22 avDgdpntrWssagqwltvdLgkpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekgnttd.gttetitfd..kpvta 100 ++D+ ++ +a vdL ++v++ ++t ++ ++ +++++S+Dg+tW+t++ +++++ + +t+ f+ +p t WSD92134.1|CBM32|GH92 1141 LFDN--TSATDAAV--TSVDLPVSRQVKGAQYTVtSSadHaKAPSGWTLQGSDDGTTWKTLDRRSGESFaWDRQTRAFTvrSPGTY 1222 5565..33333333..58***************9733444699******************9877654333334667775566655 PP CBM32.hmm 101 ryvRlt 106 ++Rl+ WSD92134.1|CBM32|GH92 1223 GKYRLV 1228 555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1242 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 86.52 // Query: XCJ16959.1|CBM32|GH92 [L=1218] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-09 24.6 0.6 7.3e-09 22.4 0.1 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.1 0.15 0.15 17 55 .. 173 225 .. 165 267 .. 0.51 2 ! 22.4 0.1 7.3e-09 7.3e-09 46 111 .. 1041 1112 .. 999 1126 .. 0.69 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.15 CBM32.hmm 17 ggaenavDgd.pn.trWss.ag......qw..ltvdLgkpt...tvdkvvltw 55 +++++avD d ++ t + a+ qw vd gk+ t++++ l + XCJ16959.1|CBM32|GH92 173 HQISRAVDQDgIRmTASAQgASrtlktgQWnyKDVDIGKVAkgkTITRILLAY 225 56777788763112221111112333454433577777764222555555554 PP == domain 2 score: 22.4 bits; conditional E-value: 7.3e-09 CBM32.hmm 46 ttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt...tetitfd..kpvtaryvRltvtkra 111 +v+ ++lt a+ + +++k++++ +S+Dg +W t++++++++ t+ f+ +p + +Rl++++++ XCJ16959.1|CBM32|GH92 1041 NRVKMYTLTSsASgRsSDPKSWRLLGSNDGVHWDTLDTRSDESF-AwrsM-TRAFTikNPKSYASYRLEISSKS 1112 5677888886533547*********************9987543.34432.44444447777899999995433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1218 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 132.30 // Query: WBB67815.1|CBM32|GH92 [L=1872] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-30 92.7 25.0 3.2e-22 65.5 5.5 4.9 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.5 5.5 3.2e-22 3.2e-22 6 111 .. 93 206 .. 89 221 .. 0.80 2 ? 1.3 0.0 0.024 0.024 8 34 .. 705 733 .. 698 748 .. 0.68 3 ! 36.8 1.2 2.5e-13 2.5e-13 12 122 .. 1165 1281 .. 1161 1283 .. 0.64 4 ? -3.3 0.2 0.64 0.64 63 82 .. 1661 1676 .. 1587 1704 .. 0.52 5 ? -1.6 0.1 0.2 0.2 17 71 .. 1702 1750 .. 1689 1809 .. 0.53 Alignments for each domain: == domain 1 score: 65.5 bits; conditional E-value: 3.2e-22 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.g 87 + ++s+++a++++a+ + Dg+p+++W + + w+t+ L kp v ++ lt a+ + +++kd+++++StDg+tWt+++++++++ g WBB67815.1|CBM32|GH92 93 AVTASAENAPNETAASLRDGNPSSKWLAFNptGWVTYQLAKPAAVVRYALTSANdaPtRDPKDFTLQGSTDGNTWTDLDTQTGQSFsG 180 45556778888*****************75567******************7334557*********************999887666 PP CBM32.hmm 88 t..tetitfdkpvta.ryvRltvtkra 111 t+t +f++ +ta y+Rl+vt+++ WBB67815.1|CBM32|GH92 181 RfvTKTYSFTN-TTAyGYYRLNVTANS 206 67444778885.5666*******7644 PP == domain 2 score: 1.3 bits; conditional E-value: 0.024 CBM32.hmm 8 essssaaggggaenavDgd...pntrWssa 34 +++s +++++ +++vDg+ +n +W ++ WBB67815.1|CBM32|GH92 705 PTGAS-TPTHTGAKIVDGQiyvNNGFWDTY 733 43444.455*********844334599885 PP == domain 3 score: 36.8 bits; conditional E-value: 2.5e-13 CBM32.hmm 12 saaggggaenavDgdpntrWssagqwltvdLgkpttvdkvvltw.....ae.......n.grikdykvevStDgktWttvaekgnt 84 +a+gg++a++++D++ +v +g+pt ++++ ++ + g++ d+++++S+Dg tWttv++++++ WBB67815.1|CBM32|GH92 1165 TASGGQDASKLFDDSSV---------TQVTFGSPTPQVNWTFRGgkqrpEYytltsgaSaGDPADWRLQGSNDGITWTTVDSRKGE 1241 34566889999999332.........355555555555555553333321123333444799******************997654 PP CBM32.hmm 85 tdgt..tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 + t ++t++f+ k+ + + +Rl+vtk+a a a++aE+ WBB67815.1|CBM32|GH92 1242 E-FTwrNQTRPFKidKTGRFTQFRLVVTKTAG-AAQANLAEI 1281 3.444445778886566667889999987663.344778886 PP == domain 4 score: -3.3 bits; conditional E-value: 0.64 CBM32.hmm 63 dykvevStDgktWttvaekg 82 +y+v v + W t+ +++ WBB67815.1|CBM32|GH92 1661 TYTVHV----TAWDTLSSST 1676 222222....2455554333 PP == domain 5 score: -1.6 bits; conditional E-value: 0.2 CBM32.hmm 17 ggaenavDgdpntrWssagqwltvdLgkpttvdkvvltw.aengrikdykvevStD 71 g + +vDg + ++++ +++tv Lg+ +v++ a + + ++ +S D WBB67815.1|CBM32|GH92 1702 AGDAVIVDG---SGFAAG-EQVTVTLGAG-PAGTVTVAAsA--AGAVHASIATSGD 1750 456667787...555554.3588888754.45555555321..2244555555544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1872 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.48 // Query: UZF71559.1|CBM32|GH92 [L=1436] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-35 109.0 19.1 9.7e-24 70.4 4.1 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 70.4 4.1 9.7e-24 9.7e-24 3 122 .. 87 213 .. 85 215 .. 0.77 2 ? 1.3 0.2 0.024 0.024 9 37 .. 713 744 .. 705 778 .. 0.68 3 ! 44.7 2.2 9e-16 9e-16 12 123 .. 1178 1291 .. 1171 1292 .. 0.78 Alignments for each domain: == domain 1 score: 70.4 bits; conditional E-value: 9.7e-24 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgntt 85 t++sa ss++++gg+ +n+vDg p+t+W s++ w +v+L ++t+++++ + a+ +++kd+++++S+D +tWt++++++++ UZF71559.1|CBM32|GH92 87 TETSA-SSENTGGGEVVANLVDGTPDTKWLSWDptAWAQVNLSEATSITHYAISSANdfDeRDPKDWTLQGSNDASTWTDLDKQTDQA 173 45555.5666777799***************96689******************7334546********************9998876 PP CBM32.hmm 86 dgt...te.titfdkpvta.ryvRltvtkratnawgasiaEl 122 t ++ + ++++p a +y+Rl vt ++ + + +++El UZF71559.1|CBM32|GH92 174 F-TarfQQkDYKLAAPSAAyKYYRLDVTRNN-GGPILQLSEL 213 4.334733355777555566*******5532.2344666665 PP == domain 2 score: 1.3 bits; conditional E-value: 0.024 CBM32.hmm 9 ssssaaggggaenavDgd...pntrWssag.qw 37 +++++a+ ++ +++vDg+ +n +W ++ +w UZF71559.1|CBM32|GH92 713 TGADTAT-QTGSKVVDGQmyvNNGFWDTYRtTW 744 3445555.899******8553346999963334 PP == domain 3 score: 44.7 bits; conditional E-value: 9e-16 CBM32.hmm 12 saaggggaenavDgdpntrWssag.qwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tet 91 +++g ++a +++D+ ++r ++a l++ Lg++ v++++lt + + g++k++ + +S DgktW +++ ++n+t ++t UZF71559.1|CBM32|GH92 1178 TSDG-SDAGALIDN--TSRTQAAVtGALQYQLGSTdEAVTHYTLTS-QtGaGDPKSWVLKGSYDGKTWAVADRQENQTF-AwrQQT 1258 3455.889******..44555542236******7769********4.3446******************8887778765.243456 PP CBM32.hmm 92 itfd..kpvtaryvRltvtkratnawgasiaEla 123 + f+ +p+ y+Rl+vt+++t+a+ a++aE++ UZF71559.1|CBM32|GH92 1259 RAFKvaDPAHYAYYRLEVTATSTGAP-AQLAEFE 1291 68887799999*******88888766.9****95 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1436 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 137.85 // Query: WLS43596.1|CBM32|GH92 [L=1860] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-28 85.6 20.5 2.4e-21 62.7 3.6 4.6 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.7 3.6 2.4e-21 2.4e-21 7 121 .. 80 198 .. 76 205 .. 0.77 2 ? 0.3 0.1 0.05 0.05 6 34 .. 689 719 .. 684 735 .. 0.71 3 ! 31.6 0.7 1e-11 1e-11 12 114 .. 1151 1261 .. 1148 1269 .. 0.67 4 ? -3.8 0.0 0.9 0.9 91 122 .. 1451 1482 .. 1441 1485 .. 0.62 5 ? -3.1 0.3 0.57 0.57 44 92 .. 1685 1731 .. 1683 1760 .. 0.56 Alignments for each domain: == domain 1 score: 62.7 bits; conditional E-value: 2.4e-21 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt. 88 ++s++++++++a+++ Dg p+t+W + + ++t+ L kpt v ++ lt + + +++kd+++++StDg+tWt+++ +++++ + WLS43596.1|CBM32|GH92 80 VTASAENPPNETAAKLADGEPSTKWLAFDrtGSVTYQLTKPTAVVRYALTAaDDePtRDPKDFTLQGSTDGNTWTDLDRRTGQSFAKr 167 3456678898*****************633457*****************7522447********************99988765444 PP CBM32.hmm 89 .te.titfdkpvta.ryvRltvtkratnawgasiaE 121 + t +f++ +ta y+Rl++++ + gasi WLS43596.1|CBM32|GH92 168 fARnTYSFTN-TTAyGYYRLVISA----NSGASIVQ 198 6333779985.5566*******33....34556554 PP == domain 2 score: 0.3 bits; conditional E-value: 0.05 CBM32.hmm 6 saessssaaggggaenavDgd...pntrWssa 34 sa +++s+a+ + +++vDg+ +n +W ++ WLS43596.1|CBM32|GH92 689 SAPTGTSTAT-RTGAKIVDGQiyvNNGFWDTY 719 5666666677.89*******844334599885 PP == domain 3 score: 31.6 bits; conditional E-value: 1e-11 CBM32.hmm 12 saaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..te 90 +a+gg++a++++D++ +t ++ q v g+ ++ + ++lt + + g++ d+++++S+Dg tW t++++ ++ ++ WLS43596.1|CBM32|GH92 1151 TATGGQDAAKLFDDSSTTQLTLGSatpQVSWVARGSRQKPSYYTLTS-GaGaGDAADWRLQGSNDGITWSTLDSRVGEV-FRwrNQ 1234 3456689*******777643222112333346778888888888884.34469*******************9865433.334445 PP CBM32.hmm 91 titfd..kpvtaryvRltvtkra.tna 114 t++f+ kp + + +Rl+vtk+a + + WLS43596.1|CBM32|GH92 1235 TRPFQidKPGRYTQFRLVVTKTAgAAQ 1261 778887788888889999988774323 PP == domain 4 score: -3.8 bits; conditional E-value: 0.9 CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEl 122 ti++ pv+ar + + + +++ n+ ++ ia + WLS43596.1|CBM32|GH92 1451 TIDLHLPVDARSISFIGAGTQGNQSTTGIATF 1482 66666778899999999655544444556655 PP == domain 5 score: -3.1 bits; conditional E-value: 0.57 CBM32.hmm 44 kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttd.gtteti 92 ++tt d+++++ + + +++v v tD + ttva+++ t+ ++ WLS43596.1|CBM32|GH92 1685 AVTTGDAITVD--GsGfAAGEQVTVVVGTDPSRTTTVAASARGTVrA---SV 1731 56666777777..3234667888888888877667887655322212...22 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1860 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 155.61 // Query: XPZ96032.1|CBM32|GH92 [L=1260] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-25 75.9 7.5 9.7e-17 47.8 0.5 4.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.8 0.5 9.7e-17 9.7e-17 7 112 .. 86 198 .. 81 210 .. 0.72 2 ? 1.7 0.2 0.018 0.018 12 46 .. 702 740 .. 693 778 .. 0.72 3 ! 27.8 0.1 1.6e-10 1.6e-10 38 107 .. 1170 1246 .. 1111 1257 .. 0.78 Alignments for each domain: == domain 1 score: 47.8 bits; conditional E-value: 9.7e-17 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt. 88 a ss+++++g+ a n+vD t+W + + w++++L++p + k+ lt a+ +++k + + +S+Dg +Wtt++++++++ ++ XPZ96032.1|CBM32|GH92 86 A-SSENTGAGEVARNLVDATSATKWLAPEpkPWVEFELEEPVKAVKYALTSANdhDeRDPKGWILKGSKDGDSWTTLDTREDQSFPEr 172 3.2334555599*******999*****86678*********8888888886334546*********************9988766444 PP CBM32.hmm 89 .teti.tfdkpvta.ryvRltvtkrat 112 ++++ ++ + ++a ++Rl++t+++ XPZ96032.1|CBM32|GH92 173 fQQKVyDIGS-ADAyAHYRLEFTANNG 198 6333335543.34449******66442 PP == domain 2 score: 1.7 bits; conditional E-value: 0.018 CBM32.hmm 12 saaggggaenavDgd...pntrWssag.qwltvdLgkpt 46 ++++++ +++vDg+ +n +W ++ +w + L +p+ XPZ96032.1|CBM32|GH92 702 PDTPTETGAKIVDGKvyvNNGFWDTYRtTWPAYSLLTPK 740 34455899******8553446999964456666665555 PP == domain 3 score: 27.8 bits; conditional E-value: 1.6e-10 CBM32.hmm 38 ltvdLgkpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..kpvtaryvRltv 107 tvdL + ++v++t ++ + + +k++ +++S Dgk+W+++++++++t ++t++f+ +p t ++Rl++ XPZ96032.1|CBM32|GH92 1170 KTVDLPVAGGTKAVQYTLtSSaePgQAPKSWVLQGSADGKKWRDLDKRSGETF-AwaKQTRPFSiaEPGTYEHYRLVA 1246 3899999999999999997334447********************98776443.23346779998899999****999 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1260 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 126.96 // Query: WNE99398.1|CBM32|GH92 [L=1285] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-29 89.2 14.2 7.2e-22 64.4 2.9 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.4 2.9 7.2e-22 7.2e-22 8 122 .. 101 222 .. 95 224 .. 0.75 2 ! 3.7 0.2 0.0043 0.0043 8 41 .. 724 760 .. 717 792 .. 0.71 3 ! 26.8 0.4 3.1e-10 3.1e-10 39 120 .. 1198 1279 .. 1177 1283 .. 0.72 Alignments for each domain: == domain 1 score: 64.4 bits; conditional E-value: 7.2e-22 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gtt 89 +s++++agg++ en+vDg +t+W + + wl++dL +p + ++ lt a+ + +++kd+++ +S +g++Wtt+++++++t + + WNE99398.1|CBM32|GH92 101 ASGENTAGGETKENLVDGEVTTKWLAVDttAWLEFDLSEPVEAVRYALTSANdaPgRDPKDWTLKGSANGSDWTTLDTRKDETFsSRQ 188 357788899*****************53368*********8888888886334557*********************99877653443 PP CBM32.hmm 90 e..titfdkpvta.ryvRltvtkratnawgasiaEl 122 + ++tfd+ ta +++Rl+++ + +++ ++aE+ WNE99398.1|CBM32|GH92 189 QtrEFTFDN-GTAyQHFRLEISRN-AGDDLIQLAEV 222 323557774.5566*******443.33333777776 PP == domain 2 score: 3.7 bits; conditional E-value: 0.0043 CBM32.hmm 8 essssaaggggaenavDgd...pntrWssag.qwltvd 41 + + +++++++ +++vDg+ +n +W ++ +w + WNE99398.1|CBM32|GH92 724 A-TGENTPTHTGAKIVDGKvyvNNGFWDTYRtTWPAYS 760 3.4455566*********95534569999644464444 PP == domain 3 score: 26.8 bits; conditional E-value: 3.1e-10 CBM32.hmm 39 tvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..kpvtaryvRltvtkratnawga 117 vdL + ++v++t ++ + ++ + +++S Dgk+W++++ +++++ t ++t+ f+ +p t ++Rl+++++ a WNE99398.1|CBM32|GH92 1198 SVDLPVTEAGRAVQYTLtSSdRgKAPTGWVLQGSRDGKDWKDLDRRSDES-FTwdKQTRVFSvrTPGTYEHYRLVANGK------A 1276 699999999999*999974344699******************9887755.444444556665599999******9432......3 PP CBM32.hmm 118 sia 120 +a WNE99398.1|CBM32|GH92 1277 TLA 1279 444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1285 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 159.49 // Query: BFE48354.1|CBM32|GH92 [L=1383] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-30 92.9 11.8 3.4e-20 59.0 2.2 3.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.0 2.2 3.4e-20 3.4e-20 6 121 .. 56 178 .. 51 206 .. 0.77 2 ? -0.1 0.0 0.065 0.065 14 37 .. 681 708 .. 671 723 .. 0.70 3 ! 37.2 0.6 1.9e-13 1.9e-13 15 122 .. 1133 1237 .. 1125 1239 .. 0.71 Alignments for each domain: == domain 1 score: 59.0 bits; conditional E-value: 3.4e-20 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt 88 +a+s++++ag + en+vDg++ ++W + + w+ + + +p v+++ +t a+ + ++++d+++ +S+Dg+tWtt+++++++ t BFE48354.1|CBM32|GH92 56 AANSEYAEAG-EVKENLVDGNTASKWLTFTrtGWVRFTFPEPVAVKRYAMTSANdaPeRDPRDWTLRGSNDGSTWTTLDTRAGEA-FT 141 4555566666.99***************75567******************7334547*********************987644.44 PP CBM32.hmm 89 te..titfdkpvtaryvRltvtkratnawg...asiaE 121 ++ t+ +d +++a +Rl+ + ++n+ g ++aE BFE48354.1|CBM32|GH92 142 ERfqTKAYD-TANAEAFRLYQLDISANQGGvglIQLAE 178 223255776.4678888888855443332223455555 PP == domain 2 score: -0.1 bits; conditional E-value: 0.065 CBM32.hmm 14 aggggaenavDgd...pntrWssag.qw 37 +++++ +++vDg+ +n +W ++ +w BFE48354.1|CBM32|GH92 681 TPTQTGAKVVDGKiyvNNGFWDTYRtTW 708 444889******9543345999853334 PP == domain 3 score: 37.2 bits; conditional E-value: 1.9e-13 CBM32.hmm 15 ggggaenavDgdpntrWssag.qwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd 95 +g+++ ++D+ +t + wl+vdL+ k + ++lt + + g+++++ + +S DgktW tv+e+++ t ++t+ f+ BFE48354.1|CBM32|GH92 1133 VTGAPASVLDNTSQTAG---SlSWLQVDLKdKKEKAEFYTLTS-SkGsGDPSSWVLKGSYDGKTWSTVDERSGVTFaHRQQTRAFK 1214 34789999999444433...2459******5556666667773.3446*********************98876654444577888 PP CBM32.hmm 96 ..kpvtaryvRltvtkratnawgasiaEl 122 + +++Rl++ + ++s+aE+ BFE48354.1|CBM32|GH92 1215 iaRAGHYQHYRLEFPG------TVSVAEV 1237 6566668999999933......2667665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1383 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 163.92 // Query: BFF16777.1|CBM32 [L=394] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-18 53.9 5.8 3.2e-18 52.6 5.8 1.6 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 52.6 5.8 3.2e-18 3.2e-18 9 116 .. 99 214 .. 94 225 .. 0.77 Alignments for each domain: == domain 1 score: 52.6 bits; conditional E-value: 3.2e-18 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt...teti. 92 +s +++++++a+n+ D + t+W + w+t++ +pt +++++lt a+ ++++++++++StDg+tW+t++e++++ t ++++ BFF16777.1|CBM32 99 ASGENPPNETAANLADWSSATKWLTFArtGWITYETSEPTALTGYSLTSANdfAdRDPRSWTLQGSTDGETWQTLDERTDER-FTerfQRRVf 190 56778888*********999*****74467******************7334556*********************998754.4434545555 PP CBM32.hmm 93 tfdkpvt.aryvRltvtkra.tnawg 116 ++d++++ +++Rl +t ++ + g BFF16777.1|CBM32 191 ELDAATEpYTWFRLDITRNNgS--DG 214 888444436*******664322..23 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (394 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.02 // Query: CAM1104641.1|CBM32|GH92 [L=1152] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-08 20.5 0.0 7.1e-08 19.2 0.0 1.7 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.2 0.0 7.1e-08 7.1e-08 22 124 .] 1029 1137 .. 1019 1137 .. 0.69 Alignments for each domain: == domain 1 score: 19.2 bits; conditional E-value: 7.1e-08 CBM32.hmm 22 avDgdpnt.rWssag.qwltvdLg.kpttvdkvvltw.aen.grikdykvevStDgktWttvaekgnttdgt..tetitfd..k 96 + Dgd+ t ++ ++ v + ++++v ++lt a + + d+++++S Dg+ W++++ + ++ ++ + f + CAM1104641.1|CBM32|GH92 1029 LADGDAATsSVLDGShPTIDVHFTdGARRVLMYTLTSaA-TgHGPGDWQLQGSRDGSRWHVLDRRHGEA-FRwpQQLRAFGvtE 1110 668877762333322445999998788999999999651.3367******************9876543.33533433666558 PP CBM32.hmm 97 pvtaryvRltvtkra.tnawgasiaElae 124 p + y+Rl++ ++ ++a +++++E+++ CAM1104641.1|CBM32|GH92 1111 PGDYIYYRLRI--DNgNDAGPVALSEIQW 1137 88899999999..5533344488888875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1152 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 183.42 // Query: XCG64760.1|CBM32|GH92 [L=2108] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-26 79.4 15.5 2e-20 59.7 4.4 4.1 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.7 4.4 2e-20 2e-20 7 111 .. 124 236 .. 119 249 .. 0.77 2 ! 24.7 0.7 1.4e-09 1.4e-09 43 122 .. 1242 1324 .. 1200 1326 .. 0.67 3 ? -3.4 0.1 0.68 0.68 69 101 .. 1348 1387 .. 1346 1410 .. 0.55 Alignments for each domain: == domain 1 score: 59.7 bits; conditional E-value: 2e-20 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt. 88 ++s+++a+g++a+ + D + +t+W + + w ++ L +++tv +++lt a+ +++k++++++S Dg+tWttv++++++ ++ XCG64760.1|CBM32|GH92 124 VTASAENAPGEPAASLADANSSTKWLAFQrtGWAQYRLTSAQTVAAYSLTSANdsDdRDPKSWTIQGSPDGTTWTTVDSRTDQAFPDr 211 4456667777*****************75567******************7334447*********************9998876554 PP CBM32.hmm 89 ..tetitfdkpvtaryvRltvtkra 111 t++ t+++p+ y+Rl +t+++ XCG64760.1|CBM32|GH92 212 faTKQYTVATPAAYLYYRLDITANN 236 64334455566656999**995533 PP == domain 2 score: 24.7 bits; conditional E-value: 1.4e-09 CBM32.hmm 43 gkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..kpvtaryvRltvtkra.tnawgasia 120 ++p v++++lt + + + ++ +++e+S+Dg +Wt ++++++++ t+t+ f+ +p+ + +Rl vt++ +++ s+a XCG64760.1|CBM32|GH92 1242 QGPVAVTTYTLT--GaaTgDAPSAWTLEGSNDGDSWTALDNRSDQDF-RwaTQTRAFSiaDPTLFTRYRLHVTATGgAGS--PSLA 1322 356788888888..3344699*******************9987653.34445668887688767999999966543333..5888 PP CBM32.hmm 121 El 122 E+ XCG64760.1|CBM32|GH92 1323 EF 1324 88 PP == domain 3 score: -3.4 bits; conditional E-value: 0.68 CBM32.hmm 69 StDgk..tWttvaekgnttdgt.tetitfd.....kpvtar 101 StD + W +v+ +n + + t t++f+ +p+t+ XCG64760.1|CBM32|GH92 1348 STDSSsrAWAVVKGGSNDP-ADyTATVDFQdgagpQPATVS 1387 6664322688775433332.222236666655544554444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (2108 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 198.26 // Query: WXH41524.1|CBM32|GH92 [L=1288] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-27 81.7 6.7 4.9e-20 58.5 0.1 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.5 0.1 4.9e-20 4.9e-20 9 122 .. 102 222 .. 95 224 .. 0.76 2 ? -1.4 0.1 0.16 0.16 17 34 .. 764 789 .. 726 821 .. 0.74 3 ! 24.8 0.2 1.3e-09 1.3e-09 18 107 .. 1179 1270 .. 1169 1282 .. 0.66 Alignments for each domain: == domain 1 score: 58.5 bits; conditional E-value: 4.9e-20 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt... 88 s+++a++g+ en+vDg t+W + + wl++ L +p + ++ lt a+ + ++++d+++ +S+Dg++Wt+++ ++++ WXH41524.1|CBM32|GH92 102 SGENAEAGEVKENLVDGESATKWLTFDraAWLEFTLSEPVKAVRYALTSANdaPgRDPRDWTLKGSDDGSHWTVLDVREGQAFERrlq 189 3455566699*******999*****85578*********7777777775335557********************8776655433452 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEl 122 t++++f +v+ r++Rl + +++ + ++++aE+ WXH41524.1|CBM32|GH92 190 TREFSFGGAVSYRHYRLDIAHNS-GGAATQLAEV 222 2355666999*********4443.3455888887 PP == domain 2 score: -1.4 bits; conditional E-value: 0.16 CBM32.hmm 17 ggaenavDg......dpn...trWssa 34 +a+++vDg d + +rWs+ WXH41524.1|CBM32|GH92 764 KSAAKLVDGfvqqykD-GgwtSRWSAP 789 4688888885554422.2353477774 PP == domain 3 score: 24.8 bits; conditional E-value: 1.3e-09 CBM32.hmm 18 gaenavDgdpn..trWssagqwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd..k 96 + ++++D+ t + + + + +v++++lt + + + + + +StDg++Wt+v+ +++++ + +t+ f+ + WXH41524.1|CBM32|GH92 1179 SGSALTDDTSAtdTSFTT----ASLRVPAGSRVTSYTLTS-AdRaRAPEGWVLKGSTDGEEWTQVDRRAGESFaWDRQTRVFSvrA 1259 456677774331134444....455566667899999995.234599******************988765543333345666558 PP CBM32.hmm 97 pvtaryvRltv 107 p + r++Rl+ WXH41524.1|CBM32|GH92 1260 PGRYRHYRLES 1270 88899999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1288 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 159.76 // Query: XQH34361.1|CBM32|GH92 [L=1264] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-29 88.3 21.0 7.1e-23 67.6 2.1 4.7 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.6 2.1 7.1e-23 7.1e-23 7 111 .. 91 202 .. 85 217 .. 0.77 2 ! 2.7 0.3 0.009 0.009 10 37 .. 705 736 .. 698 751 .. 0.72 3 ? -2.2 0.1 0.29 0.29 24 34 .. 760 778 .. 742 840 .. 0.54 4 ? -1.3 0.0 0.16 0.16 59 78 .. 1088 1108 .. 1072 1113 .. 0.78 5 ! 28.8 0.4 7.4e-11 7.4e-11 20 109 .. 1161 1253 .. 1149 1262 .. 0.71 Alignments for each domain: == domain 1 score: 67.6 bits; conditional E-value: 7.1e-23 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt. 88 a ss++++gg+ en+vDg +t+W + w+++dL+kp ++ ++ lt a+ ++++d+++++StDgk+W+t++++++++ + XQH34361.1|CBM32|GH92 91 A-SSENTGGGEVKENLVDGESGTKWLTFAstGWVEFDLDKPAKIVTYALTSANdfAeRDPRDWTLSGSTDGKDWKTLDTRSGESFADr 177 3.4556677799*******999*****63367******************7334546*********************9876554333 PP CBM32.hmm 89 .te.titfdkpvtaryvRltvtkra 111 ++ + ++++p++ +++Rl +tk++ XQH34361.1|CBM32|GH92 178 fQTkSYDLAEPAEYQHFRLDITKNN 202 533255666999*********7743 PP == domain 2 score: 2.7 bits; conditional E-value: 0.009 CBM32.hmm 10 sssaaggggaenavDgd...pntrWssag.qw 37 +s+++++++ +++vDg+ +n +W ++ +w XQH34361.1|CBM32|GH92 705 TSQDTPTHTGAKIVDGKvyvNNGFWDTYRtTW 736 4566677*********9553346999863334 PP == domain 3 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 24 DgdpntrWss........a 34 Dg ++rWss + XQH34361.1|CBM32|GH92 760 DGGWTSRWSSpgyadlmtG 778 3323357777433333320 PP == domain 4 score: -1.3 bits; conditional E-value: 0.16 CBM32.hmm 59 grikdykvevS.tDgktWttv 78 + +k++ v++ +gktWt+ XQH34361.1|CBM32|GH92 1088 NSTKNIYVQGLkVNGKTWTKT 1108 55788888887689****975 PP == domain 5 score: 28.8 bits; conditional E-value: 7.4e-11 CBM32.hmm 20 enavDgdpntrWssagqwltvdLgkpttvdkvvltw..ae.n.grikdykvevStDgktWttvaekgnttdgt...teti.tfdkp 97 +++D+ ++ +++ vdL ++ ++v++t ++ ++ +++++S Dg++W+t++++++++ t ++++ ++++p XQH34361.1|CBM32|GH92 1161 GALFDN--TSATEATV--TSVDLPVAKATKGVQYTLtsSKdHtLAPTGWTLQGSADGTSWKTLDKRSGES-FTwdrQTRVfSVKSP 1241 567777..33444443..68***************9852243589******************9876644.444433333366677 PP CBM32.hmm 98 vtaryvRltvtk 109 ++Rl+ ++ XQH34361.1|CBM32|GH92 1242 GAYAHYRLVLNG 1253 766999999833 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1264 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.67 // Query: XVL68929.1|CBM32|GH92 [L=1273] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-28 85.4 8.7 3e-19 55.9 1.5 3.9 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 55.9 1.5 3e-19 3e-19 9 111 .. 102 212 .. 95 229 .. 0.77 2 ? -1.0 0.2 0.13 0.13 16 37 .. 720 745 .. 712 783 .. 0.72 3 ? -1.1 0.0 0.13 0.13 19 43 .. 1105 1135 .. 1085 1140 .. 0.64 4 ! 30.7 0.0 1.9e-11 1.9e-11 22 121 .. 1172 1268 .. 1163 1271 .. 0.69 Alignments for each domain: == domain 1 score: 55.9 bits; conditional E-value: 3e-19 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt... 88 s+++aa+g++ en+vD + +t+W + w+++dL++p +v ++ lt a+ ++++d+++ +S Dgk+W++++ ++++t ++ XVL68929.1|CBM32|GH92 102 SGENAASGETKENLVDLQSGTKWLVFEptAWIEFDLDAPVKVVTYALTSANdaAeRDPRDWTLKGSADGKEWKVLDGREGQTFSKrfe 189 466778889*********9******75578******************7334546********************9887766533342 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkra 111 t+t++f++++ ++Rl++tk+a XVL68929.1|CBM32|GH92 190 TRTFDFANDTAYAHYRLEITKNA 212 234555566656*******8855 PP == domain 2 score: -1.0 bits; conditional E-value: 0.13 CBM32.hmm 16 gggaenavDgd...pntrWssag.qw 37 + + +++vDg+ +n +W ++ +w XVL68929.1|CBM32|GH92 720 TRTGAKIVDGKvyvNNGFWDTYRtTW 745 46789999998553345898853334 PP == domain 3 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 19 aenavDgdpntrWssag.........qwltvdLg 43 vDg rW s+ lt+d+g XVL68929.1|CBM32|GH92 1105 QGLKVDG---KRWDSTAlphallakgGRLTFDMG 1135 4555788...799995333334444456999998 PP == domain 4 score: 30.7 bits; conditional E-value: 1.9e-11 CBM32.hmm 22 avDgdpntrWssagqwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttetitfdkpvtaryv 103 ++D+ ++ ++ v+L ++ v++v++t ++ + + + + +++S Dg+tWt+++ +++++ + +t+ f+ ++++ y XVL68929.1|CBM32|GH92 1172 LFDD--TSATEAPV--ASVELPVAKPVRAVQYTLtSSaRdRAPAGWVLQGSADGTTWTDLDRRSEESFaWDRQTRAFSVAAPGSYA 1253 5666..33444444..789**************974445699******************98866543333347788855556666 PP CBM32.hmm 104 RltvtkratnawgasiaE 121 +++ a+ +g ++aE XVL68929.1|CBM32|GH92 1254 KYRL--VAA-GTGGALAE 1268 6655..222.13455555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1273 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 149.30 // Query: XQV58743.1|CBM32|GH92 [L=1432] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-27 81.9 9.6 8e-21 61.0 2.2 3.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.0 2.2 8e-21 8e-21 8 120 .. 87 206 .. 81 213 .. 0.77 2 ? -0.7 0.1 0.1 0.1 13 40 .. 716 747 .. 703 765 .. 0.66 3 ! 23.7 0.1 2.9e-09 2.9e-09 43 122 .. 1205 1286 .. 1175 1288 .. 0.64 Alignments for each domain: == domain 1 score: 61.0 bits; conditional E-value: 8e-21 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt. 88 + s +++++++a+++vD + +t+W w+ v +++p + ++ lt a+ + ++++d+++++S Dg++Wt+++++++++ XQV58743.1|CBM32|GH92 87 TGSGENPPNETAARVVDQNVSTKWLVFAsaGWVRVRFDEPVAIVHYALTSANdaPeRDPRDWTLQGSADGESWTDLDSRTGQEFaERf 174 4567788889**************9963367******************7334547*********************99887653446 PP CBM32.hmm 89 .tetitfdkpvta.ryvRltvtkratnawgasia 120 t++ ++d+ +ta ry+Rl vt+ a + +++a XQV58743.1|CBM32|GH92 175 qTREYRLDN-TTAyRYYRLDVTAVAGGGI-TQLA 206 334778885.5566*******66443222.3444 PP == domain 2 score: -0.7 bits; conditional E-value: 0.1 CBM32.hmm 13 aaggggaenavDgd...pntrWssag.qwltv 40 ++++++ + +vDg+ +n +W ++ +w + XQV58743.1|CBM32|GH92 716 STPTETGAEVVDGKvyvNNGFWDTYRtTWSAY 747 3344889999***8553345888853345444 PP == domain 3 score: 23.7 bits; conditional E-value: 2.9e-09 CBM32.hmm 43 gkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..kpvtaryvRltvtkra.tnawgasiaE 121 g+p v++++lt + g+++ +++++S Dg Wt++++++++t +t+ f+ ++ry ++ t + t+ + a++aE XQV58743.1|CBM32|GH92 1205 GAPELVTHYTLTS-QaAaGDPTGWTLSGSYDGRRWTVLDSRSDETF-AwrSQTRAFPvqH--PGRYGHYRLTPTGsTGGP-AALAE 1285 6889999*****5.23359********************9987554.2333577888534..566655555445534444.77888 PP CBM32.hmm 122 l 122 + XQV58743.1|CBM32|GH92 1286 V 1286 6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1432 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 173.12 // Query: XDQ05343.1|CBM32|GH92 [L=1264] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-29 87.1 22.0 6.7e-23 67.7 2.1 4.6 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.7 2.1 6.7e-23 6.7e-23 7 111 .. 91 202 .. 85 217 .. 0.77 2 ! 2.7 0.3 0.009 0.009 10 37 .. 705 736 .. 698 751 .. 0.72 3 ? -2.2 0.1 0.29 0.29 24 34 .. 760 778 .. 742 840 .. 0.54 4 ? -3.3 0.1 0.63 0.63 59 77 .. 1088 1107 .. 1078 1109 .. 0.73 5 ! 29.1 0.5 5.8e-11 5.8e-11 20 109 .. 1161 1253 .. 1149 1262 .. 0.71 Alignments for each domain: == domain 1 score: 67.7 bits; conditional E-value: 6.7e-23 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt. 88 a ss++++gg+ en+vDg +t+W + + w+++dL+kp ++ ++ lt a+ ++++d+++++StDgk+W+t++++++++ + XDQ05343.1|CBM32|GH92 91 A-SSENTGGGEVKENLVDGESGTKWLTFEstGWVEFDLDKPAKIVTYALTSANdfAeRDPRDWTLSGSTDGKDWKTLDTRSGESFADr 177 3.4556677799*******999*****74467******************7334546*********************9876554333 PP CBM32.hmm 89 .te.titfdkpvtaryvRltvtkra 111 ++ + ++++p++ +++Rl +tk++ XDQ05343.1|CBM32|GH92 178 fQTkSYDLAEPAEYQHFRLDITKNN 202 533255666999*********7743 PP == domain 2 score: 2.7 bits; conditional E-value: 0.009 CBM32.hmm 10 sssaaggggaenavDgd...pntrWssag.qw 37 +s+++++++ +++vDg+ +n +W ++ +w XDQ05343.1|CBM32|GH92 705 TSQDTPTHTGAKIVDGKvyvNNGFWDTYRtTW 736 4566677*********9553346999863334 PP == domain 3 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 24 DgdpntrWss........a 34 Dg ++rWss + XDQ05343.1|CBM32|GH92 760 DGGWTSRWSSpgyadlmtG 778 3323357777433333320 PP == domain 4 score: -3.3 bits; conditional E-value: 0.63 CBM32.hmm 59 grikdykvevS.tDgktWtt 77 + +k++ v++ +g tWt+ XDQ05343.1|CBM32|GH92 1088 NSTKNIYVQGLkVNGRTWTK 1107 4577788887768999**97 PP == domain 5 score: 29.1 bits; conditional E-value: 5.8e-11 CBM32.hmm 20 enavDgdpntrWssagqwltvdLgkpttvdkvvltw..ae.n.grikdykvevStDgktWttvaekgnttdgt...teti.tfdkp 97 +++D+ ++ +++ vdL ++ ++v++t ++ ++ +++++S Dg++W+t++++++++ t ++++ ++++p XDQ05343.1|CBM32|GH92 1161 GALFDN--TSATEATV--TSVDLPVAKATKGVQYTLtsSKdHtLAPTGWTLQGSADGTSWKTLDKRSGES-FTwdrQTRVfSVKSP 1241 567777..33444443..68***************9852243589******************9876644.444433333466677 PP CBM32.hmm 98 vtaryvRltvtk 109 ++Rl+ ++ XDQ05343.1|CBM32|GH92 1242 GAYAHYRLVLNS 1253 766999999944 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1264 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 78.94 // Query: XLX06256.1|CBM32|GH92 [L=1266] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-27 82.7 15.1 2.3e-22 66.0 2.8 4.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.0 2.8 2.3e-22 2.3e-22 9 111 .. 94 206 .. 87 220 .. 0.76 2 ? -0.4 1.3 0.079 0.079 15 40 .. 712 741 .. 708 838 .. 0.78 3 ! 22.6 0.1 6.2e-09 6.2e-09 48 107 .. 1189 1253 .. 1160 1265 .. 0.68 Alignments for each domain: == domain 1 score: 66.0 bits; conditional E-value: 2.3e-22 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt... 88 s++++++g+ en+vD p+t+W + + w+++dL+kp +++++ lt a+ +++ d+++++StDgk+W+t++++++++ ++ XLX06256.1|CBM32|GH92 94 SGENTGAGEVKENLVDTEPSTKWLTFEptGWVEFDLDKPAKITRYALTSANdhDeRDPADWTLQGSTDGKDWKTLDTRTGESFPErfq 181 3555666699***************74567******************7334546*********************998765544453 PP CBM32.hmm 89 tetitfd....kpvtaryvRltvtkra 111 t +t+d ++++ r++Rl vt ++ XLX06256.1|CBM32|GH92 182 T--KTYDiaetAAAEYRHYRLDVTRNH 206 2..3333335556678*******6643 PP == domain 2 score: -0.4 bits; conditional E-value: 0.079 CBM32.hmm 15 ggggaenavDgd...pntrWssag.qwltv 40 ++++ +++vDg+ +n +W ++ +w + XLX06256.1|CBM32|GH92 712 PTHTGAKIVDGKvyvNNGFWDTYRtTWPAY 741 458889999998553345888853345444 PP == domain 3 score: 22.6 bits; conditional E-value: 6.2e-09 CBM32.hmm 48 vdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..kpvtaryvRltv 107 +++lt + ++ +++++S+Dg+tW+t++++++++ t +t+ f+ +p + ++Rl+ XLX06256.1|CBM32|GH92 1189 AVQYTLTS-SadHtKAPTGWTLQGSSDGTTWRTLDKRSGES-FTwdRQTRAFSvgSPGPYEKYRLVL 1253 44455553.2333599******************9876644.4443346677776777778888877 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1266 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 87.14 // Query: XLH02102.1|CBM0|CBM32|GH92 [L=1709] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-30 92.1 9.1 8.1e-21 61.0 1.7 3.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.0 1.7 8.1e-21 8.1e-21 6 122 .. 89 212 .. 84 214 .. 0.80 2 ! 33.9 1.0 1.9e-12 1.9e-12 9 122 .. 1182 1301 .. 1174 1303 .. 0.71 Alignments for each domain: == domain 1 score: 61.0 bits; conditional E-value: 8.1e-21 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgn 83 + ++s+++++++ +n++D +++t+W + + wl++++ +p ++ k+ +t a+ + +++k++k+++S+Dg++Wt+++++++ XLH02102.1|CBM0|CBM32|GH92 89 EVTASANNPPNEIEANLIDRSAQTKWLAFEptAWLQFKFPEPVNLVKYAFTSANdaQgRDPKNWKLYGSKDGEEWTEIDSRTD 171 4556777888899***************75578*********9999999997334668*********************9998 PP CBM32.hmm 84 ttdgt..teti.tfdkpvtaryvRltvtkratnawgasiaEl 122 ++ + ++++ +f++ + +y+++ +t++a + +++aE+ XLH02102.1|CBM0|CBM32|GH92 172 ESFEKrfERKVyEFENENSYTYYKFDITENAGDGL-TQLAEI 212 66533465566699955568*******88664333.677776 PP == domain 2 score: 33.9 bits; conditional E-value: 1.9e-12 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkp.ttvdkvvltwae..n.grikdykvevStDgktWttvaekgn 83 +s ++++ g a++++D++ +t ++ w+++ ++ + + ++lt + + +++k++ + +S+Dg++Wt v+e+++ XLH02102.1|CBM0|CBM32|GH92 1182 TSIHSDE-GVANALFDNSSRTGLTFESerPWIQYHFEDQsGKALMYTLTS-SddKkQDPKSWVLIGSNDGNDWTIVDERTD 1260 3444555.89*******98885444333579*****95514666666663.34556******************9999987 PP CBM32.hmm 84 ttdgt.te.titfd..kpvtaryvRltvtkratnawgasiaEl 122 ++ + + t++f+ +p + y+Rl v+++ ++a ++s+aE+ XLH02102.1|CBM0|CBM32|GH92 1261 ED-FKwRKfTKPFEiiNPGEYAYYRLIVKDN-QGASSTSLAEI 1301 54.444334778889899999*******443.44555889987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1709 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 192.00 // Query: BFE68994.1|CBM32 [L=269] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-19 54.5 0.7 8.4e-19 54.5 0.7 1.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.3 0.1 0.62 0.62 74 82 .. 48 56 .. 35 68 .. 0.59 2 ! 54.5 0.7 8.4e-19 8.4e-19 12 121 .. 86 202 .. 77 205 .. 0.76 Alignments for each domain: == domain 1 score: -3.3 bits; conditional E-value: 0.62 CBM32.hmm 74 tWttvaekg 82 +Wt+ ++ + BFE68994.1|CBM32 48 DWTDTVDAD 56 677665433 PP == domain 2 score: 54.5 bits; conditional E-value: 8.4e-19 CBM32.hmm 12 saaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt.teti.tfdk 96 + +g++ga n++Dgd t+W ++ w ++ L +p + ++ lt a+ + ++++d+++++S Dg+ Wttv++++++t +++i ++++ BFE68994.1|CBM32 86 EPNGNEGAGNLNDGDSATKWLVDTptSWAQYTLAAPAEAIRYALTSANdaPeRDPRDWTLQGSADGTAWTTVDTRTGQTFaERfQTRIyEVAN 178 3345699***************86678*********9999999997334547**********************9987764446556668888 PP CBM32.hmm 97 pvtaryvRltvtkratnawgasiaE 121 p++ +Rl +t+ +++ +++aE BFE68994.1|CBM32 179 PASFPIYRLSITGHPSGNL-TQLAE 202 8877888888854323222.55665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (269 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.22 // Query: XLW92097.1|CBM32|GH92 [L=1022] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-11 31.4 0.0 5.1e-11 29.3 0.0 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.3 0.0 0.31 0.31 18 37 .. 472 495 .. 466 510 .. 0.67 2 ! 29.3 0.0 5.1e-11 5.1e-11 18 112 .. 908 1008 .. 902 1020 .. 0.68 Alignments for each domain: == domain 1 score: -2.3 bits; conditional E-value: 0.31 CBM32.hmm 18 gaenavDgd...pntrWssag.qw 37 + +++vDg +n +W ++ w XLW92097.1|CBM32|GH92 472 TGAKVVDGElyvNNGFWDTYRtAW 495 67899***8443345998863345 PP == domain 2 score: 29.3 bits; conditional E-value: 5.1e-11 CBM32.hmm 18 gaenavDgdpntrWss..ag..qwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetitf 94 g++++ D+ r ++ + ++t+ + +p++v ++lt + + g+++d+ +e+S+Dg W+t++e++++ +t++f XLW92097.1|CBM32|GH92 908 GIAALSDNTS--RTQAvfRTprPTITFTADgEPREVVLYTLTS-GsSaGDPQDWVLEGSDDGRRWRTLDERSGEV-FRwrRQTRPF 989 5667777733..4334221234458888886889999999994.3446********************9987644.3343346677 PP CBM32.hmm 95 d..kpvtaryvRltvtkra.t 112 +p+ r++Rl+v ra t XLW92097.1|CBM32|GH92 990 VlaDPAACRHYRLRV--RAsT 1008 77788766*******..4422 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1022 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 152.15 // Query: XQV85967.1|CBM0|CBM32|GH92 [L=1874] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-26 79.0 21.7 2.6e-21 62.6 2.3 4.9 6 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.6 2.3 2.6e-21 2.6e-21 6 109 .. 93 204 .. 90 220 .. 0.73 2 ? -2.1 0.1 0.27 0.27 36 78 .. 348 410 .. 315 433 .. 0.54 3 ? 0.3 0.1 0.05 0.05 6 34 .. 703 733 .. 698 747 .. 0.71 4 ! 26.8 0.9 3.2e-10 3.2e-10 17 111 .. 1170 1271 .. 1162 1283 .. 0.58 5 ? -2.4 0.2 0.33 0.33 59 72 .. 1726 1739 .. 1662 1777 .. 0.58 6 ? -2.8 0.0 0.46 0.46 33 54 .. 1810 1830 .. 1793 1840 .. 0.73 Alignments for each domain: == domain 1 score: 62.6 bits; conditional E-value: 2.6e-21 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgn 83 +a++s+++++++ a+n++Dg+p+t+W + + wlt+ L +p v+++ lt + + ++++d+++++StDg+tW++++ +++ XQV85967.1|CBM0|CBM32|GH92 93 AATASAQNPPNEIAANLTDGNPSTKWLAFEptAWLTYQLAEPAVVKRYALTSaDDePgRDPRDFTLQGSTDGSTWVDLDRQTK 175 4555777889899***************75578******************7522447********************98766 PP CBM32.hmm 84 ttdgt..tetitfd.kpvta.ryvRltvtk 109 + + t ++ +++ta ++Rl +++ XQV85967.1|CBM0|CBM32|GH92 176 QRFAKrfA-TNRYGvTNTTAyGWYRLAISA 204 54333331.223333345555788887733 PP == domain 2 score: -2.1 bits; conditional E-value: 0.27 CBM32.hmm 36 qw..ltvdLgkp...ttvdkvvltw....ae.....ngrikdykvevSt...Dg...ktWttv 78 qw + dLg++ +t+d++ l + a+ +g d++v +S Dg +++++ XQV85967.1|CBM0|CBM32|GH92 348 QWnaVSADLGAVargKTIDRILLAYddpqATeetlfQGWLDDVEVTGSPaaiDGsrlTNYVDT 410 444488889877333488888888664431133332255556666666434455333345544 PP == domain 3 score: 0.3 bits; conditional E-value: 0.05 CBM32.hmm 6 saessssaaggggaenavDgd...pntrWssa 34 sa +++s+a+ + +++vDg+ +n +W ++ XQV85967.1|CBM0|CBM32|GH92 703 SAPTGTSTAT-RTGAKIVDGQiyvNNGFWDTY 733 5666666677.89*******844334599885 PP == domain 4 score: 26.8 bits; conditional E-value: 3.2e-10 CBM32.hmm 17 ggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt.. 88 ++a+ ++D++ +t +++ w t g+ ++ + +++t + g++ d+++++StDg tW+t+++++++ XQV85967.1|CBM0|CBM32|GH92 1170 QDASTLFDDSSTTQLTASSgtpqiGW-T-TRGGRQQPTYYTITS-GaAaGDPADWRLQGSTDGLTWNTLDSRADEV-FRwr 1246 56777777766665444312321112.2.234455556667774.23359********************998754.3344 PP CBM32.hmm 89 tetitfd..kpvtaryvRltv..tkra 111 ++t++f kp +ry R++ tk+ XQV85967.1|CBM0|CBM32|GH92 1247 NQTRPFRidKP--GRYSRFRLvvTKTV 1271 45667774366..57776666324432 PP == domain 5 score: -2.4 bits; conditional E-value: 0.33 CBM32.hmm 59 grikdykvevStDg 72 g++++++v++S g XQV85967.1|CBM0|CBM32|GH92 1726 GTTREVTVSASATG 1739 33444444444444 PP == domain 6 score: -2.8 bits; conditional E-value: 0.46 CBM32.hmm 33 sagqwltvdLgkpttvdkvvlt 54 + +++tv Lg ++v +v+ + XQV85967.1|CBM0|CBM32|GH92 1810 PN-ETITVSLGDGRRVGTVRAN 1830 22.579*******999999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1874 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 166.12 // Query: XRD82931.1|CBM32|GH92 [L=1115] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-14 38.1 0.1 2.7e-11 30.2 0.0 3.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.4 0.0 0.0055 0.0055 32 54 .. 140 190 .. 123 207 .. 0.51 2 ? -1.4 0.0 0.16 0.16 13 35 .. 538 563 .. 532 581 .. 0.69 3 ! 30.2 0.0 2.7e-11 2.7e-11 21 121 .. 1007 1109 .. 996 1112 .. 0.74 Alignments for each domain: == domain 1 score: 3.4 bits; conditional E-value: 0.0055 CBM32.hmm 32 ss................ag.......qw..ltvdLgkpt...tvdkvvlt 54 s+ ++ qw lt+dLgk+ +v+++vl XRD82931.1|CBM32|GH92 140 SAsqaqdqhripanahalGTsrtvyvnQWnkLTIDLGKVAagrRVRHIVLS 190 4433333333322222220023344454555******99622255555554 PP == domain 2 score: -1.4 bits; conditional E-value: 0.16 CBM32.hmm 13 aaggggaenavDgd...pntrWssag 35 ++++++ +++vDg+ +n +W ++ XRD82931.1|CBM32|GH92 538 NTPTQTGARIVDGKvfvNNGFWDTYR 563 34558899*****8664456998853 PP == domain 3 score: 30.2 bits; conditional E-value: 2.7e-11 CBM32.hmm 21 navDgdpntrWssag..qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttd.gtte.titfd..kpv 98 +++D +t + g + + +p+ v +++t + ++++++e+S+Dgk+W+++++++++ t + t+ f +p XRD82931.1|CBM32|GH92 1007 ALFDHTSDTEVQLPGsqAAVSWHFPEPRAVAMYTFTS-AkQaPAPSNWTLEASDDGKHWKVLDTRKDEHFpWT-RqTRAFGihQPG 1090 5667666665555433445888899***********5.245689*******************9987655333.437788899999 PP CBM32.hmm 99 taryvRltvtkratnawgasiaE 121 + y+R+++ n+ + ++aE XRD82931.1|CBM32|GH92 1091 PYAYYRIRFD----NDAPKALAE 1109 99*******3....333344555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1115 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 147.55 // Query: BFZ39494.1|CBM32|GH92 [L=1551] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1551 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 992.28 // Query: XMG36282.1|CBM32|GH92 [L=1255] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-29 88.8 7.1 2.8e-18 52.8 0.3 3.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 52.8 0.3 2.8e-18 2.8e-18 11 122 .. 73 190 .. 64 192 .. 0.74 2 ? 0.7 0.0 0.037 0.037 36 56 .. 317 346 .. 283 381 .. 0.73 3 ! 36.5 1.1 3.1e-13 3.1e-13 12 122 .. 1133 1249 .. 1123 1251 .. 0.71 Alignments for each domain: == domain 1 score: 52.8 bits; conditional E-value: 2.8e-18 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt..tet 91 ++ +g ++++avD dp t W+ +lt+ L+++t v +++lt a+ + ++++++++++S Dg++W+ v+++ +++ ++ + t XMG36282.1|CBM32|GH92 73 ATGDG-TTPAAAVDHDPATGWQVPAtrGTLTLALKATTAVVTYTLTSARdnPaSDPRTWSLQGSADGTHWQAVDDRRDQDFSQrgQ-T 158 33344.89***************633567*****************7335347********************9987765333332.4 PP CBM32.hmm 92 itfd..kpvtaryvRltvtkra.tnawgasiaEl 122 + f+ p r++Rl v +a ++++ ++aE+ XMG36282.1|CBM32|GH92 159 RVFAvaHPGAYRHYRLDV--SAnHGDTSLQLAEI 190 45554477767*******..44344556889887 PP == domain 2 score: 0.7 bits; conditional E-value: 0.037 CBM32.hmm 36 qw..ltvdLg..kp.ttvdkvvltw....a 56 qw +t dLg ++ +tv +++ltw + XMG36282.1|CBM32|GH92 317 QWnqVTADLGafAAgKTVARIQLTWagpgD 346 3444999999553348********964321 PP == domain 3 score: 36.5 bits; conditional E-value: 3.1e-13 CBM32.hmm 12 saaggggaenavDgdpntrWss...ag.qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.. 88 +a+g+ + +++vD+ t + a+ ++ + L ++++v ++++t + + ++ ++++++StDg +Wt+++ +++++ XMG36282.1|CBM32|GH92 1133 AAPGTTTTAAVVDNTSATV--AdlpATgGSVGFTLPAAHQVEQYTVTA-GsaEgADPASWTLSGSTDGIQWTVLDRRQDQKF-Awr 1214 5667778999999944453..322312457*****************5.3344699******************98877654.244 PP CBM32.hmm 89 tetitfd..kpvtaryvRltvtkra.tnawgasiaEl 122 +et+ f+ k ry+Rl a +a ++s+aEl XMG36282.1|CBM32|GH92 1215 NETRVFTpsKSGAYRYYRLDL--AAaPGAAKTSVAEL 1249 55556665454545******9..44333455888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1255 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 155.75 // Query: XEM72220.1|CBM0|CBM32|GH92 [L=1435] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-33 102.4 20.5 8.6e-23 67.4 1.8 4.2 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.4 1.8 8.6e-23 8.6e-23 6 120 .. 89 210 .. 84 214 .. 0.76 2 ? 1.7 0.3 0.019 0.019 9 37 .. 714 745 .. 706 797 .. 0.71 3 ? -1.0 0.0 0.12 0.12 59 77 .. 1100 1119 .. 1082 1137 .. 0.79 4 ! 41.5 4.2 8.9e-15 8.9e-15 12 123 .. 1178 1290 .. 1174 1291 .. 0.75 Alignments for each domain: == domain 1 score: 67.4 bits; conditional E-value: 8.6e-23 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgn 83 sa+ s++++gg+ a+n++Dg+++t+W s++ ++t+ L +pt+++++ + a+ + ++++d+++++S+D ++Wt+++++++ XEM72220.1|CBM0|CBM32|GH92 89 SAT-SENTGGGEVAANLIDGSTGTKWLSWDpaASVTFTLSAPTSITHYAISSANdfPgRDPRDWTLQGSNDAQQWTDLDKQSG 170 454.556667799***************966778*****************7334657********************98877 PP CBM32.hmm 84 ttd.gt.te.titfdkpvta.ryvRltvtkratnawgasia 120 ++ + ++ + ++++p a +y+Rl+vt+++ + ++++ XEM72220.1|CBM0|CBM32|GH92 171 QSFaNRfQQnDYKLAAPSAAyTYYRLNVTGNNG-DSIMQMS 210 777566743366777555566*******55332.2224444 PP == domain 2 score: 1.7 bits; conditional E-value: 0.019 CBM32.hmm 9 ssssaaggggaenavDgdp..nt.rWssag.qw 37 +++++a+ + +++vDg++ n+ +W ++ +w XEM72220.1|CBM0|CBM32|GH92 714 TGTDTAT-RTGSKIVDGQTyvNNgFWDTYRtTW 745 3445555.899******6422223788853334 PP == domain 3 score: -1.0 bits; conditional E-value: 0.12 CBM32.hmm 59 grikdykvevS.tDgktWtt 77 + +k++ v++ +gk+Wt XEM72220.1|CBM0|CBM32|GH92 1100 NSAKNVYVQGLkVNGKNWTS 1119 56888999988789****96 PP == domain 4 score: 41.5 bits; conditional E-value: 8.9e-15 CBM32.hmm 12 saaggggaenavDgdpntrWssag.qwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt 88 +++g ++a+++vD+ ++r +++ +++ L+++ v++++lt + + g++k++++ +S Dgk+Wt+++++++++ + XEM72220.1|CBM0|CBM32|GH92 1178 TSDG-SDASALVDN--TSRTQAKVtGAVQYQLKSTdEAVTHYTLTS-GtGaGDAKSWTLKGSYDGKNWTVADQQTDQSFPW 1254 3455.89*******..55556642236******7769********4.3446******************888887765533 PP CBM32.hmm 89 .tetitfd..kpvtaryvRltvtkratnawgasiaEla 123 ++t+ f+ +p+ y+Rl+v +at+ +a +aE++ XEM72220.1|CBM0|CBM32|GH92 1255 rQQTRAFAvkNPAHYAYYRLEV--TATTGGPATLAEFE 1290 445667777699999*******..55333348899985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1435 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 161.48 // Query: BGA68410.1|CBM32|GH92 [L=741] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-23 67.4 1.0 2.6e-22 65.8 1.0 1.8 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.8 1.0 2.6e-22 2.6e-22 7 111 .. 90 203 .. 84 221 .. 0.76 Alignments for each domain: == domain 1 score: 65.8 bits; conditional E-value: 2.6e-22 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt 88 a+ s++a++g+ en+vDg p+++W + + w ++dL++p +v ++ lt a+ ++++d+++ +S Dg++Wtt+++++++t BGA68410.1|CBM32|GH92 90 AS-SENAGAGEVKENLVDGEPSSKWLAFTstGWAEFDLDAPVEVVRYALTSANdfApRDPRDWTLKGSADGENWTTLDTRSGETFaER 176 43.334455599***************74478******************7334656*********************9877665343 PP CBM32.hmm 89 .teti.tfd.kpvta.ryvRltvtkra 111 ++++ ++d ++v + r++Rl++t + BGA68410.1|CBM32|GH92 177 fQTKVyDLDaSAVAGyRHFRLEITRNG 203 6455558888677656*******6533 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (741 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 151.74 // Query: XKQ93433.1|CBM32|GH92 [L=1298] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-28 85.1 14.0 9.3e-22 64.0 3.3 3.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.0 3.3 9.3e-22 9.3e-22 9 112 .. 112 223 .. 106 235 .. 0.75 2 ? -2.5 0.1 0.37 0.37 16 42 .. 744 774 .. 735 808 .. 0.58 3 ! 27.2 0.3 2.4e-10 2.4e-10 22 107 .. 1197 1282 .. 1185 1295 .. 0.69 Alignments for each domain: == domain 1 score: 64.0 bits; conditional E-value: 9.3e-22 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt..t 89 s++++++g++ e++vDg +t+W + w++++L++p +v ++ lt a+ + +++kd+k+++StDgk+W++++++++++ + t XKQ93433.1|CBM32|GH92 112 SGENTGAGETKEKLVDGEQSTKWLTFKptGWVEFELDAPAKVVTYALTSANdhQeRDPKDWKLQGSTDGKDWKDLDTRTGEKFASpfT 199 3455666699***************63456******************7334667*********************988655444453 PP CBM32.hmm 90 e.titfdkpvta.ryvRltvtkrat 112 + + +f++++ a ++Rl +t+++ XKQ93433.1|CBM32|GH92 200 TkKYDFENTA-AySHYRLDITANNG 223 3244777544.44*******66442 PP == domain 2 score: -2.5 bits; conditional E-value: 0.37 CBM32.hmm 16 gggaenavDgdp...ntrWssag.qwltvdL 42 +++ +++v g+p n +W ++ +w + L XKQ93433.1|CBM32|GH92 744 THTGAKIVEGKPyvnNGFWDTYRtTWPAYSL 774 4777777777742213477765333444433 PP == domain 3 score: 27.2 bits; conditional E-value: 2.4e-10 CBM32.hmm 22 avDgdpntrWssagqwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd..kpvtar 101 ++D++ +t+ +a v L + + ++v++t + + ++ + +++S Dg++W+tv+++++++ +++t++f+ +p + XKQ93433.1|CBM32|GH92 1197 LFDNSSTTYANAA----SVVLPVQGRTKAVQYTLtSAdKaKAPRGWVLQGSRDGEKWKTVDKRSGQSFaWDQQTRPFTvsDP--GS 1276 7888666666655....4555555555555555543345699******************9987766544455779996555..57 PP CBM32.hmm 102 yvRltv 107 yv+++ XKQ93433.1|CBM32|GH92 1277 YVKYRL 1282 877765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1298 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 167.60 // Query: UUS33479.1|CBM0|CBM32|GH92 [L=1282] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-27 82.2 1.2 2.1e-18 53.2 0.2 3.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.2 0.2 2.1e-18 2.1e-18 9 119 .. 92 210 .. 86 215 .. 0.78 2 ? 1.7 0.1 0.018 0.018 13 40 .. 716 747 .. 707 807 .. 0.78 3 ! 23.3 0.0 3.8e-09 3.8e-09 39 109 .. 1185 1261 .. 1163 1275 .. 0.68 Alignments for each domain: == domain 1 score: 53.2 bits; conditional E-value: 2.1e-18 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd 86 s+++a++g++ en++D p+t+W + wl++ L++p v ++ lt a+ ++++ +++ +S Dg+ Wt++++++n+t UUS33479.1|CBM0|CBM32|GH92 92 SGEHAEAGETKENLLDSEPTTKWLTLAptAWLEFTLEEPLPVVSYALTSANdhAaRDPRAWTLHGSADGTRWTPLDTRENETF 174 466777779****************53457******************7334547*********************9998776 PP CBM32.hmm 87 gt...tetitfdkpvtaryvRltvtkratna.wgasi 119 ++ t+t f+++++ ++Rl++t+++ a + ++ UUS33479.1|CBM0|CBM32|GH92 175 PErfrTRTYHFANTTRYAHYRLEITANNG-ApATLQL 210 44464457799988889999****55432.2133555 PP == domain 2 score: 1.7 bits; conditional E-value: 0.018 CBM32.hmm 13 aaggggaenavDgd...pntrWssag.qwltv 40 ++++++ +++vDg+ +n +W ++ +w + UUS33479.1|CBM0|CBM32|GH92 716 DTPTHTGAKIVDGKvyvNNGFWDTYRtTWPAY 747 445599*******8553446999963445444 PP == domain 3 score: 23.3 bits; conditional E-value: 3.8e-09 CBM32.hmm 39 tvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt...teti.tfdkpvtaryvRltvtk 109 v+L p v++v++t + + + +e+StDg W++v+ ++++ ++++ t++ p r +Rl++ + UUS33479.1|CBM0|CBM32|GH92 1185 AVELPVPGPVRAVQYTLtSAaAaAAPDGWVLEGSTDGARWREVDRRSGEVF-RwdrQTRVfTVARPGAYRAYRLVAAD 1261 688999999*******973334599******************98775443.33333333355577666*****9933 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1282 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 166.07 // Query: UTP30477.1|CBM0|CBM32|GH92 [L=1285] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-27 82.6 11.5 3.8e-21 62.1 3.1 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.1 3.1 3.8e-21 3.8e-21 7 122 .. 101 222 .. 95 224 .. 0.75 2 ! 3.4 0.2 0.0054 0.0054 8 41 .. 724 760 .. 717 794 .. 0.71 3 ! 20.4 0.0 3e-08 3e-08 22 107 .. 1185 1272 .. 1176 1282 .. 0.70 Alignments for each domain: == domain 1 score: 62.1 bits; conditional E-value: 3.8e-21 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a s ++++gg+ en+vDg +++W + + wl++dL +p + ++ lt a+ + +++kd+++ +S +g++Wtt+++++++ UTP30477.1|CBM0|CBM32|GH92 101 A-SDENTDGGEIKENLVDGEVTSKWLAFDttAWLEFDLSEPVKAVRYALTSANdaPgRDPKDWTLKGSANGSDWTTLDTRKDE 182 3.4556677799*******999*****74478*********7777777775335557*********************99877 PP CBM32.hmm 85 td.gt.te.titfdkpvtaryvRltvtkratnawgasiaEl 122 t + ++ +++fd+ + +++Rl++t +a ++ +++aE+ UTP30477.1|CBM0|CBM32|GH92 183 TFsSRqQTrEFSFDSSTAYQHFRLEITRNAGDDI-VQLAEV 222 6534442236677755445*******77554344.888887 PP == domain 2 score: 3.4 bits; conditional E-value: 0.0054 CBM32.hmm 8 essssaaggggaenavDgd...pntrWssag.qwltvd 41 +++++ +++++ +++vDg+ +n +W ++ +w + UTP30477.1|CBM0|CBM32|GH92 724 AAGEN-TPTHTGAKIVDGKvyvNNGFWDTYRtTWPAYS 760 33444.555*********95534569999644564444 PP == domain 3 score: 20.4 bits; conditional E-value: 3e-08 CBM32.hmm 22 avDgdpntrWssagqwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt..te.ti.tfd 95 ++D+ +t + + vdL ++ ++v++t ++ + ++ + +++S Dg++W++++ +++++ + ++ ++ +++ UTP30477.1|CBM0|CBM32|GH92 1185 LLDNTSGTEAAFE----SVDLPVTKPGRAVQYTLtSSdRgKAPTGWVLQGSPDGEKWRDLDRRSGESF-SwdKQtRVfSVK 1260 5666444544333....699**9999*******974444699******************98765443.334332333555 PP CBM32.hmm 96 kpvtaryvRltv 107 +p ++Rl+ UTP30477.1|CBM0|CBM32|GH92 1261 NPGVYEHYRLVP 1272 777678888875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1285 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 165.38 // Query: WFB85266.1|CBM0|CBM32|GH92 [L=1269] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-27 82.8 13.7 1.6e-21 63.3 1.3 3.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.3 1.3 1.6e-21 1.6e-21 7 112 .. 94 207 .. 88 221 .. 0.78 2 ? 0.9 0.8 0.031 0.031 12 37 .. 711 740 .. 702 774 .. 0.72 3 ! 24.5 0.2 1.6e-09 1.6e-09 21 106 .. 1166 1255 .. 1153 1266 .. 0.69 Alignments for each domain: == domain 1 score: 63.3 bits; conditional E-value: 1.6e-21 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a+ +++++gg+ en+ D+ p+t+W + w+++dL++pt++ k+ lt a+ + ++++d+++ +S Dg++W+t+++++++ WFB85266.1|CBM0|CBM32|GH92 94 AS-AENTNGGEVKENLADNEPGTKWLTFAptGWVEFDLDAPTKIVKYALTSANdhSeRDPRDWTLKGSADGESWQTLDTRSGE 175 33.344556699***************74457******************7334546*********************98765 PP CBM32.hmm 85 tdgt..te.titfdkpvtaryvRltvtkra.t 112 t g+ t+ t +++++++ +++Rl++tk++ + WFB85266.1|CBM0|CBM32|GH92 176 TFGEpfTTkTYDLAEAAEFQHFRLEITKNNgA 207 5555443325566699999*******875533 PP == domain 2 score: 0.9 bits; conditional E-value: 0.031 CBM32.hmm 12 saaggggaenavDgd...pntrWssag.qw 37 +++++++ +++vDg+ +n +W ++ +w WFB85266.1|CBM0|CBM32|GH92 711 ENTPTETGAKVVDGKvyvNNGFWDTYRtTW 740 44556999******8553346999863345 PP == domain 3 score: 24.5 bits; conditional E-value: 1.6e-09 CBM32.hmm 21 navDgdpntrWssagqwltvdLg.kpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekgnttd.gttetitfd 95 +++D+ ++ ++ vdL + + +++++t ++ + + +k+++S DgktW+t++ +++++ + +t+ f+ WFB85266.1|CBM0|CBM32|GH92 1166 ALFDD--TSATDATV--ASVDLPvADKGAKALQYTLtSSadRtKAPAGWKLQGSADGKTWRTLDRRSGESFaWDRQTRAFS 1242 55666..33334443..6899996668999999998733454699******************987765433333355776 PP CBM32.hmm 96 ..kpvtaryvRlt 106 +p t ++Rl+ WFB85266.1|CBM0|CBM32|GH92 1243 vkSPGTYAKYRLV 1255 5466665555655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1269 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.42 // Query: XBQ35554.1|CBM0|CBM32|GH92 [L=1285] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-27 82.6 11.5 3.8e-21 62.1 3.1 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.1 3.1 3.8e-21 3.8e-21 7 122 .. 101 222 .. 95 224 .. 0.75 2 ! 3.4 0.2 0.0054 0.0054 8 41 .. 724 760 .. 717 794 .. 0.71 3 ! 20.4 0.0 3e-08 3e-08 22 107 .. 1185 1272 .. 1176 1282 .. 0.70 Alignments for each domain: == domain 1 score: 62.1 bits; conditional E-value: 3.8e-21 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a s ++++gg+ en+vDg +++W + + wl++dL +p + ++ lt a+ + +++kd+++ +S +g++Wtt+++++++ XBQ35554.1|CBM0|CBM32|GH92 101 A-SDENTDGGEIKENLVDGEVTSKWLAFDttAWLEFDLSEPVKAVRYALTSANdaPgRDPKDWTLKGSANGSDWTTLDTRKDE 182 3.4556677799*******999*****74478*********7777777775335557*********************99877 PP CBM32.hmm 85 td.gt.te.titfdkpvtaryvRltvtkratnawgasiaEl 122 t + ++ +++fd+ + +++Rl++t +a ++ +++aE+ XBQ35554.1|CBM0|CBM32|GH92 183 TFsSRqQTrEFSFDSSTAYQHFRLEITRNAGDDI-VQLAEV 222 6534442236677755445*******77554344.888887 PP == domain 2 score: 3.4 bits; conditional E-value: 0.0054 CBM32.hmm 8 essssaaggggaenavDgd...pntrWssag.qwltvd 41 +++++ +++++ +++vDg+ +n +W ++ +w + XBQ35554.1|CBM0|CBM32|GH92 724 AAGEN-TPTHTGAKIVDGKvyvNNGFWDTYRtTWPAYS 760 33444.555*********95534569999644564444 PP == domain 3 score: 20.4 bits; conditional E-value: 3e-08 CBM32.hmm 22 avDgdpntrWssagqwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt..te.ti.tfd 95 ++D+ +t + + vdL ++ ++v++t ++ + ++ + +++S Dg++W++++ +++++ + ++ ++ +++ XBQ35554.1|CBM0|CBM32|GH92 1185 LLDNTSGTEAAFE----SVDLPVTKPGRAVQYTLtSSdRgKAPTGWVLQGSPDGEKWRDLDRRSGESF-SwdKQtRVfSVK 1260 5666444544333....699**9999*******974444699******************98765443.334332333555 PP CBM32.hmm 96 kpvtaryvRltv 107 +p ++Rl+ XBQ35554.1|CBM0|CBM32|GH92 1261 NPGVYEHYRLVP 1272 777678888875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1285 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 165.71 // Query: BGA18059.1|CBM0|CBM32|GH92 [L=1370] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-31 93.6 15.4 2e-24 72.6 3.4 4.1 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.6 3.4 2e-24 2e-24 8 122 .. 52 174 .. 46 176 .. 0.78 2 ? 1.0 0.1 0.031 0.031 9 37 .. 665 696 .. 657 711 .. 0.67 3 ? -1.9 0.0 0.24 0.24 49 78 .. 1041 1070 .. 987 1090 .. 0.64 4 ! 25.1 0.7 1e-09 1e-09 17 122 .. 1122 1224 .. 1116 1239 .. 0.69 Alignments for each domain: == domain 1 score: 72.6 bits; conditional E-value: 2e-24 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLg.kpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 ++s ++a+++g ++++Dg++nt+W w+t+d+g +p+t++k+++ a+ + +++kd+++++S+Dg++Wt+v++++++ BGA18059.1|CBM0|CBM32|GH92 52 AASGENAPNEGVDKINDGNINTKWLVFAatGWVTFDFGaGPQTIKKYSVSSANdaPeRDPKDWTLQGSNDGTNWTVVDTRTGQ 134 346667777****************963457*******999*********7334547*********************99876 PP CBM32.hmm 85 tdgt..teti.tfdkpvtaryvRltvtkra.tnawgasiaEl 122 + + ++++ ++++p++ r++++ +t+++ + ++i+E+ BGA18059.1|CBM0|CBM32|GH92 135 DFAErfQTKVyDVTSPASYRHYKIDITANHgV--NLVQISEI 174 5433464555588899999*******664422..33777776 PP == domain 2 score: 1.0 bits; conditional E-value: 0.031 CBM32.hmm 9 ssssaaggggaenavDgd...pntrWssag.qw 37 ++++ +++ + +++vDg+ +n +W ++ +w BGA18059.1|CBM0|CBM32|GH92 665 AGAN-TPTKTGAKIVDGKiyvNNGFWDTYRtTW 696 3444.444899******9543345999863344 PP == domain 3 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 49 dkvvltwaen.grikdykvevS.tDgktWttv 78 +k+v++ + + +k++ v++ +gk W + BGA18059.1|CBM0|CBM32|GH92 1041 KKLVINA--PkNSAKNIYVQGVkVNGKAWSKT 1070 4555552..22567888888665788888764 PP == domain 4 score: 25.1 bits; conditional E-value: 1e-09 CBM32.hmm 17 ggaenavDgdpntrWssagqwltvdLgkpttvdkvvltw..ae.n.grikdykvevStDgktWttvaekgnttdgt.te.t 91 +a ++vD++ +t +d++++ k +++ + + ++++++ +S DgktW tv+++++++ + ++ t BGA18059.1|CBM0|CBM32|GH92 1122 VSAGALVDNNSTTSAVVR----SFDFKAADAKEKAEFYTltNAkSgKSPSSWELKASYDGKTWATVDKRSGEN-FQwQQyT 1197 468889999877754433....45555555555555554432244699******************9876543.3344535 PP CBM32.hmm 92 itfd..kpvtaryvRltvtkratnawgasiaEl 122 ++f+ +p + ++Rl++++ +++aE+ BGA18059.1|CBM0|CBM32|GH92 1198 RSFKiaSPGRYNFYRLEFSE------DVALAEF 1224 58887788888999999933......2555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1370 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 159.38 // Query: WAL69172.1|CBM0|CBM32|GH92 [L=1263] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-33 102.1 7.5 5.4e-25 74.5 0.4 2.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 74.5 0.4 5.4e-25 5.4e-25 6 111 .. 83 195 .. 78 207 .. 0.76 2 ! 29.8 1.6 3.5e-11 3.5e-11 16 109 .. 1153 1250 .. 1144 1260 .. 0.73 Alignments for each domain: == domain 1 score: 74.5 bits; conditional E-value: 5.4e-25 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgn 83 +a+ +++++g+ a n++Dg+p t+W + + w+++ L +pt ++++ +t a+ + +++kd+++++S Dg+tWtt++++++ WAL69172.1|CBM0|CBM32|GH92 83 TAS-DENTGAGEVALNLIDGKPETKWLAFSptGWVQFALTEPTAITHYAVTSANdaPtRDPKDWTLQGSADGQTWTTIDQQSG 164 443.334455599***************75567******************7334557********************98877 PP CBM32.hmm 84 ttd.gt.tetitfd..kpvtaryvRltvtkra 111 ++ + + t +f +p+t ry+R+++t+++ WAL69172.1|CBM0|CBM32|GH92 165 QSFpNRfQ-TLNFRlaAPATYRYYRMNITANS 195 76645443.44555559999********6543 PP == domain 2 score: 29.8 bits; conditional E-value: 3.5e-11 CBM32.hmm 16 gggaenavDgdpntrWssagqwltvdLgkp.ttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.te. 90 + + ++++D+ + t ++ +++ L ++ v+ ++lt + + ++++ + + +S+Dg +Wt++++++n+ t + WAL69172.1|CBM0|CBM32|GH92 1153 TASDAALFDNTTATEATAS--AVQYQLSAAaDPVTYYTLTS-GkgTgSDPTGWVLKGSNDGVNWTVLDARQNQG-FTwRDq 1229 4567899***776754444..4******65389*******5.344469*******************9987754.445333 PP CBM32.hmm 91 titfd..kpvtaryvRltvtk 109 t++f +p + +Rl++t+ WAL69172.1|CBM0|CBM32|GH92 1230 TRPFRvaQPGHYTTYRLEFTG 1250 557776688878888888844 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1263 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 176.18 // Query: XCO73712.1|CBM32|GH92 [L=1146] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-13 36.1 1.4 8.3e-13 35.1 0.0 2.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.47 0.47 93 107 .. 345 362 .. 320 377 .. 0.64 2 ? -3.6 0.1 0.79 0.79 17 34 .. 570 590 .. 563 602 .. 0.65 3 ! 35.1 0.0 8.3e-13 8.3e-13 17 107 .. 1031 1125 .. 1020 1141 .. 0.72 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.47 CBM32.hmm 93 tfd...kpvtaryvRltv 107 +f ++++a y+R+++ XCO73712.1|CBM32|GH92 345 SFGhdqETARADYYRVRF 362 444445566799***999 PP == domain 2 score: -3.6 bits; conditional E-value: 0.79 CBM32.hmm 17 ggaenavDgd...pntrWssa 34 + + +vDg+ +n +W ++ XCO73712.1|CBM32|GH92 570 ATGATVVDGKvfvNNGFWDTY 590 567888999855334588875 PP == domain 3 score: 35.1 bits; conditional E-value: 8.3e-13 CBM32.hmm 17 ggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd. 95 +a++++D+d +t + ++ +++p tv+ ++lt + + g+++ + +++S+Dg++Wtt++e++++ +t+ f+ XCO73712.1|CBM32|GH92 1031 KQAAALFDDDSGTGVRLNVpmPSIAWTFKRPATVHLYTLTS-SaKrGDAQAWALQGSNDGEQWTTLDERSGQAF-AwrRQTRAFAl 1114 56999****99996655423456*****************5.3456*********************9877654.33334668885 PP CBM32.hmm 96 .kpvtaryvRltv 107 +p a y R++ XCO73712.1|CBM32|GH92 1115 aQP--ASYSRYRL 1125 466..56666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1146 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 154.66 // Query: XPG40981.1|CBM32|GH92 [L=987] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.1 8.8 2.2e-14 40.2 4.8 2.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.2 0.1 0.025 0.025 89 112 .. 201 222 .. 117 252 .. 0.71 2 ! 40.2 4.8 2.2e-14 2.2e-14 11 121 .. 864 981 .. 858 985 .. 0.70 Alignments for each domain: == domain 1 score: 1.2 bits; conditional E-value: 0.025 CBM32.hmm 89 tetitfdkpvt.aryvRltvtkrat 112 +++it + + a y+R+tv ++at XPG40981.1|CBM32|GH92 201 KTEITPT---DhAAYFRFTVPASAT 222 2244333...327999999955332 PP == domain 2 score: 40.2 bits; conditional E-value: 2.2e-14 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag..qwltvdLg..kpttvdkvvltwae...n.grikdykvevStDgktWttvaekgnttdgt.. 88 ss+++ g+ n+ D d +t W+sa+ w++ d +p +v ++ ++ +++k++k+ +S+Dg tW+t++e+ n++ + XPG40981.1|CBM32|GH92 864 SSSTT-GQSGNLYDRDSDTAWQSASanAWIEADAAagQPASVPRIYTLTSGtqgAdQDPKSWKLKASKDGATWVTLDERRNESF-Qwr 949 22233.6899*************866889999876226667777755543244447*********************9887653.343 PP CBM32.hmm 89 tetitfd.kpvtaryvRltvtkratnawgasiaE 121 ++t++f+ k+ t y R++++ ++t+++++ +E XPG40981.1|CBM32|GH92 950 QQTRPFAlKAGTESYSRYRIEFDNTGTMTV--SE 981 458899997777777777773344544534..33 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (987 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.67 // Query: BFT71548.1|CBM32 [L=1212] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-16 46.4 13.4 8.8e-16 44.7 11.0 3.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.7 11.0 8.8e-16 8.8e-16 10 108 .. 48 162 .. 40 186 .. 0.71 2 ? -0.8 0.1 0.11 0.11 28 72 .. 183 225 .. 176 282 .. 0.59 Alignments for each domain: == domain 1 score: 44.7 bits; conditional E-value: 8.8e-16 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag...qw..ltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt...te 90 s++++++++a +++D+++nt+W a+ w +++++g ++ v+k+ + a+ +++k++++e+S+Dg +W++++e++n++ +e BFT71548.1|CBM32 48 SKENQPNETAVKLFDNNANTKWLGAQttnVWvqVQFNYGDTQAVSKYAMVSANdaAtRDPKNWRIEGSNDGLSWNVLDEQSNQSFsARfqtKE 140 5667888*****************733464433899999***********7334546*********************998877534375323 PP CBM32.hmm 91 .titfdkpvtaryvRltv...t 108 ti +k + y+Rl + + BFT71548.1|CBM32 141 yTIAANKVKEYGYYRLFImnnN 162 3444444444799999994321 PP == domain 2 score: -0.8 bits; conditional E-value: 0.11 CBM32.hmm 28 ntrWssagqwltvdLgkpttvdkvvltw.aengrikdykvevStDg 72 nt +sa +dLg +t ++k v+ + ++ ++++ e S+ g BFT71548.1|CBM32 183 NTSVASAV--AALDLGDTTALTKGVILPsTF-RKGTTITWESSNPG 225 56666654..667777777777777775322.34445554444443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1212 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 53.68 // Query: UOG79610.1|CBM0|CBM32|GH92 [L=1269] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-27 82.1 14.4 1.6e-21 63.3 1.3 4.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.3 1.3 1.6e-21 1.6e-21 7 112 .. 94 207 .. 88 221 .. 0.78 2 ? 0.9 0.8 0.031 0.031 12 37 .. 711 740 .. 702 774 .. 0.72 3 ! 24.4 0.3 1.8e-09 1.8e-09 22 106 .. 1167 1255 .. 1154 1266 .. 0.69 Alignments for each domain: == domain 1 score: 63.3 bits; conditional E-value: 1.6e-21 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a+ +++++gg+ en+ D+ p+t+W + w+++dL++pt++ k+ lt a+ + ++++d+++ +S Dg++W+t+++++++ UOG79610.1|CBM0|CBM32|GH92 94 AS-AENTNGGEVKENLADNEPGTKWLTFAptGWVEFDLDAPTKIVKYALTSANdhSeRDPRDWTLKGSADGESWQTLDTRSGE 175 33.344556699***************74457******************7334546*********************98765 PP CBM32.hmm 85 tdgt..te.titfdkpvtaryvRltvtkra.t 112 t g+ t+ t +++++++ +++Rl++tk++ + UOG79610.1|CBM0|CBM32|GH92 176 TFGEpfTTkTYDLAEAAEFQHFRLEITKNNgA 207 5555443325566699999*******875533 PP == domain 2 score: 0.9 bits; conditional E-value: 0.031 CBM32.hmm 12 saaggggaenavDgd...pntrWssag.qw 37 +++++++ +++vDg+ +n +W ++ +w UOG79610.1|CBM0|CBM32|GH92 711 ENTPTETGAKVVDGKvyvNNGFWDTYRtTW 740 44556999******8553346999863345 PP == domain 3 score: 24.4 bits; conditional E-value: 1.8e-09 CBM32.hmm 22 avDgdpntrWssagqwltvdLg.kpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekgnttd.gttetitfd. 95 ++D+ ++ ++ vdL + + +++++t ++ + + +k+++S DgktW+t++ +++++ + +t+ f+ UOG79610.1|CBM0|CBM32|GH92 1167 LFDD--TSATDATV--TSVDLPvADKGAKALQYTLtSSadRtKAPAGWKLQGSADGKTWRTLDRRSDESFaWDRQTRAFSv 1243 5666..33333332..5788886668899999998733454699******************9887755433333557765 PP CBM32.hmm 96 .kpvtaryvRlt 106 +p t ++Rl+ UOG79610.1|CBM0|CBM32|GH92 1244 kSPGTYAKYRLV 1255 466665555655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1269 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.17 // Query: WXH12553.1|CBM32|GH92 [L=2007] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-30 91.3 17.8 9.4e-22 64.0 0.5 5.3 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.0 0.5 9.4e-22 9.4e-22 5 111 .. 82 195 .. 78 210 .. 0.75 2 ? -0.4 0.1 0.084 0.084 35 55 .. 332 362 .. 293 384 .. 0.63 3 ! 3.3 0.1 0.006 0.006 5 34 .. 710 741 .. 706 760 .. 0.73 4 ! 31.9 1.1 7.9e-12 7.9e-12 14 109 .. 1169 1270 .. 1162 1296 .. 0.72 5 ? -3.9 0.1 1 1 16 26 .. 1742 1752 .. 1731 1753 .. 0.73 Alignments for each domain: == domain 1 score: 64.0 bits; conditional E-value: 9.4e-22 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd. 86 + +s+++++++ga+++ Dg+++t+W + w+++ L +p+ + +++lt + + +++kd++v++S++g++W+tv+e++++ WXH12553.1|CBM32|GH92 82 VT--ASDQNTPNEGAAFLADGNAGTKWLAFKnaAWVQYQLSAPQPMVRYTLTSgNDePdRDPKDFRVQGSNNGTDWVTVDERSGELFs 167 33..355566669****************74478******************7532557********************998765544 PP CBM32.hmm 87 gt.tetitfd..kpvta.ryvRltvtkra 111 g + t++f+ +p +a y+Rl v +++ WXH12553.1|CBM32|GH92 168 GRgE-TRSFTlaAPSDAfVYYRLDVLATK 195 5442.4455544888888*******4433 PP == domain 2 score: -0.4 bits; conditional E-value: 0.084 CBM32.hmm 35 g......qw..ltvdLg..kpttvdkvvltw 55 + qw +tvdLg + +tvd + + + WXH12553.1|CBM32|GH92 332 SnvlwpnQWnkVTVDLGsfAGRTVDDILFRY 362 02333555556******55558888887664 PP == domain 3 score: 3.3 bits; conditional E-value: 0.006 CBM32.hmm 5 ssaessssaaggggaenavDgd...pntrWssa 34 sa+s+s++++ ++ +++vDg+ +n +W ++ WXH12553.1|CBM32|GH92 710 VSATSGSATDT-QTNAKIVDGKiyvNNGFWDTY 741 57777888787.99*******954334599985 PP == domain 4 score: 31.9 bits; conditional E-value: 7.9e-12 CBM32.hmm 14 aggggaenavDgdpntrWssag..qwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttd.gttetit 93 +g + + +vD++ n++ +g +l+ + +p ++ +++lt + + ++++++e+S+Dg+tWt++++++++ +t+t++ WXH12553.1|CBM32|GH92 1169 DG-TSVASLVDDNMNSKVTFSGdtAELVWTSQsGPVSIGQYTLTS-AaKaDAPSSWTLEGSMDGTTWTELDSRDGQAFaWDTQTRP 1252 34.77999*****9987555423445666666599*********5.245699******************9987765433355789 PP CBM32.hmm 94 fd.kpvta.ryvRltvtk 109 f+ k+ ++ + +Rlt ++ WXH12553.1|CBM32|GH92 1253 FTaKNDDGyTSIRLTLQG 1270 997444444999999944 PP == domain 5 score: -3.9 bits; conditional E-value: 1 CBM32.hmm 16 gggaenavDgd 26 + +++avDgd WXH12553.1|CBM32|GH92 1742 IQVPKKAVDGD 1752 46799*****7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (2007 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 173.37 // Query: XLR78697.1|CBM32|GH92 [L=1022] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-10 27.1 0.0 1.2e-09 25.0 0.0 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.3 0.0 0.31 0.31 18 37 .. 472 495 .. 466 510 .. 0.67 2 ! 25.0 0.0 1.2e-09 1.2e-09 18 112 .. 908 1008 .. 902 1020 .. 0.68 Alignments for each domain: == domain 1 score: -2.3 bits; conditional E-value: 0.31 CBM32.hmm 18 gaenavDgd...pntrWssag.qw 37 + +++vDg +n +W ++ w XLR78697.1|CBM32|GH92 472 TGAKVVDGElyvNNGFWDTYRtAW 495 67899***8443345998863345 PP == domain 2 score: 25.0 bits; conditional E-value: 1.2e-09 CBM32.hmm 18 gaenavDgdpntrWss..ag..qwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetitf 94 g++++ D+ r ++ + ++t+ + +p++v ++lt + + g+++d+ +e+S+Dg W+ ++e++++ +t++f XLR78697.1|CBM32|GH92 908 GIAALSDNTS--RTQAvfRTprPTITFTADgEPREVVLYTLTS-GsSaGDPQDWVLEGSDDGRRWRILDERSGEV-FRwrRQTRPF 989 5666777733..4333221234458888876889999999994.3446******************999987644.3343346677 PP CBM32.hmm 95 d..kpvtaryvRltvtkra.t 112 +p+ r++Rl+v ra t XLR78697.1|CBM32|GH92 990 VlaDPAACRHYRLRV--RAsT 1008 77788766*******..4422 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1022 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 167.40 // Query: WUT59029.1|CBM32|GH92 [L=1242] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-29 87.6 14.9 4.2e-22 65.1 0.7 3.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.1 0.7 4.2e-22 4.2e-22 7 111 .. 69 180 .. 63 193 .. 0.76 2 ? -0.2 0.9 0.071 0.071 15 39 .. 688 716 .. 684 759 .. 0.74 3 ! 29.6 0.8 4.3e-11 4.3e-11 22 106 .. 1141 1228 .. 1135 1239 .. 0.70 Alignments for each domain: == domain 1 score: 65.1 bits; conditional E-value: 4.2e-22 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt. 88 a s+++++gg+ en+vDg p+t+W + + w ++dL kp +v ++ lt a+ ++++d+++ +StDgk+W+t++++++++ ++ WUT59029.1|CBM32|GH92 69 A-SAENTGGGEVKENLVDGEPGTKWLAFEstGWAEFDLAKPLKVVTYALTSANdfAeRDPRDWTLKGSTDGKDWKTLDTRSGESFDEr 155 3.3445667799***************74467******************7334546*********************9876543223 PP CBM32.hmm 89 .tetitfd..kpvtaryvRltvtkra 111 t+++d +p++ +++Rl++tk++ WUT59029.1|CBM32|GH92 156 fR-TKSYDiaDPAEYQHFRLEITKNN 180 31.445555599999*******7743 PP == domain 2 score: -0.2 bits; conditional E-value: 0.071 CBM32.hmm 15 ggggaenavDgd...pntrWssag.qwlt 39 ++++ +++vDg+ +n +W ++ +w WUT59029.1|CBM32|GH92 688 PTHTGAKIVDGKvyvNNGFWDTYRtTWPA 716 45899999999855334599986334544 PP == domain 3 score: 29.6 bits; conditional E-value: 4.3e-11 CBM32.hmm 22 avDgdpntrWssagqwltvdLgkpttvdkvvltw..ae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd..kpvta 100 ++D+ ++ +a vdL ++v++v++t ++ ++ +++++S+Dg+ W+t+++++ ++ + +t+ f+ +p t WUT59029.1|CBM32|GH92 1141 LFDN--TSATDAAV--TSVDLPVSRQVKGVQYTVtsSSdHtKAPSGWTLQGSDDGTRWKTLDQRSAESFaWDRQTRAFTvrSPGTY 1222 5565..33333333..58***************9852254699******************9887644323334567775566655 PP CBM32.hmm 101 ryvRlt 106 ++Rl+ WUT59029.1|CBM32|GH92 1223 GKYRLV 1228 555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1242 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.33 // Query: BFE62545.1|CBM32 [L=106] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-14 39.6 3.0 3.9e-14 39.4 3.0 1.0 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.4 3.0 3.9e-14 3.9e-14 29 121 .. 2 101 .. 1 104 [. 0.70 Alignments for each domain: == domain 1 score: 39.4 bits; conditional E-value: 3.9e-14 CBM32.hmm 29 trWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt.tetitfdkpvtaryvRltv..tkratn 113 t+W + ++t L ++ v++++lt + + ++++ +++++S+Dg tWttv+++++ + + +t+ f + +a y R++ t++ + BFE62545.1|CBM32 2 TKWLTFAntATITDQLTGAVAVRQYTLTSaDDvPgRDPRAWTLQGSDDGVTWTTVDTRADVDFADrRQTRAFVVTGSASYSRYRLqiTAN-HG 93 78999533567999**************7433656*********************9988655443336677744556665555521332.32 PP CBM32.hmm 114 awgasiaE 121 a +++aE BFE62545.1|CBM32 94 AAETQLAE 101 34466666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (106 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 39.18 // Query: CAM1000043.1|CBM32|GH92 [L=1152] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-08 20.5 0.0 7.1e-08 19.2 0.0 1.7 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.2 0.0 7.1e-08 7.1e-08 22 124 .] 1029 1137 .. 1019 1137 .. 0.69 Alignments for each domain: == domain 1 score: 19.2 bits; conditional E-value: 7.1e-08 CBM32.hmm 22 avDgdpnt.rWssag.qwltvdLg.kpttvdkvvltw.aen.grikdykvevStDgktWttvaekgnttdgt..tetitfd..k 96 + Dgd+ t ++ ++ v + ++++v ++lt a + + d+++++S Dg+ W++++ + ++ ++ + f + CAM1000043.1|CBM32|GH92 1029 LADGDAATsSVLDGShPTIDVHFTdGARRVLMYTLTSaA-TgHGPGDWQLQGSRDGSRWHVLDRRHGEA-FRwpQQLRAFGvtE 1110 668877762333322445999998788999999999651.3367******************9876543.33533433666558 PP CBM32.hmm 97 pvtaryvRltvtkra.tnawgasiaElae 124 p + y+Rl++ ++ ++a +++++E+++ CAM1000043.1|CBM32|GH92 1111 PGDYIYYRLRI--DNgNDAGPVALSEIQW 1137 88899999999..5533344488888875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1152 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 177.49 // Query: XAW43804.1|CBM0|CBM32|GH92 [L=1430] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-30 89.9 14.3 3e-23 68.9 2.0 3.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.9 2.0 3e-23 3e-23 7 122 .. 86 208 .. 82 215 .. 0.79 2 ? -1.4 0.3 0.16 0.16 14 42 .. 717 748 .. 704 814 .. 0.67 3 ! 28.2 0.5 1.1e-10 1.1e-10 37 122 .. 1197 1284 .. 1175 1286 .. 0.67 Alignments for each domain: == domain 1 score: 68.9 bits; conditional E-value: 3e-23 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 +++++++++++a++++Dg+ +t+W + + w+ v L++p v ++ lt a+ + +++kd+++++S Dg++Wtt+++++++ XAW43804.1|CBM0|CBM32|GH92 86 VTANAENPPSETADRVIDGNVSTKWLAFTptGWVRVRLDAPVAVVHYALTSANdaPeRDPKDWTLQGSADGENWTTLDTRTGQ 168 4456778888*****************75567******************7334547*********************99876 PP CBM32.hmm 85 tdgt....tetitfdkpvta.ryvRltvtkratnawgasiaEl 122 + t t++ +fd+ +ta y+Rl+vt+ + +++aEl XAW43804.1|CBM0|CBM32|GH92 169 QF-TerfqTREYRFDN-TTAyPYYRLNVTAIGGGGI-TQLAEL 208 64.3347334779995.5555*******55332222.666665 PP == domain 2 score: -1.4 bits; conditional E-value: 0.16 CBM32.hmm 14 aggggaenavDgd...pntrWssag.qwltvdL 42 ++ + + +vDg+ +n +W ++ +w + L XAW43804.1|CBM0|CBM32|GH92 717 PT-RTGAPVVDGKvyvNNGFWDTYRtTWSAYTL 748 33.667777888644333477765334444444 PP == domain 3 score: 28.2 bits; conditional E-value: 1.1e-10 CBM32.hmm 37 wltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt.tetitfd..kpvtaryvRltvtkra 111 +++ + +p +v++++lt + g+ + +++ +S Dg +Wt+++++++++ + +t++f+ +p + ++Rl+vt+ XAW43804.1|CBM0|CBM32|GH92 1197 SVQWKVSgTPEQVTHYTLTS-GkVaGDLHGWQLKGSYDGRNWTVLDDRSGESFPWrSQTRSFQvdQPGRYAHYRLEVTA-- 1274 3555554389*********4.33259*******************9987644332333556665599988999999944.. PP CBM32.hmm 112 tnawgasiaEl 122 + +++a +aE+ XAW43804.1|CBM0|CBM32|GH92 1275 A-DPAATLAEV 1284 3.456777776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1430 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 171.39 // Query: WSE32959.1|CBM32|GH92 [L=1051] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-12 33.4 2.2 3.9e-12 32.9 0.5 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.3 0.0 0.31 0.31 17 37 .. 480 504 .. 474 514 .. 0.67 2 ! 32.9 0.5 3.9e-12 3.9e-12 13 110 .. 932 1036 .. 925 1049 .. 0.70 Alignments for each domain: == domain 1 score: -2.3 bits; conditional E-value: 0.31 CBM32.hmm 17 ggaenavDgd...pntrWssag.qw 37 + +++vDg +n +W ++ +w WSE32959.1|CBM32|GH92 480 RTGAKVVDGElyvNNGFWDTYRtTW 504 467899***8443345998853334 PP == domain 2 score: 32.9 bits; conditional E-value: 3.9e-12 CBM32.hmm 13 aaggggaenavDgdpntrWssa.g...qwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..t 89 ++++g+a+ +vD+ +t +++ + ++++ p++v+ ++lt + + g+++ +++e+S Dg Wt+++ ++++ WSE32959.1|CBM32|GH92 932 YSADGPADLLVDDTSRT--EATfTtrtPTIEFSVHgHPREVTMYTLTS-GsRtGDATAWTLEGSADGRRWTELDRRTGEL-FRwrR 1013 445589*******5444..4432124556999887689*********4.3446********************9887633.33442 PP CBM32.hmm 90 etitfd..kpvtaryvRltvtkr 110 +t++f p+t ++Rl+vt+ WSE32959.1|CBM32|GH92 1014 QTRPFVldRPATYAHYRLRVTAA 1036 35555555889999999999552 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1051 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.91 // Query: WEH31302.1|CBM32|GH92 [L=1257] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-28 85.8 10.4 4.1e-22 65.2 1.5 4.1 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.2 1.5 4.1e-22 4.1e-22 7 122 .. 73 196 .. 67 198 .. 0.76 2 ? 1.4 0.2 0.023 0.023 13 47 .. 696 733 .. 689 787 .. 0.77 3 ? -2.8 0.0 0.46 0.46 71 107 .. 1064 1089 .. 1058 1102 .. 0.56 4 ! 22.4 0.0 7.1e-09 7.1e-09 43 109 .. 1170 1240 .. 1133 1255 .. 0.69 Alignments for each domain: == domain 1 score: 65.2 bits; conditional E-value: 4.1e-22 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt. 88 a s++++agg+ a+n+ Dg p+t+W + + w ++dL++p+ v+++ l a+ ++++d+++++StDgk+W+t++++++++ t WEH31302.1|CBM32|GH92 73 A-SAENTAGGEVAANLADGLPGTKWLTFEnkGWAEFDLDAPQPVTRYALVSANdhDeRDPRDWTLQGSTDGKEWKTLDTRAGEKF-Te 158 3.345667779****************74467******************7334546*********************9876553.33 PP CBM32.hmm 89 ..te.titfd.kpvtaryvRltvtkratnawgasiaEl 122 + t ++ +p+ ++Rl vt+++ + ++++aE+ WEH31302.1|CBM32|GH92 159 raQSkTYEIGgAPAAYAHYRLDVTANNGASDATQLAEV 196 3422244444767766*******665532455888887 PP == domain 2 score: 1.4 bits; conditional E-value: 0.023 CBM32.hmm 13 aaggggaenavDgd...pntrWssag.qwltvdLgkptt 47 +a+ ++ +++vDg+ +n +W ++ +w + L +p++ WEH31302.1|CBM32|GH92 696 TAT-HTGAKIVDGKvyvNNGFWDTYRtTWPAYSLLTPKK 733 344.999******85534469999644576666666555 PP == domain 3 score: -2.8 bits; conditional E-value: 0.46 CBM32.hmm 71 DgktWttvaekgnttdgttetitfdkpvtaryvRltv 107 +gk++t+ a +gn t ++ + ++ vRl++ WEH31302.1|CBM32|GH92 1064 NGKKFTVTA-RGNST------KN----IYVQSVRLNG 1089 777877555.44322......11....1134444444 PP == domain 4 score: 22.4 bits; conditional E-value: 7.1e-09 CBM32.hmm 43 gkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd..kpvtaryvRltvtk 109 gk+ v++ ++t + + ++ + +++S Dg++W++++++g+++ ++++t+ f+ p t ++R++ + WEH31302.1|CBM32|GH92 1170 GKA--VKAAQYTLtSAdRaKAPSGWVLQGSADGTSWRDLDKRGGESFaYDQQTRVFSvaHPGTYAHYRIVPDG 1240 444..5555555443344589*******************999877666644445554477777888887643 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1257 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 154.88 // Query: WXA95323.1|CBM32|GH92 [L=1325] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-31 94.7 17.8 7.8e-21 61.0 3.2 4.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.0 3.2 7.8e-21 7.8e-21 8 120 .. 113 233 .. 106 239 .. 0.74 2 ! 3.8 0.3 0.004 0.004 9 45 .. 753 793 .. 746 828 .. 0.73 3 ! 37.4 1.6 1.7e-13 1.7e-13 17 122 .. 1211 1320 .. 1203 1322 .. 0.73 Alignments for each domain: == domain 1 score: 61.0 bits; conditional E-value: 7.8e-21 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgtte 90 ++++++++g+ a+n++D+d+ ++W + w++++L++++ v++++l + +++kd++v++S+Dg+tW+++++k+n++ ++ + WXA95323.1|CBM32|GH92 113 ANGENDGAGEVADNLTDDDTHSKWLVFEssGWIVYKLDEAMAVRRYRLGSaNDyDeRDPKDWTVQGSQDGETWVDLDKKTNEDFPQ-R 199 34555566689********99***9964467******************8522456********************9988765444.2 PP CBM32.hmm 91 .ti.tfd...kpvtaryvRltvtkratnawgasia 120 + +fd ++++ y+Rl++t+++++ ++++ WXA95323.1|CBM32|GH92 200 yQLrEFDlssNTTPYLYYRLNITANNNGGI-VQMS 233 233366666655668*******66443321.3333 PP == domain 2 score: 3.8 bits; conditional E-value: 0.004 CBM32.hmm 9 ssssaaggggaenavDgd...pntrWssag.qwltvdLgkp 45 +s + +++++ +++vDg+ +n +W ++ +w + L +p WXA95323.1|CBM32|GH92 753 ASGAGSPTNTGAKLVDGKvyvNNGFWDTYRgTWSAYALLTP 793 3455556699*******965345699997455766665555 PP == domain 3 score: 37.4 bits; conditional E-value: 1.7e-13 CBM32.hmm 17 ggaenavDgd.pntrWssagqwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt.tetitfd.k 96 +g + + D+d +t ++ ++ + +++ v+ ++lt a + g+++d+ +e+S+Dg+tW+++++++++ + +t+ f+ + WXA95323.1|CBM32|GH92 1211 NGDAHLYDNDgLSTATLTGA--VQCKIQGTAPVRFYTLTSaADtTnGDPTDWVLEGSNDGTTWKELDKRTGQVFPWrSQTRAFKvA 1294 56677888875578878875..9****************7533545********************99887554333346688885 PP CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEl 122 +++a+y +++t +++++++++iaE+ WXA95323.1|CBM32|GH92 1295 DASATYANYRITVTKSTKPTTAIAEI 1320 55666655555445544566889997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1325 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 163.30 // Query: XTM51237.1|CBM32|GH92 [L=1263] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-30 90.4 17.8 1.1e-21 63.7 1.6 4.1 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.7 1.6 1.1e-21 1.1e-21 9 110 .. 92 201 .. 86 219 .. 0.77 2 ? 0.4 1.7 0.047 0.047 12 37 .. 706 735 .. 701 809 .. 0.74 3 ! 34.3 0.7 1.5e-12 1.5e-12 19 107 .. 1159 1250 .. 1146 1261 .. 0.73 Alignments for each domain: == domain 1 score: 63.7 bits; conditional E-value: 1.1e-21 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt... 88 s++++++g+ en+vDg +t+W + w+++dL+kp ++ ++ lt a+ ++++d+++++StDgk+W+tv+++++++ + XTM51237.1|CBM32|GH92 92 SGENTGAGEVKENLVDGESGTKWLTFAptGWVEFDLDKPLKIVTYALTSANdhDeRDPQDWTLQGSTDGKDWKTVDTRSGESF-Sarf 178 3455566699*******999*****74457******************7334546*********************9876554.3345 PP CBM32.hmm 89 te.titfdkpvtaryvRltvtkr 110 ++ + ++++p++ +++Rl v+ + XTM51237.1|CBM32|GH92 179 QTkSYDLAEPAEYQHFRLDVSRN 201 332556669999*******9332 PP == domain 2 score: 0.4 bits; conditional E-value: 0.047 CBM32.hmm 12 saaggggaenavDgd...pntrWssag.qw 37 +++++++ +++vDg+ +n +W ++ +w XTM51237.1|CBM32|GH92 706 QDTPTHTGAKIVDGKvyvNNGFWDTYRtTW 735 445569999999998553345888853334 PP == domain 3 score: 34.3 bits; conditional E-value: 1.5e-12 CBM32.hmm 19 aenavDgdpntrWssagqwltvdLgkpttvdkvvltw..ae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..k 96 +++D+ ++ +++ vdL ++ v+++++t ++ + ++ +++++S Dg++W+t++++++++ t +t+ f+ + XTM51237.1|CBM32|GH92 1159 TGALFDN--TSATAATV--TSVDLPVAKAVKGIQYTLtsSTdHtQAPTGWTLQGSADGTKWKTLDKRSGES-FTwdRQTRAFSveS 1239 5678888..44444443..69***************985235469*******************9876644.44433355666668 PP CBM32.hmm 97 pvtaryvRltv 107 p + ++Rl+ XTM51237.1|CBM32|GH92 1240 PGSYAHYRLVL 1250 88889999988 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1263 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.28 // Query: WZO38052.1|CBM32|GH92 [L=2006] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-25 76.8 32.4 2.3e-21 62.8 1.3 6.5 7 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.8 1.3 2.3e-21 2.3e-21 5 114 .. 82 196 .. 78 208 .. 0.73 2 ? -1.0 0.1 0.13 0.13 25 55 .. 330 362 .. 304 380 .. 0.59 3 ! 2.6 0.1 0.0098 0.0098 5 34 .. 710 741 .. 706 760 .. 0.73 4 ! 25.9 3.4 6.1e-10 6.1e-10 15 107 .. 1169 1268 .. 1162 1296 .. 0.68 5 ? 2.3 0.2 0.012 0.012 25 67 .. 1310 1353 .. 1283 1385 .. 0.72 6 ? -3.4 0.0 0.71 0.71 7 26 .. 1538 1556 .. 1534 1561 .. 0.66 7 ? -1.0 0.3 0.13 0.13 36 72 .. 1626 1669 .. 1583 1718 .. 0.60 Alignments for each domain: == domain 1 score: 62.8 bits; conditional E-value: 2.3e-21 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd. 86 ++s+++a++++a+++ Dg+++++W + w+++ Lg+p+ + +++lt + + +++kd++v++St+g++W+tv++++++ WZO38052.1|CBM32|GH92 82 V--TASAQNAPNEAAAFVADGNASSKWLAFAntGWVQYQLGTPQPMVRYTLTSgNDaQeRDPKDFRVQGSTNGTDWVTVDQRTGELFs 167 3..3355677779****************63367******************7533667********************998865544 PP CBM32.hmm 87 gttetitfd...kpvtaryvRltvtkratna 114 g et+tf+ ++ y+Rl v at + WZO38052.1|CBM32|GH92 168 GRGETRTFElaaPSAEYLYYRLDVL--ATRT 196 5433445555343334677888873..3333 PP == domain 2 score: -1.0 bits; conditional E-value: 0.13 CBM32.hmm 25 gdpntrWssagqw..ltvdLg..kpttvdkvvltw 55 g++n W + qw +t+dLg + +t+d + + + WZO38052.1|CBM32|GH92 330 GQANVLWPN--QWnkVTIDLGafAGRTIDDILFRY 362 333333433..4444******55558888887764 PP == domain 3 score: 2.6 bits; conditional E-value: 0.0098 CBM32.hmm 5 ssaessssaaggggaenavDgd...pntrWssa 34 sa+s+s++++ + +++vDg+ +n +W ++ WZO38052.1|CBM32|GH92 710 VSATSGSASDT-RTNAKIVDGKiyvNNGFWDTY 741 57777777777.99*******954334599985 PP == domain 4 score: 25.9 bits; conditional E-value: 6.1e-10 CBM32.hmm 15 ggggaenavDgdpn.t.rWssagqwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetit 93 g + +vD++ n t ++ ++ +l+ + +p ++ +++lt + + ++++++S Dg+tWt++++++++t t +t++ WZO38052.1|CBM32|GH92 1169 DGTPVGSLVDDNMNsTvTFQGDSAELVWTSQsGPVSIGQYTLTS-AsKaAAPASWTLSGSLDGTTWTELDSREGQT-FTwdSQTRP 1252 447889999*999843333332234666666599*********5.234589******************9988766.333245779 PP CBM32.hmm 94 fdkpvta..ryvRltv 107 f++++ + + v+l WZO38052.1|CBM32|GH92 1253 FTTQTAGgyTSVKLAL 1268 9943333025555544 PP == domain 5 score: 2.3 bits; conditional E-value: 0.012 CBM32.hmm 25 gdpntrWssag....qwltvdLgkpttvdkvvltwaengrikdykve 67 g+ t +++ ++tvd+g vd v+lt + + +kv+ WZO38052.1|CBM32|GH92 1310 GSLATIVGTETdasgYDVTVDYGDGEAVDDVTLT--R-DELGGWKVS 1353 44445444432233457*****************..3.445555554 PP == domain 6 score: -3.4 bits; conditional E-value: 0.71 CBM32.hmm 7 aessssaaggggaenavDgd 26 ++++ +a+ +++ avDg+ WZO38052.1|CBM32|GH92 1538 VKNTAIYAT-APIALAVDGN 1556 433333444.899******7 PP == domain 7 score: -1.0 bits; conditional E-value: 0.13 CBM32.hmm 36 qwltvdLgkpttvdkvvltwae......n.grikdykvevS.tDg 72 ++ +++ g v++v +t ++ + ++ +y+v v +Dg WZO38052.1|CBM32|GH92 1626 TSTVINWGDGSPVSAVDVT-DGavqgthTyAKAGSYTVTVTaDDG 1669 4578888888899999999.3233333335566677777773444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (2006 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 68.68 // Query: UMP04711.1|CBM32|GH92 [L=1430] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-32 97.6 14.3 2.2e-24 72.5 1.9 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.5 1.9 2.2e-24 2.2e-24 4 122 .. 86 210 .. 83 212 .. 0.76 2 ? 1.6 0.1 0.019 0.019 10 50 .. 717 760 .. 708 786 .. 0.68 3 ! 29.6 1.1 4.2e-11 4.2e-11 18 123 .. 1178 1285 .. 1171 1286 .. 0.73 Alignments for each domain: == domain 1 score: 72.5 bits; conditional E-value: 2.2e-24 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd 86 + sa +s++++++g +n+vDg+++t+W +++ w +v L +pt+++++ l + ++++d+++++S Dgk+Wt+++++++++ UMP04711.1|CBM32|GH92 86 EVSA--NSENTPNEGVANLVDGSTDTKWLAWTptGWAQVTLSEPTSITRYALSSaNDfDnRNPQDWTLQGSADGKSWTELDKQTGQKF 171 4444..5666677*****************96678******************7522535********************98877654 PP CBM32.hmm 87 gt...tetitfdkpvta.ryvRltvtkratnawgasiaEl 122 ++ +++ +++++ a +++Rl vtk++ + ++++El UMP04711.1|CBM32|GH92 172 SEpfqKKEYRLAAASAAyKFFRLDVTKNNG-GPIMQLSEL 210 335633366777433445*******66443.244677765 PP == domain 2 score: 1.6 bits; conditional E-value: 0.019 CBM32.hmm 10 sssaaggggaenavDgd...pntrWssag.qwltvdLgkpttvdk 50 + +++++++ +++vDg +n +W ++ w + L +p t k UMP04711.1|CBM32|GH92 717 G-QDTPTQTGAKLVDGEfyvNNGFWDTYRtVWSAYSLLSPETTGK 760 3.44455899******76644458888633456666666655555 PP == domain 3 score: 29.6 bits; conditional E-value: 4.2e-11 CBM32.hmm 18 gaenavDgdpntrWssag.qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..k 96 g ++ +D+ +t +++ +++ ++ + ++ ++ + g++k++ + +S Dgk+W +++++++++ + ++t+ f+ + UMP04711.1|CBM32|GH92 1178 GDAAFFDNTSRT--EAKVkAPIQYQVPSTNEAGSFYTLTSGkGaGDAKSWVLKGSYDGKNWAVADQRTDQK-FSwrQQTRAFKiaN 1260 556778884444..443222399999999999999666433447******************999888766.44444566888779 PP CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEla 123 p+ y+Rl+vt+ t+ as++E++ UMP04711.1|CBM32|GH92 1261 PAHYAYYRLEVTA--TTGGEASLSEFE 1285 9999*******55..333348999985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1430 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.36 // Query: UUV31942.1|CBM32|GH92 [L=1430] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-31 94.6 14.3 9.8e-24 70.4 1.7 3.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 70.4 1.7 9.8e-24 9.8e-24 4 122 .. 86 210 .. 83 212 .. 0.76 2 ? 0.8 0.1 0.035 0.035 11 38 .. 717 748 .. 709 788 .. 0.68 3 ! 29.3 1.4 5.3e-11 5.3e-11 18 123 .. 1178 1285 .. 1171 1286 .. 0.73 Alignments for each domain: == domain 1 score: 70.4 bits; conditional E-value: 9.8e-24 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd 86 + sa +s++++++g +n+vDg+++t+W +++ w +v L +pt+++++ l + ++++d+++ +StDg++Wt+++ +++++ UUV31942.1|CBM32|GH92 86 EVSA--NSENTPNEGVANLVDGSTDTKWLAWTptGWAQVTLSEPTSITRYALSSaNDfDnRNPQDWTLKGSTDGQSWTDLDRQTGQKF 171 4444..5666677*****************96678******************7522535********************98877654 PP CBM32.hmm 87 gt...tetitfdkpvta.ryvRltvtkratnawgasiaEl 122 ++ +++ +++++ a +++Rl++tk++ + +++El UUV31942.1|CBM32|GH92 172 SEpfqKKEYRLAAASAAyKFFRLEITKNNG-GPILQLSEL 210 335633366777433445*******66432.244666665 PP == domain 2 score: 0.8 bits; conditional E-value: 0.035 CBM32.hmm 11 ssaaggggaenavDgd...pntrWssag.qwl 38 +++++++ +++vDg +n +W ++ w UUV31942.1|CBM32|GH92 717 GQDTPTQTGAKLVDGEfyvNNGFWDTYRtVWS 748 3444558999*****65543457776422233 PP == domain 3 score: 29.3 bits; conditional E-value: 5.3e-11 CBM32.hmm 18 gaenavDgdpntrWssag.qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..k 96 g ++ +D+ +t +++ +++ ++ + ++ ++ + g++k++ + +S DgktW ++++++++t + ++t+ f+ + UUV31942.1|CBM32|GH92 1178 GDAAFFDNTSRT--EAKVkAPIQYQVPSTNEAGSFYTLTSGkGaGDAKSWVLKGSYDGKTWAVADQRTDQTF-QwrQQTRAFKiaN 1260 556778884444..443222399999999999999666433447******************9998988764.3434566888779 PP CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEla 123 p+ y+Rl+vt+ t+ as++E++ UUV31942.1|CBM32|GH92 1261 PAHYAYYRLEVTA--TTGGEASLSEFE 1285 9999*******55..333348999985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1430 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 165.03 // Query: WIB26869.1|CBM32|GH92 [L=1993] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-26 79.4 19.7 7e-19 54.7 4.1 3.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 54.7 4.1 7e-19 7e-19 9 112 .. 85 197 .. 79 211 .. 0.73 2 ? -0.4 0.1 0.082 0.082 35 73 .. 331 381 .. 305 408 .. 0.69 3 ! 31.2 3.5 1.3e-11 1.3e-11 13 122 .. 1178 1293 .. 1167 1295 .. 0.67 Alignments for each domain: == domain 1 score: 54.7 bits; conditional E-value: 7e-19 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g.qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt.t 89 + +++++++ a+ + Dg+p+++W + + +t+ L++p t+++++lt a+ + +++ +++e+StDg+tWttv++++ +t g + WIB26869.1|CBM32|GH92 85 ADAENPPNEVAASLADGNPGSKWLAFrStGVVTYRLDQPETLRAYSLTSANdaPgRDPAAWTLEGSTDGTTWTTVDTQTAQTFtGRgK 172 3556788899***************632346*****************7334557*********************998777555542 PP CBM32.hmm 90 etitfd..kpvtaryvRltvtkra.t 112 t +++ +p + +Rl++t+++ WIB26869.1|CBM32|GH92 173 -TNEYTaaTPGSYDRYRLRITQNSgD 197 .4455533666778888888775532 PP == domain 2 score: -0.4 bits; conditional E-value: 0.082 CBM32.hmm 35 g......qw..ltvdLg..kpttvdkvvltw..aen.grikdykvevStDgk 73 g qw + + Lg + +tvdkv +t+ + g+ + k++++ Dg WIB26869.1|CBM32|GH92 331 GkvffvdQWnsIRIPLGalAGKTVDKVLFTYddD-AeGTSASTKFQGWVDGI 381 1334445444489999944448********8641.34999999999999995 PP == domain 3 score: 31.2 bits; conditional E-value: 1.3e-11 CBM32.hmm 13 aaggggaenavDgd..pntrWssagqwltvdLg.kpttvdkvvltw.aen.grikdykvevStDgktWttvaekgnttdgt....t 89 ++ + + +++D+ + t +ssa+ +t + +p tvd+++lt a + +++++k+e+S+Dg+tW+++ ++++ t + t WIB26869.1|CBM32|GH92 1178 SDDDTAVGALTDDEslTATTFSSATPAITWKSSqGPVTVDQYTLTTaA-SgAQPTSWKLEGSSDGSTWVPLSTVAKSTF-DaplqT 1261 233355677777753323666665345888888789*********752.3489******************98774332.234432 PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEl 122 + +t++ p+ +++Rl vt+++t++ si E+ WIB26869.1|CBM32|GH92 1262 RPTTIAHPAALTWYRLSVTGTSTGKA-PSIGEF 1293 22244456656*******99887654.689888 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1993 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 189.71 // Query: XPP13336.1|CBM32|GH92 [L=1903] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-25 75.3 7.4 1.8e-16 46.9 3.1 3.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.9 3.1 1.8e-16 1.8e-16 8 109 .. 81 191 .. 76 209 .. 0.75 2 ! 28.6 0.1 8.6e-11 8.6e-11 43 122 .. 1218 1301 .. 1183 1305 .. 0.72 Alignments for each domain: == domain 1 score: 46.9 bits; conditional E-value: 1.8e-16 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStD.gktWttvaekgnttd.gt 88 ++s+++a+g++a n+ Dg+p ++W + + ++t+ L++p+t +++lt a+ + ++++d+++ +StD g+tWttv+++++t g XPP13336.1|CBM32|GH92 81 TASAENAPGETAVNLSDGNPASKWLAFErtATVTYLLDSPQTAATWSLTSANdaPtRDPRDVTLLGSTDgGTTWTTVDQRSGTAFaGR 168 345667787*****************744668*****************7334557*************679*****99877666555 PP CBM32.hmm 89 te.titfdkpvta..ryvRltvtk 109 t++f+ pv+a +Rl +t+ XPP13336.1|CBM32|GH92 169 -GaTVDFAVPVPAayDAYRLDITA 191 .33778885565413667777754 PP == domain 2 score: 28.6 bits; conditional E-value: 8.6e-11 CBM32.hmm 43 gkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 +p tv++++lt ++ + ++ +++e+StDg+tW +++e++ +t ++ +t++f+ +p + ++R+t t+++ +a ++El XPP13336.1|CBM32|GH92 1218 SGPVTVSRYTLT-NGptGsAAPTGWTLEGSTDGTTWLPLDERAAQTFPSaLQTRPFTvtDPRPFSWYRITTTGTTD-GRAATLSEL 1301 4789********.43554699*******************998877655434556666688888*******66543.344666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1903 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 201.58 // Query: BGA75580.1|CBM32|GH92 [L=1042] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-09 23.5 0.2 1.2e-08 21.7 0.0 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.1 0.37 0.37 17 34 .. 497 517 .. 493 528 .. 0.66 2 ! 21.7 0.0 1.2e-08 1.2e-08 40 108 .. 950 1025 .. 928 1038 .. 0.65 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.37 CBM32.hmm 17 ggaenavDgd...pntrWssa 34 + +++vDg +n +W ++ BGA75580.1|CBM32|GH92 497 RTGAKVVDGEmyvNNGFWDTY 517 567899***844334589885 PP == domain 2 score: 21.7 bits; conditional E-value: 1.2e-08 CBM32.hmm 40 vdLgkpttvdkvvltw..ae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfdkpvtaryvRltv..t 108 +d+ + + ++vv++ ++ + g+++++ +e+S+Dg+ W +++++++t +t++f+ + +ar+ R++ t BGA75580.1|CBM32|GH92 950 IDFPTDGSSREVVMYTltSGsRrGDPRSWVLEGSDDGERWMLLDQREGETF-RwrRQTRPFALAGPARHARYRLriT 1025 55555544455555544333446********************99876553.3323477999555677776665223 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1042 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 162.85 // Query: WXB05746.1|CBM32|GH92 [L=1320] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-32 97.2 23.0 1.1e-22 67.0 3.4 4.3 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.0 3.4 1.1e-22 1.1e-22 7 113 .. 106 221 .. 100 236 .. 0.76 2 ? -0.7 0.0 0.098 0.098 65 95 .. 429 459 .. 395 469 .. 0.74 3 ? 2.4 0.2 0.011 0.011 10 40 .. 748 782 .. 740 814 .. 0.72 4 ! 37.1 3.7 2e-13 2e-13 15 122 .. 1203 1315 .. 1195 1317 .. 0.75 Alignments for each domain: == domain 1 score: 67.0 bits; conditional E-value: 1.1e-22 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt. 88 ++s++++a+g+ a+n++Dgd++++W + wl+++L++p v++++l a+ ++++d+ +++S+Dg+tW+++++++n++ t WXB05746.1|CBM32|GH92 106 TASGENDASGEVADNLTDGDTRSKWLVFEstGWLVYKLDEPVAVKRYRLASANdfDqRDPRDWALQGSQDGETWVDLDKQTNQNF-Te 192 345677788899*************9963467******************7334645********************99888764.32 PP CBM32.hmm 89 ..tetitfd..kpvta.ryvRltvtkratn 113 + t++f+ ++ta y+Rl++t+++++ WXB05746.1|CBM32|GH92 193 rfQ-TREFNvpGNTTAyLYYRLNITANHSG 221 342.3355544667777*******775433 PP == domain 2 score: -0.7 bits; conditional E-value: 0.098 CBM32.hmm 65 kvevStDgktWttvaekgnttdgt.tetitfd 95 vev t+ ++W++ +n + g+ + +f+ WXB05746.1|CBM32|GH92 429 AVEVRTNPSDWVDTRRGTNSS-GDfSRGNNFP 459 699999*****9997555533.3321233554 PP == domain 3 score: 2.4 bits; conditional E-value: 0.011 CBM32.hmm 10 sssaaggggaenavDgd...pntrWssag.qwltv 40 s + +++++ +++vDg+ +n +W ++ +w + WXB05746.1|CBM32|GH92 748 SGAGSPTNTGAKLVDGKvfvNNGFWDTYRgTWSAY 782 334455599*******9664456999964445444 PP == domain 4 score: 37.1 bits; conditional E-value: 2e-13 CBM32.hmm 15 ggggaenavDgdpntrWssagqwltvdLgkpttvdkvvltw..ae..n.grikdykvevStDgktWttvaekgnttdgt.tetitf 94 g +g +++ D+++nt + ++ + +++ v+ +++t a+ + g+++d+ +e+S+Dg+tW+++++++++ + +t+ f WXB05746.1|CBM32|GH92 1203 GCNGDARLYDNSANTSATVN--AVQCKIQGTAPVRFYTITStaASdtTnGDPTDWVLEGSNDGTTWKELDKRTGQVFPWrLQTRAF 1286 456788999**999965555..4*****************875225546********************99987654334235566 PP CBM32.hmm 95 d...kpvtaryvRltvtkratnawgasiaEl 122 + +++t +Rltvtk + +++++iaE+ WXB05746.1|CBM32|GH92 1287 KvadAAATYANYRLTVTKGT--KTTTAIAEV 1315 66566667788999996644..233678887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1320 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 158.15 // Query: XCV32582.1|CBM0|CBM32|GH92 [L=1292] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-30 93.0 14.3 2.5e-20 59.4 2.5 4.1 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.4 2.5 2.5e-20 2.5e-20 7 111 .. 99 210 .. 93 223 .. 0.74 2 ! 2.9 0.2 0.0077 0.0077 13 47 .. 727 765 .. 717 810 .. 0.75 3 ? -2.5 0.0 0.37 0.37 59 78 .. 1114 1134 .. 1094 1144 .. 0.74 4 ! 36.6 0.2 2.8e-13 2.8e-13 20 109 .. 1187 1281 .. 1175 1290 .. 0.77 Alignments for each domain: == domain 1 score: 59.4 bits; conditional E-value: 2.5e-20 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a s++++++g+ en+vDg p+++W + + w+++dL++p + ++ lt a+ +++kd+++ +StDgk+W+++++++++ XCV32582.1|CBM0|CBM32|GH92 99 A-SGENSGSGEVKENLVDGEPTSKWLTFEptGWVEYDLDEPAKAVTYALTSANdhAeRDPKDWTLKGSTDGKDWKVLDTRKGE 180 3.4556667799***************74567*********9999999997334546********************998765 PP CBM32.hmm 85 tdgt.tetitfd.kpvta.ryvRltvtkra 111 ++ ++t+++d ++ ta ++Rl+vt+++ XCV32582.1|CBM0|CBM32|GH92 181 AFDKrHQTKKYDfENGTAyAHYRLEVTANN 210 5433455445555456666*******6644 PP == domain 2 score: 2.9 bits; conditional E-value: 0.0077 CBM32.hmm 13 aaggggaenavDgdp...ntrWssag.qwltvdLgkptt 47 ++++++ +++vDg+p n +W ++ +w + L +p++ XCV32582.1|CBM0|CBM32|GH92 727 DTPTHTGAKIVDGKPyvnNGFWDTYRtTWPAYSLLTPKK 765 445599*******96331459999744576666665555 PP == domain 3 score: -2.5 bits; conditional E-value: 0.37 CBM32.hmm 59 grikdykvevS.tDgktWttv 78 + +k++ v++ +gk+Wt XCV32582.1|CBM0|CBM32|GH92 1114 NSAKNVYVQGLkVNGKKWTST 1134 567888888876899999965 PP == domain 4 score: 36.6 bits; conditional E-value: 2.8e-13 CBM32.hmm 20 enavDgdpntrWssagqwltvdLgkpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekgnttdgt..tetitf 94 +++D+ +t +s++ vdL +++ ++v++t ++ + ++ + +++S+Dg++W++++++++++ ++t+ f XCV32582.1|CBM0|CBM32|GH92 1187 GALFDNTSDTDAASES--GSVDLPVAKETKAVQYTLtSSsdKaKAPRGWVLQGSSDGEKWKELDKRSGQSF-AweKQTRAF 1264 5688998888777763..69***************9833455799******************98876554.233344455 PP CBM32.hmm 95 d..kpvtaryvRltvtk 109 + +p t r++Rl+ + XCV32582.1|CBM0|CBM32|GH92 1265 TvdDPGTYRHYRLVLDE 1281 5559999******9944 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1292 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 152.45 // Query: WHY85698.1|CBM0|CBM32|GH92 [L=1411] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-30 91.5 14.6 1.3e-20 60.3 1.1 3.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.3 1.1 1.3e-20 1.3e-20 8 122 .. 96 217 .. 90 219 .. 0.77 2 ! 3.5 0.2 0.0051 0.0051 6 37 .. 720 754 .. 715 769 .. 0.66 3 ! 34.2 1.7 1.6e-12 1.6e-12 13 120 .. 1198 1312 .. 1188 1333 .. 0.73 Alignments for each domain: == domain 1 score: 60.3 bits; conditional E-value: 1.3e-20 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgntt 85 ++s+++++++ ++++Dgdp+t+W + + +++++L +p v k+ lt a+ + +++k++++++S Dg++Wt v+++++++ WHY85698.1|CBM0|CBM32|GH92 96 TASANNPPNEIDSKLIDGDPTTKWLAFEptANIVLKLAEPVAVVKYALTSANdaKgRDPKNWTLYGSLDGTNWTAVDTREGED 178 45667788899***************744568*****************7334557********************9976644 PP CBM32.hmm 86 dgt..teti.tfdkpvtaryvRltvtkratnawgasiaEl 122 ++ +++ +++++++ y++l +tk+a + +++aE+ WHY85698.1|CBM0|CBM32|GH92 179 FKDrfQRNMyDLKNTTKYLYYKLDITKNAGD-SITQLAEI 217 333454444477777889*******776543.33677776 PP == domain 2 score: 3.5 bits; conditional E-value: 0.0051 CBM32.hmm 6 saessssaaggggaenavDgdp..nt.rWssag.qw 37 sa++++++a+ + +++vDg++ n+ +W ++ w WHY85698.1|CBM0|CBM32|GH92 720 SAATGQDTAT-TTGAKIVDGKTyvNNgFWDTYRtAW 754 5555666666.99*******7422223788853334 PP == domain 3 score: 34.2 bits; conditional E-value: 1.6e-12 CBM32.hmm 13 aaggggaenavDgdpntrWssag..qwltvdLg.kpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdg 87 +++ g+ + ++D+ nt s ++ ++++ ++ + ++v+ ++lt + ++k++ + +S+Dgk+W ++++++n+t WHY85698.1|CBM0|CBM32|GH92 1198 SDE-GNGQLLFDNTSNTQLSMKSktPSIVYQFKeGKQNVKMYTLTSsKAsQnEDPKSWVLKGSNDGKSWSVLDQRKNETF- 1276 344.67899****99996555433457******6669********7512556********************99887653. PP CBM32.hmm 88 t.te.titfd..kpvtaryvRltvtkratnawgasia 120 + + t+ f+ p + ++l++t++a + + +a WHY85698.1|CBM0|CBM32|GH92 1277 QwRQyTRAFTiqHPGKYSQYKLEITENAGAEV-TTLA 1312 33233446666688899999999977542122.3444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1411 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 135.48 // Query: XDA11406.1|CBM32 [L=1217] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-21 61.7 1.0 2.2e-20 59.6 1.0 2.1 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.6 1.0 2.2e-20 2.2e-20 11 121 .. 599 716 .. 591 720 .. 0.76 Alignments for each domain: == domain 1 score: 59.6 bits; conditional E-value: 2.2e-20 CBM32.hmm 11 ssaaggggaenavDgdpntrWssa..g.qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt..te.titf 94 +++g +++++a+D+d nt+W a + +++ + L +pt v+ +v+t + + +++k++++++S+Dg++Wt ++++ n++ + ++ ++ f XDA11406.1|CBM32 599 GTTWG-HEPAFAFDDDLNTKWLHAmaTnTYIGYQLAAPTPVSYYVITSaDDvPeRDPKNWQFQGSNDGTNWTILDQQINQNFTSrfQRrSFVF 690 44555.9**************996433678*****************7433656******************998765765433454436688 PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaE 121 +++v +y+Rl v+++ ++ ++++ E XDA11406.1|CBM32 691 SNNVAYQYYRLFVQEN-HGDIATQLQE 716 898978******9443.3344466665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1217 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 166.99 // Query: WOX13221.1|CBM32|GH92 [L=1263] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-29 87.4 19.9 5.8e-23 67.9 1.6 4.2 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.9 1.6 5.8e-23 5.8e-23 7 111 .. 90 201 .. 84 216 .. 0.77 2 ? -2.7 2.6 0.41 0.41 42 42 .. 740 740 .. 701 840 .. 0.59 3 ? -2.1 0.0 0.27 0.27 59 77 .. 1087 1106 .. 1073 1110 .. 0.76 4 ! 31.0 0.4 1.5e-11 1.5e-11 38 109 .. 1174 1252 .. 1150 1261 .. 0.71 Alignments for each domain: == domain 1 score: 67.9 bits; conditional E-value: 5.8e-23 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt. 88 a ss++++gg+ en+vDg +t+W + w+++dL+kp ++ ++ lt a+ ++++d+++++StDgk+W+t++++++++ + WOX13221.1|CBM32|GH92 90 A-SSENTGGGEVKENLVDGESGTKWLTFAptGWVEFDLDKPAKIVTYALTSANdfAeRDPRDWTLSGSTDGKDWKTLDTRSGESFADr 176 3.4556677799*******999*****74457******************7334546*********************9876554333 PP CBM32.hmm 89 .te.titfdkpvtaryvRltvtkra 111 ++ + ++++p++ +++Rl +tk++ WOX13221.1|CBM32|GH92 177 fQTkSYDLAEPAEYQHFRLDITKNN 201 533255666999*********7743 PP == domain 2 score: -2.7 bits; conditional E-value: 0.41 CBM32.hmm 42 L 42 + WOX13221.1|CBM32|GH92 740 F 740 2 PP == domain 3 score: -2.1 bits; conditional E-value: 0.27 CBM32.hmm 59 grikdykvevS.tDgktWtt 77 + +k++ v++ +g++Wt+ WOX13221.1|CBM32|GH92 1087 NSTKNIYVQGLkVNGQNWTK 1106 45778888887689****97 PP == domain 4 score: 31.0 bits; conditional E-value: 1.5e-11 CBM32.hmm 38 ltvdLgkpttvdkvvltw..ae.n.grikdykvevStDgktWttvaekgnttdgt..te.ti.tfdkpvtaryvRltvtk 109 vdL ++ ++v++t ++ ++ +++++StDg+tW+t++++++++ t ++ ++ ++++p + ++Rl+ ++ WOX13221.1|CBM32|GH92 1174 SSVDLPVAKATKGVQYTLtsSKdHtLAPTGWTLQGSTDGTTWKTLDKRSGES-FTwnQQtRVfSVKSPGSYAHYRLVLNG 1252 379**************9852243589******************9876544.334333244466699999999999833 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1263 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.35 // Query: XIA23621.1|CBM32|GH92 [L=1123] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-11 28.6 0.0 2e-09 24.2 0.0 2.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.4 0.0 0.16 0.16 23 56 .. 141 201 .. 130 244 .. 0.63 2 ? -0.2 0.0 0.072 0.072 10 37 .. 543 573 .. 535 594 .. 0.69 3 ! 24.2 0.0 2e-09 2e-09 10 107 .. 999 1102 .. 995 1117 .. 0.69 Alignments for each domain: == domain 1 score: -1.4 bits; conditional E-value: 0.16 CBM32.hmm 23 vDgdpntrWss...............ag........qw..ltvdLgkp...ttvdkvvltw.a 56 +D+ ++r ss +g qw l vd g++ +t++++vl + + XIA23621.1|CBM32|GH92 141 FDD--GSRLSSrgardqhrlgasaraQGegrvlypdQWnyLAVDVGAVaagRTIKRIVLAHdG 201 555..5555554444444443333330033445556555599999976335699999999541 PP == domain 2 score: -0.2 bits; conditional E-value: 0.072 CBM32.hmm 10 sssaaggggaenavDgdp...ntrWssag.qw 37 ++++++ + +++vDg+p n +W ++ w XIA23621.1|CBM32|GH92 543 GKDTPT-RTGARIVDGKPyvnNGFWDTYRtAW 573 444444.8999*****9633145999863334 PP == domain 3 score: 24.2 bits; conditional E-value: 2e-09 CBM32.hmm 10 sssaaggggaenavDgdpnt.rWssag.qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..t 89 +ss+++ g +++D+d + a+ +++ + +p++v ++lt + ++ +++++S Dg++W+t+++++++ XIA23621.1|CBM32|GH92 999 TSSTPTIAGLPALFDNDSASeAVLPATsTTIAWHYAAPRRVALLTLTS-AaRaAAPSGWQLQASVDGHHWRTLDTRQQQR-FAwpR 1082 444555567788999976653444433456999999***********5.234589******************9986533.33432 PP CBM32.hmm 90 etitfd..kpvtaryvRltv 107 +t+ f+ +p + ++Rl + XIA23621.1|CBM32|GH92 1083 QTRAFAvpAPGEYAHYRLHF 1102 45577744666778888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1123 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 106.00 // Query: BEP42756.1|CBM32|GH92 [L=1012] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-12 34.5 1.0 1.3e-12 34.5 1.0 3.4 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.0 0.094 0.094 87 109 .. 239 259 .. 219 278 .. 0.65 2 ? -3.6 0.1 0.82 0.82 24 35 .. 467 478 .. 457 490 .. 0.70 3 ? -0.4 0.6 0.082 0.082 14 35 .. 577 598 .. 567 635 .. 0.77 4 ! 34.5 1.0 1.3e-12 1.3e-12 10 122 .. 884 1004 .. 878 1006 .. 0.69 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.094 CBM32.hmm 87 gttetitfdkpvtaryvRltvtk 109 gt ++it ++ a y+R+t+ + BEP42756.1|CBM32|GH92 239 GTRTEITPTD--HAAYFRFTAAA 259 2212444442..389****9933 PP == domain 2 score: -3.6 bits; conditional E-value: 0.82 CBM32.hmm 24 DgdpntrWssag 35 Dg +trW+s g BEP42756.1|CBM32|GH92 467 DGGWTTRWASPG 478 665568999863 PP == domain 3 score: -0.4 bits; conditional E-value: 0.082 CBM32.hmm 14 aggggaenavDgdpntrWssag 35 ++ g +n++Dg + W+ ++ BEP42756.1|CBM32|GH92 577 NSATGYANIFDGASTGTWAGGW 598 3446789*****6554888753 PP == domain 4 score: 34.5 bits; conditional E-value: 1.3e-12 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag..qwltv.dLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt. 88 +++a+++ g +n++D t Wss+ w++ g++++v ++lt + + +++ +++ +S+Dg +Wtt+++++++ BEP42756.1|CBM32|GH92 884 ATTASNTTGLKNLNDRTSLTEWSSGAgaAWIQGsTAGTARKVAIYTLTS-SgkTgQDPAGWTLKGSNDGIDWTTLDTRQGEV-FAw 967 233445589*******6559****8458899761566889999999995.23446********************9987543.333 PP CBM32.hmm 89 teti.tfd..kpvtaryvRltvtkra.tnawgasiaEl 122 +++ +f +p +Rl++ + ++s++E+ BEP42756.1|CBM32|GH92 968 RRQVrPFVvkTPGAYSTYRLEIGR-GvGGGGAVSLSEF 1004 234446665455545889999933.3233455888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1012 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 119.59 // Query: XSS42347.1|CBM32|GH92 [L=1345] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-30 90.8 22.4 1.5e-21 63.3 5.2 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.3 5.2 1.5e-21 1.5e-21 9 121 .. 88 207 .. 82 212 .. 0.79 2 ? 0.8 0.2 0.035 0.035 4 47 .. 703 749 .. 700 773 .. 0.69 3 ! 34.5 4.1 1.3e-12 1.3e-12 15 117 .. 1181 1289 .. 1174 1301 .. 0.76 Alignments for each domain: == domain 1 score: 63.3 bits; conditional E-value: 1.5e-21 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gtte 90 +s+++a+g+ga+ +vDg++ ++W + + w++v L +p v+k+ lt + + ++++++++++S+Dg++Wtt++++++++ ++ XSS42347.1|CBM32|GH92 88 ASAENAPGEGAAQLVDGSTASKWLAFEstGWVEVHLSEPAAVKKYALTSaDDaPeRDPRNWTIQGSQDGSNWTTIDTRTDQKFaERHQ 175 45567777*********9999****74467******************7522546**********************99987645466 PP CBM32.hmm 91 titfd..kpvtaryvRltvtkratnawgasiaE 121 t+++d ++ + ++R++vt+++ a +++aE XSS42347.1|CBM32|GH92 176 TVQYDvaEAEEWSWYRIEVTANSG-ADIVQLAE 207 777777677779*******66542.22255555 PP == domain 2 score: 0.8 bits; conditional E-value: 0.035 CBM32.hmm 4 assaessssaaggggaenavDgd...pntrWssag.qwltvdLgkptt 47 +ssae+ s+++ ++ + +vDg+ +n +W ++ w + L +p++ XSS42347.1|CBM32|GH92 703 QSSAENVPSSPT-ETGAPVVDGKvyvNNGFWDTYRtAWAAYGLYAPQQ 749 566665555555.99999****85533458988645677766666655 PP == domain 3 score: 34.5 bits; conditional E-value: 1.3e-12 CBM32.hmm 15 ggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.aen.grikdykvevStDgktWttvaekgnttdgt..tetitf 94 g ++ ++a+D++ +t s +g +lt + + t d +++t ae +++ +k+++S+Dgk Wtt++e+++++ + +t++f XSS42347.1|CBM32|GH92 1181 GADDVSAAFDDNSRTEVSLSGddRSLTWKGSDTATADFYTVTSgAEDgADPTAWKLQGSNDGKAWTTIDERNEQQ-FSwrRQTRPF 1265 557899*****99997666534667*****************65334599*******************997654.4443347788 PP CBM32.hmm 95 d..kpvtaryvRltvtkratnawga 117 + ++v+ + +Rl++t+ +t ++ + XSS42347.1|CBM32|GH92 1266 QlaEAVSYKSYRLVFTGPQTATT-V 1289 8889999********77554222.3 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1345 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 154.99 // Query: XVK59669.1|CBM32|GH92 [L=1003] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-15 42.2 7.4 7.1e-15 41.8 5.0 2.4 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.0 0.18 0.18 91 109 .. 210 226 .. 181 257 .. 0.64 2 ! 41.8 5.0 7.1e-15 7.1e-15 10 123 .. 880 999 .. 874 1000 .. 0.72 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.18 CBM32.hmm 91 titfdkpvt.aryvRltvtk 109 +it + + a y+R+t+ + XVK59669.1|CBM32|GH92 210 EITPT---DhAAYFRFTMPA 226 34333...327999999933 PP == domain 2 score: 41.8 bits; conditional E-value: 7.1e-15 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag..qwltvdLg..kpttvdkvvltwae...n.grikdykvevStDgktWttvaekgnttd.gt 88 sss ++ g+++n+ D d +t W+s++ w++ d +p +v ++ ++ + +++k++k+ +S+Dg W+t++e++n++ XVK59669.1|CBM32|GH92 880 SSS-TA-GQPANLYDRDSDTAWQSTSanAWIEADAAtgQPASVPRIYTLTSGtqdSsQDPKSWKLKASKDGVAWVTLDERSNESFmWR 965 233.33.68***************86689*999987226666666655543245547*********************9988654444 PP CBM32.hmm 89 tetitfd.kpvt.a.ryvRltvtkratnawgasiaEla 123 ++t++f+ k+ t a ++R+++ +n+ + s+aE++ XVK59669.1|CBM32|GH92 966 QQTRPFAlKAGTeAySKYRIEF----ANTGTLSVAEFE 999 5577999855542668888888....334348999985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1003 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 144.54 // Query: UIJ62969.1|CBM0|CBM32|GH92 [L=1263] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-35 108.3 11.6 4.9e-24 71.4 2.4 3.5 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.4 2.4 4.9e-24 4.9e-24 6 122 .. 83 205 .. 78 207 .. 0.80 2 ? -2.9 0.0 0.47 0.47 20 42 .. 701 727 .. 691 736 .. 0.71 3 ? -2.4 0.0 0.33 0.33 59 77 .. 1077 1096 .. 1065 1110 .. 0.80 4 ! 41.0 0.6 1.3e-14 1.3e-14 14 110 .. 1150 1250 .. 1143 1258 .. 0.79 Alignments for each domain: == domain 1 score: 71.4 bits; conditional E-value: 4.9e-24 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgn 83 +a s ++++gg+ a n+vD +p+t+W +++ w ++ L +pt ++++ lt a+ +++kd+++++S Dg+ Wtt++++++ UIJ62969.1|CBM0|CBM32|GH92 83 TA-SDENTDGGEVAVNLVDANPDTKWLAWEptGWAQFQLSEPTAITHYALTSANdsAeRDPKDWTLQGSADGQVWTTIDQRSG 164 33.4566778799***************95678******************7334446********************99988 PP CBM32.hmm 84 ttd.gt.te.titfdkpvtaryvRltvtkratnawgasiaEl 122 ++ g ++ + +++++vt ry+Rl vt+++ + + +++El UIJ62969.1|CBM0|CBM32|GH92 165 QSFaGRlQTnSYQLTSAVTYRYYRLDVTANN-GGPLLQLSEL 205 87767774436688899**********5532.2344666665 PP == domain 2 score: -2.9 bits; conditional E-value: 0.47 CBM32.hmm 20 enavDgd...pntrWssag.qwltvdL 42 + +vDg+ +n +W ++ +w +dL UIJ62969.1|CBM0|CBM32|GH92 701 QQVVDGQlyvNNGFWDTYRtTWPAYDL 727 678999854334699997456877777 PP == domain 3 score: -2.4 bits; conditional E-value: 0.33 CBM32.hmm 59 grikdykvevS.tDgktWtt 77 +++k++ v++ Dgk Wt UIJ62969.1|CBM0|CBM32|GH92 1077 NNAKNVYVQGLrVDGKPWTS 1096 68999999999889999996 PP == domain 4 score: 41.0 bits; conditional E-value: 1.3e-14 CBM32.hmm 14 aggggaenavDgdpntrWssagqwltvdLgkp.ttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gtt 89 +g+g+a++++D+ +t ++++ +++ L +p v+ ++lt + +++ +++++S Dg++Wtt+++++n+t UIJ62969.1|CBM0|CBM32|GH92 1150 KGTGSAAALFDNTSKTEAQATT--VQYQLAAPgNPVSYYTLTS-GkqAgADPTGWTLSGSADGQNWTTLDSRANQTFqWR- 1226 46689*******8888888876..********99********5.3433699*******************9998764333. PP CBM32.hmm 90 e.titfd..kpvtaryvRltvtkr 110 + t++f p +y+Rl+ t+ UIJ62969.1|CBM0|CBM32|GH92 1227 DqTRPFRvaHPGGYTYYRLQLTGP 1250 43667776577667*****99653 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1263 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 159.71 // Query: UUN29811.1|CBM32|GH92 [L=1275] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-25 75.7 9.5 2e-20 59.7 1.8 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.7 1.8 2e-20 2e-20 8 118 .. 98 217 .. 92 223 .. 0.74 2 ? 0.8 0.1 0.036 0.036 13 40 .. 716 747 .. 707 778 .. 0.70 3 ! 17.7 0.1 2.1e-07 2.1e-07 38 105 .. 1185 1258 .. 1162 1272 .. 0.62 Alignments for each domain: == domain 1 score: 59.7 bits; conditional E-value: 2e-20 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.. 88 +s+++ ag + en+vD +p+t+W + + wl++d+++p +v ++ lt a+ ++++d+++e+S+Dg++W+t+++++++t ++ UUN29811.1|CBM32|GH92 98 SSEYAGAG-EVKENLVDLQPSTKWLAFEktAWLEFDMDAPVKVVTYALTSANdfDiRDPRDWTLEGSSDGTDWKTLDTRAGETFDKrf 184 33444555.99***************75578******************7334668*********************98876643346 PP CBM32.hmm 89 .tetitfd..kpvta.ryvRltvtkra.tnawgas 118 t+t +d +++ a ++Rl++t+++ ++ +++ UUN29811.1|CBM32|GH92 185 qTKTYGIDaaNAA-AyAHYRLEITANNgAG-DATQ 217 3234455564444.4499*****6654332.2245 PP == domain 2 score: 0.8 bits; conditional E-value: 0.036 CBM32.hmm 13 aaggggaenavDgd...pntrWssag.qwltv 40 ++++++ +++vDg +n +W ++ +w + UUN29811.1|CBM32|GH92 716 DTPTHTGAKIVDGRvyvNNGFWDTYRtTWPAY 747 445599*******7543345999863445444 PP == domain 3 score: 17.7 bits; conditional E-value: 2.1e-07 CBM32.hmm 38 ltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd..kpvtaryvRl 105 v+L + ++v++t ++ + + + +++S Dg tWt v+++++++ +++t+ f+ p ++Rl UUN29811.1|CBM32|GH92 1185 AAVELPVAPGTRAVQYTLtSStKdKAPAGWILQGSRDGATWTAVDKRSGESFaWDKQTRVFTvaRPGAYEKYRL 1258 46666666666788888764345699******************987764433333444555224443355554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1275 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 162.68 // Query: XPG83696.1|CBM32|GH92 [L=1009] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-13 35.1 0.8 8.2e-13 35.1 0.8 3.4 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.087 0.087 87 108 .. 236 255 .. 214 273 .. 0.64 2 ? -3.6 0.1 0.82 0.82 24 35 .. 464 475 .. 454 487 .. 0.70 3 ? -0.4 0.6 0.082 0.082 14 35 .. 574 595 .. 564 632 .. 0.77 4 ! 35.1 0.8 8.2e-13 8.2e-13 10 122 .. 881 1001 .. 874 1003 .. 0.70 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.087 CBM32.hmm 87 gttetitfdkpvtaryvRltvt 108 gt ++it ++ a y+R+t+ XPG83696.1|CBM32|GH92 236 GTRTEITPTD--HAAYFRFTAA 255 2212444432..389****993 PP == domain 2 score: -3.6 bits; conditional E-value: 0.82 CBM32.hmm 24 DgdpntrWssag 35 Dg +trW+s g XPG83696.1|CBM32|GH92 464 DGGWTTRWASPG 475 665568999863 PP == domain 3 score: -0.4 bits; conditional E-value: 0.082 CBM32.hmm 14 aggggaenavDgdpntrWssag 35 ++ g +n++Dg + W+ ++ XPG83696.1|CBM32|GH92 574 NSATGYANIFDGASTGTWAGGW 595 3446789*****6554888753 PP == domain 4 score: 35.1 bits; conditional E-value: 8.2e-13 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag..qwltv.dLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt. 88 s++a+++ g +n++D t Wss+ w++ g++++v ++lt + + +++ +++ +S+Dg +Wtt+++++++ XPG83696.1|CBM32|GH92 881 STTASNTTGLKNLNDRTSLTEWSSGAgaAWIQGsTAGTARKVAIYTLTS-SskTgQDPAGWTLKGSNDGIDWTTLDTRQGEV-FAw 964 444556689*******6559****8458899761566889999999996.23446********************9987543.333 PP CBM32.hmm 89 teti.tfd..kpvtaryvRltvtkratnawgasiaEl 122 +++ +f +p +Rl++ + + ++s++E+ XPG83696.1|CBM32|GH92 965 RRQVrPFVvkAPGAYSTYRLEIGGGVGGGGAVSLSEF 1001 2344466654555458899999433233345888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1009 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 146.32 // Query: XVK61925.1|CBM32|GH92 [L=969] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-12 31.8 3.0 8.9e-12 31.8 3.0 3.5 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.7 0.0 0.1 0.1 87 109 .. 199 219 .. 178 234 .. 0.64 2 ? -3.5 0.1 0.75 0.75 24 35 .. 427 438 .. 417 451 .. 0.70 3 ? 0.4 0.6 0.044 0.044 14 35 .. 537 558 .. 527 596 .. 0.77 4 ! 31.8 3.0 8.9e-12 8.9e-12 11 122 .. 845 961 .. 838 963 .. 0.68 Alignments for each domain: == domain 1 score: -0.7 bits; conditional E-value: 0.1 CBM32.hmm 87 gttetitfdkpvtaryvRltvtk 109 gt ++it ++ a y+R+t+ + XVK61925.1|CBM32|GH92 199 GTRTEITPTD--HAAYFRFTAGA 219 2212444432..379***99933 PP == domain 2 score: -3.5 bits; conditional E-value: 0.75 CBM32.hmm 24 DgdpntrWssag 35 Dg +trW+s g XVK61925.1|CBM32|GH92 427 DGGWTTRWASPG 438 665568999963 PP == domain 3 score: 0.4 bits; conditional E-value: 0.044 CBM32.hmm 14 aggggaenavDgdpntrWssag 35 ++ g +n++Dg + W+ ++ XVK61925.1|CBM32|GH92 537 NSATGYANIFDGTSTGAWAGGW 558 3446789*****5445999863 PP == domain 4 score: 31.8 bits; conditional E-value: 8.9e-12 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag...qwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt.tet 91 ++a++ g + ++D t Wss++ w++ +++tv ++lt ++ + +++ +++ +S+Dg +Wtt+++++++ ++ XVK61925.1|CBM32|GH92 845 TTASNATGLKDLNDRTSLTEWSSGTsgtAWIQGSTAtTARTVAIYTLTSSNkTgQDPAGWTLKGSNDGINWTTLDSRQGEV-FAwRRQ 931 3333446788888885559****8456899998888455888888888533447********************9987543.333234 PP CBM32.hmm 92 i.tfd..kpvtaryvRltvtkratnawgasiaEl 122 + +f +p +Rl++ +++ ++s++E+ XVK61925.1|CBM32|GH92 932 VrPFVvkTPGAYSSYRLEI----AGSGAVSLSEF 961 4466654555458899999....33344788887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (969 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 128.36 // Query: XBH20901.1|CBM32|GH92 [L=2041] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-22 66.6 23.2 2e-17 50.0 0.5 5.6 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 50.0 0.5 2e-17 2e-17 10 110 .. 97 206 .. 91 230 .. 0.74 2 ? 0.3 0.0 0.048 0.048 35 56 .. 345 375 .. 300 423 .. 0.68 3 ? 0.5 0.1 0.044 0.044 6 34 .. 713 744 .. 708 763 .. 0.68 4 ! 27.3 1.1 2.1e-10 2.1e-10 17 122 .. 1175 1288 .. 1168 1303 .. 0.65 5 ? -1.9 1.9 0.24 0.24 36 71 .. 1675 1708 .. 1637 1798 .. 0.56 Alignments for each domain: == domain 1 score: 50.0 bits; conditional E-value: 2e-17 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gt..t 89 s+++++ +g++n+ Dg++nt+W + t++L p +++++lt ++ + +++kd+ v++S Dg tW+++++++++t g t XBH20901.1|CBM32|GH92 97 STESPAAEGPANLADGSANTKWLIREpiGHATYELSDPAAITGYTLTSaNNaSeRDPKDFVVQGSIDGATWVDLDTQTGQTWtGRlaT 184 334455589**************96345469****************8533557********************99876554455643 PP CBM32.hmm 90 etitfd.kpvtaryvRltvtkr 110 ++ +++ + + ++Rl +t++ XBH20901.1|CBM32|GH92 185 NKYELPaLTEKYGFYRLAITAN 206 3446664223468999999553 PP == domain 2 score: 0.3 bits; conditional E-value: 0.048 CBM32.hmm 35 g..qw..ltvdLgkp..ttvdkvvltw...a 56 + qw +tvdLgk ++v+kv + + + XBH20901.1|CBM32|GH92 345 WpdQWnsVTVDLGKFsgKSVKKVLVSYeqpG 375 1444444******653379999988865331 PP == domain 3 score: 0.5 bits; conditional E-value: 0.044 CBM32.hmm 6 saessssaaggggaenavDgd...pntrWssa 34 sa+ + sa+ + +++vDg+ +n +W ++ XBH20901.1|CBM32|GH92 713 SATDGGSASDANRKAKIVDGKmyvNNGFWDTY 744 4444555555588*******855334599885 PP == domain 4 score: 27.3 bits; conditional E-value: 2.1e-10 CBM32.hmm 17 ggaenavDgdpntrWssag..qwltvdLg.kpttvdkvvltwae...n.grikdykvevStDgktWttvaekgnttd.gttetitf 94 +++++vD++ ++ ++ +++t + +p +++++t + + g++ ++ +++StDg +Wt+++++++++ +t+t++f XBH20901.1|CBM32|GH92 1175 TNISALVDDNMRSNVVFDEnsTEITWKSAsGPVFAHQYTVTS-TtgpGvGTPESWILQGSTDGVNWTELDKRSGQEFkFNTQTRPF 1259 556777777766543332112334444443677788888885.234558********************98776554444456677 PP CBM32.hmm 95 d...kpvta.ryvRltvtkratnawgasiaEl 122 + + a + +Rlt ++ + ++ +aEl XBH20901.1|CBM32|GH92 1260 TvktQ-GGAfTQFRLTLNSA--EGTKLGLAEL 1288 76432.33559999999442..2233555554 PP == domain 5 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 36 qwltvdLgkpttvdkvvltwaengrikdykvevStD 71 w+tvd g ++v++ e + + +y+ +vS D XBH20901.1|CBM32|GH92 1675 VWVTVDDGVRSVATQVEIIV-E-DSTPTYDPSVSID 1708 33333333333333333332.1.1122222222222 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (2041 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.00 // Query: XTM39292.1|CBM32 [L=1051] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-21 62.1 3.9 9.7e-21 60.7 2.9 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.7 2.9 9.7e-21 9.7e-21 5 116 .. 259 374 .. 255 400 .. 0.76 2 ? -2.7 0.0 0.42 0.42 38 55 .. 611 628 .. 578 660 .. 0.72 Alignments for each domain: == domain 1 score: 60.7 bits; conditional E-value: 9.7e-21 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt...t 89 s+ ++s ++++++ a+n+ D dp+t+W s++ ++t++L kp v +++lt a+ + +++kd+++++S+D +tWt++++++++ ++ XTM39292.1|CBM32 259 SAITASGENPPNEVAANLDDHDPSTKWLSKQptGSVTYELAKPAVVVRYSLTSANdsPgRDPKDFTLQGSNDASTWTDLDKRTGQRFDSryiS 351 45567888899999***************844567*****************7334547********************99887654333432 PP CBM32.hmm 90 etitfdkpvta.ryvRltvtkratnawg 116 + +tf++++ a ry+Rl+vt+ +wg XTM39292.1|CBM32 352 NGFTFKNTA-AyRYYRLNVTT----NWG 374 355777544.45*******55....343 PP == domain 2 score: -2.7 bits; conditional E-value: 0.42 CBM32.hmm 38 ltvdLgkpttvdkvvltw 55 + ++Lg p t+++v l XTM39292.1|CBM32 611 VPLKLGDPSTIKHVFLLV 628 556788888888887764 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1051 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 140.46 // Query: XBV27240.1|CBM32|GH92 [L=1316] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-29 86.8 22.0 2.3e-18 53.1 7.1 4.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.1 7.1 2.3e-18 2.3e-18 5 109 .. 71 182 .. 67 198 .. 0.78 2 ? -0.2 0.2 0.069 0.069 13 34 .. 703 727 .. 692 748 .. 0.66 3 ! 40.5 2.1 1.8e-14 1.8e-14 14 121 .. 1165 1277 .. 1154 1280 .. 0.72 Alignments for each domain: == domain 1 score: 53.1 bits; conditional E-value: 2.3e-18 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd. 86 +a +++++++g+ a+na Dgd+ t+W + wl++ +p ++k+ lt a+ +++++++v++S+Dg+tWtt++++++++ XBV27240.1|CBM32|GH92 71 VTA-NGENTGAGEIASNAADGDKFTKWLVFEptGWLVYQTSAPVVIKKYALTSANdaDgRDPQNWTVSGSNDGSTWTTLDTRTGQSFe 157 444.3555566689********99*****74467******************7334546**********************9988776 PP CBM32.hmm 87 gt..tetitfdkpvtaryvRltvtk 109 + t++ +f++++ +y++l +t XBV27240.1|CBM32|GH92 158 NRfqTKEYSFANDTAYTYFKLDITL 182 6673347788876656*****9943 PP == domain 2 score: -0.2 bits; conditional E-value: 0.069 CBM32.hmm 13 aaggggaenavDgdp..nt.rWssa 34 ++++ + +++vDg++ n+ +W ++ XBV27240.1|CBM32|GH92 703 DTPTTTGSKIVDGQTyvNNgFWDTY 727 4455889******632222378874 PP == domain 3 score: 40.5 bits; conditional E-value: 1.8e-14 CBM32.hmm 14 aggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt.te.tit 93 agg + +++vD+d++t +g ++tv L + + v ++lt + + + ++ +++e+S+Dg+tWt+v+ ++++t t++ XBV27240.1|CBM32|GH92 1165 AGGADVSALVDNDTKTQVTLTGaqPTVTVALPQGRPVGMYTLTS-GaTgTAPSAWTLEGSNDGTTWTPVDRRTGQTW-AwASyTRS 1248 4557899*****99986544433567*****************5.344599******************98775432.13232447 PP CBM32.hmm 94 fd..kpvtaryvRltvtkratnawgasiaE 121 f+ +p + +Rl+ t ++a+g+ ++E XBV27240.1|CBM32|GH92 1249 FNvaSPKAYTQYRLVLTPA-AGATGVTLSE 1277 7765664459999999543.3345566666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1316 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 165.01 // Query: XLQ72448.1|CBM32|GH92 [L=1288] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-27 82.9 16.2 6e-22 64.6 3.1 3.5 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.6 3.1 6e-22 6e-22 9 112 .. 102 213 .. 96 225 .. 0.75 2 ? -3.1 0.3 0.54 0.54 14 40 .. 732 762 .. 725 788 .. 0.64 3 ? -2.8 0.1 0.44 0.44 23 35 .. 782 794 .. 764 810 .. 0.67 4 ! 26.5 0.3 3.9e-10 3.9e-10 21 107 .. 1186 1272 .. 1175 1285 .. 0.71 Alignments for each domain: == domain 1 score: 64.6 bits; conditional E-value: 6e-22 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt..t 89 s+++a++g++ e++vDg +t+W + w++++L++p +v ++ lt a+ + +++kd+++++StDgk+W++++++++++ + t XLQ72448.1|CBM32|GH92 102 SGENAGSGETKEKLVDGEQSTKWLTFKptGWVEFELDEPAKVVTYALTSANdhQeRDPKDWTLQGSTDGKDWKDLDTRKGEKFASpfT 189 4566777799***************63456******************7334667********************9976554443443 PP CBM32.hmm 90 e.titfdkpvta.ryvRltvtkrat 112 + + +f++ +ta ++Rl +t+++ XLQ72448.1|CBM32|GH92 190 TkKYDFQN-ATAySHYRLDITANNG 213 32446665.5566*******66442 PP == domain 2 score: -3.1 bits; conditional E-value: 0.54 CBM32.hmm 14 aggggaenavDgdp...ntrWssag.qwltv 40 +++++ +++v g+p n +W ++ +w + XLQ72448.1|CBM32|GH92 732 TPTHTGAKIVEGKPyvnNGFWDTYRtTWPAY 762 4458888889998533134888853345444 PP == domain 3 score: -2.8 bits; conditional E-value: 0.44 CBM32.hmm 23 vDgdpntrWssag 35 Dg+ ++rWss g XLQ72448.1|CBM32|GH92 782 KDGSWTSRWSSPG 794 4666667999863 PP == domain 4 score: 26.5 bits; conditional E-value: 3.9e-10 CBM32.hmm 21 navDgdpntrWssagqwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd..kpvtar 101 ++D++ +t+ sa+ +++ ++ t+ +++lt + + ++ + +++S Dg++W tv+++++++ +++t++f+ +p + XLQ72448.1|CBM32|GH92 1186 ELFDNSSSTYANSAS--VVLPVQGRTKAVQYTLT-SAdKaKAPRGWVLQGSRDGEKWSTVDKRSGQSFaWDQQTRPFTvsDP--GA 1266 589998889888864..55555555555555555.3345699******************9987766444455779996555..57 PP CBM32.hmm 102 yvRltv 107 yv+++ XLQ72448.1|CBM32|GH92 1267 YVKYRL 1272 777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1288 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.15 // Query: XQA54324.1|CBM32 [L=372] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-19 55.2 2.1 4.9e-19 55.2 2.1 1.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 55.2 2.1 4.9e-19 4.9e-19 8 121 .. 122 246 .. 116 249 .. 0.71 2 ? -2.1 0.0 0.27 0.27 70 85 .. 310 326 .. 281 342 .. 0.67 Alignments for each domain: == domain 1 score: 55.2 bits; conditional E-value: 4.9e-19 CBM32.hmm 8 essssaaggggaenavDgdpn..trWssag..qwltvdLgkpttvdkvvltw.ae.....ngrikdykvevStDgktWttvaekgnttdgt.t 89 ++ss+ ++ +a a+D+ ++ +W+++ w+++++ + ++v+k++lt ++ + ++kd+++e+S+Dg++Wt+++++ +++ t + XQA54324.1|CBM32 122 SASSEI-STRQAYQAFDKVYTgnKFWQANAatGWIQYKFLEGKRVSKYSLTGiDTgqfslQINPKDWTLEGSNDGSNWTVLDTRVDESFTTlE 213 223333.33566677777543327****84467******************772234543399******************987665433344 PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkra.tnawgasiaE 121 ++i tf+++ + +++Rl++tk++ + ++++E XQA54324.1|CBM32 214 KKIcTFNNTEKFTHYRLNITKNNgMAGY-VALTE 246 5999***77778*******775422123.66666 PP == domain 2 score: -2.1 bits; conditional E-value: 0.27 CBM32.hmm 70 tDgktWttvaekg.ntt 85 +D +W+ v++ + +t+ XQA54324.1|CBM32 310 DDAFHWKNVYSFTqDTP 326 45567888876432332 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (372 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.34 // Query: XUK11269.1|CBM32|GH92 [L=1292] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-29 87.9 4.2 1.6e-21 63.3 0.6 3.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.3 0.6 1.6e-21 1.6e-21 3 122 .. 103 228 .. 101 230 .. 0.79 2 ? -1.3 0.1 0.15 0.15 14 37 .. 734 761 .. 727 795 .. 0.71 3 ! 23.8 0.0 2.7e-09 2.7e-09 39 108 .. 1201 1276 .. 1171 1286 .. 0.72 Alignments for each domain: == domain 1 score: 63.3 bits; conditional E-value: 1.6e-21 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgntt 85 t+ sa s++++agg+ en+vDg p+++W + l++++ +p +v ++ lt a+ ++++d+++ +StDg++W+t++++++++ XUK11269.1|CBM32|GH92 103 TEVSA-SGENTAGGEVKENLVDGEPTSKWLVFTrtARLEFEFSEPVDVVRYALTSANdaAgRDPRDWTLKGSTDGEDWRTLDTRTGED 189 45555.578888889***************9755667*****************7334546*********************998755 PP CBM32.hmm 86 dgt.te..titfdkpvtaryvRltvtkratnawgasiaEl 122 + ++ +++fd++++ r +Rl++t +a ++ +++aE+ XUK11269.1|CBM32|GH92 190 FPRrHQtrEFSFDNATEYRRFRLEITRNAGDDL-TQLAEV 228 444543236688899999*******77554343.777776 PP == domain 2 score: -1.3 bits; conditional E-value: 0.15 CBM32.hmm 14 aggggaenavDgd...pntrWssag.qw 37 +++ + +++vDg+ +n +W ++ +w XUK11269.1|CBM32|GH92 734 TPTRTGARIVDGKvyvNNGFWDTYRtTW 761 4447889999998553345998863345 PP == domain 3 score: 23.8 bits; conditional E-value: 2.7e-09 CBM32.hmm 39 tvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd..kpvtaryvRltvt 108 +dL + ++v++t ++ + + ++ + +++S+Dg W++++ +++++ + +t+ f+ +p t r++Rl+ XUK11269.1|CBM32|GH92 1201 SLDLPVASARRAVQYTLtSShRaDAPSGWVLQGSDDGRRWHELDRRSGESFrWDRQTRVFSvrSPGTYRHYRLVTD 1276 5788888888889999864445699******************9887654333333445555699999*****983 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1292 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 168.43 // Query: XGX78715.1|CBM32|GH92 [L=1695] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-27 81.6 18.5 6.3e-22 64.6 2.0 3.6 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.6 2.0 6.3e-22 6.3e-22 6 111 .. 86 199 .. 82 222 .. 0.78 2 ? -3.5 0.0 0.72 0.72 37 56 .. 342 367 .. 318 408 .. 0.65 3 ? -3.1 0.4 0.56 0.56 7 34 .. 714 743 .. 709 752 .. 0.62 4 ! 28.0 0.8 1.3e-10 1.3e-10 10 122 .. 1177 1296 .. 1172 1300 .. 0.70 Alignments for each domain: == domain 1 score: 64.6 bits; conditional E-value: 6.3e-22 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.g 87 + ++ss++++g+ a+n+ D +p+t+W + w+ + L +p +v +++lt a+ + ++++d+++++S+Dg+tWt+++++++ + g XGX78715.1|CBM32|GH92 86 AVTASSENSPGEVAANLADANPDTKWLAFAssGWVRYQLASPAKVLRYSLTSANdsPeRDPRDFTLQGSSDGTTWTDLDTRTGVDFsG 173 44556777777*****************63367******************7334547*********************988766555 PP CBM32.hmm 88 t..tetitfdkpvtaryvRltvtkra 111 ++++t+++p y+Rl+vt+ + XGX78715.1|CBM32|GH92 174 RfaKQDFTVKTPEAYAYYRLNVTAVH 199 575445566555445*******6633 PP == domain 2 score: -3.5 bits; conditional E-value: 0.72 CBM32.hmm 37 w..ltvdLgkp...ttvdkvvltw.a 56 w + vd gk+ +t+d++ + + + XGX78715.1|CBM32|GH92 342 WnaVSVDVGKVaagRTIDRILVGYdN 367 33378888876334577777777541 PP == domain 3 score: -3.1 bits; conditional E-value: 0.56 CBM32.hmm 7 aessssaaggggaenavDgd...pntrWssa 34 a+s+s++a+ + +++ Dg+ +n +W ++ XGX78715.1|CBM32|GH92 714 ATSGSATAT-TTNAAVKDGKiyvNNGFWDTY 743 444555555.778888888744233588774 PP == domain 4 score: 28.0 bits; conditional E-value: 1.3e-10 CBM32.hmm 10 sssaaggggaenavDgdpnt..rWssagqwltvdLgkp.ttvdkvvltwae.n.grikdykvevStD.gktWttvaekgnttdgt. 88 +++ a+g++a++++D+ +t +ssa+ ++ + L + ++ + ++lt ++ + g+++ +++e+S+D gk+W+t+++++++ + XGX78715.1|CBM32|GH92 1177 ATDLASGQEAKALFDNTSRTsaTFSSATPTVGFTLSGIgQRATWYTLT-SGpKaGDPSAWRLEGSKDgGKSWRTLDTRSGQVFPWr 1261 344566699*******55543323333257******996777777777.44557***********99679******9877654333 PP CBM32.hmm 89 tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 ++t++f+ p t + +Rl+vt++a + +a+++E+ XGX78715.1|CBM32|GH92 1262 QQTRPFEiaHPNTFTTYRLVVTATAGG-AAANLSEV 1296 45778888766678*******776643.34666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1695 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 170.33 // Query: WNV90176.1|CBM32|GH92 [L=1426] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-31 93.7 27.2 1.5e-21 63.4 6.3 4.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.4 6.3 1.5e-21 1.5e-21 7 122 .. 97 219 .. 91 221 .. 0.77 2 ? -2.9 4.6 0.49 0.49 13 40 .. 718 749 .. 707 861 .. 0.77 3 ! 42.4 1.2 4.6e-15 4.6e-15 15 122 .. 1175 1279 .. 1169 1285 .. 0.73 Alignments for each domain: == domain 1 score: 63.4 bits; conditional E-value: 1.5e-21 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt 88 a +s++++gg+ en+vD + n++W + + w ++ + +pttv+++ + a+ +++k++++++S Dg+tWtt+++++n+ WNV90176.1|CBM32|GH92 97 A-NSENTSGGEVKENLVDANVNSKWLTFTstGWAQFRFSEPTTVKRYAISSANdaDeRDPKNWTFQGSADGQTWTTLDTRTNEVFaER 183 3.3445666699***************74478******************7334546*********************9998765333 PP CBM32.hmm 89 .teti.tfdkpvta.ryvRltvtkratnawgasiaEl 122 ++++ +++ ++ta y+Rl +t++a + + ++aE+ WNV90176.1|CBM32|GH92 184 lQTKVyDLA-NTTAyPYYRLDITANAGGVNLIQVAEV 219 534444666.56666*******776643344777776 PP == domain 2 score: -2.9 bits; conditional E-value: 0.49 CBM32.hmm 13 aaggggaenavDgd...pntrWssag.qwltv 40 ++++++ +++vDg+ +n +W ++ +w + WNV90176.1|CBM32|GH92 718 STPTQTGAKVVDGKiyvNNGFWDTYRtTWPAY 749 44557889999998443345888853345433 PP == domain 3 score: 42.4 bits; conditional E-value: 4.6e-15 CBM32.hmm 15 ggggaenavDgdpntrWssagqwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd. 95 g++++vD+ + t + ++ l+vdL ++++ ++ ++ + ++k++ + +S DgktWtt++e+++++ ++t+ f+ WNV90176.1|CBM32|GH92 1175 KFTGPAALVDDTTATQAAVDS--LQVDLPNTKEKAEFYTLTSStTtADAKNWVLRGSLDGKTWTTADERKDQKF-AwrKQTRAFKi 1257 44579******5555544445..******9976666644433344699*******************9987664.23345668887 PP CBM32.hmm 96 .kpvtaryvRltvtkratnawgasiaEl 122 kp ry+Rl+v a ga +aE+ WNV90176.1|CBM32|GH92 1258 aKPGFYRYYRLEV------AGGATLAEF 1279 688889*******......335667776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1426 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.20 // Query: UIX30175.1|CBM0|CBM32|GH92 [L=1275] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-28 84.9 12.2 1.7e-21 63.1 1.1 4.2 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.1 1.1 1.7e-21 1.7e-21 9 111 .. 101 211 .. 94 224 .. 0.76 2 ? 0.9 0.2 0.032 0.032 15 45 .. 718 752 .. 713 802 .. 0.76 3 ? -2.8 0.0 0.44 0.44 61 78 .. 1098 1116 .. 1087 1137 .. 0.61 4 ! 25.4 0.3 8.6e-10 8.6e-10 20 107 .. 1173 1262 .. 1166 1272 .. 0.68 Alignments for each domain: == domain 1 score: 63.1 bits; conditional E-value: 1.7e-21 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd 86 s+++a++ + en+vD p+t+W + w+++dL +p +v ++ lt a+ ++++d+++ +S Dg++Wttv+++++++ UIX30175.1|CBM0|CBM32|GH92 101 SGENAGAREVKENLVDVEPSTKWLTFAptGWVEFDLAAPVEVVTYALTSANdhDeRNPQDWTLRGSADGTNWTTVDARTGESF 183 4555666689***************74457******************7334546********************99876543 PP CBM32.hmm 87 gt..tetitfd..kpvtaryvRltvtkra 111 ++ + t+t+d +p++ r++Rl+++k++ UIX30175.1|CBM0|CBM32|GH92 184 SEpfQ-TKTYDiaSPAEYRHFRLEISKNN 211 33342.445554499999*******5533 PP == domain 2 score: 0.9 bits; conditional E-value: 0.032 CBM32.hmm 15 ggggaenavDgd...pntrWssag.qwltvdLgkp 45 ++++ +++vDg+ +n +W ++ +w + L +p UIX30175.1|CBM0|CBM32|GH92 718 PTHTGAKIVDGKvyvNNGFWDTYRtTWPAYSLLTP 752 458999999*9855334699986445655555555 PP == domain 3 score: -2.8 bits; conditional E-value: 0.44 CBM32.hmm 61 ikdykvevS.tDgktWttv 78 ++++ v++ +gk+Wt UIX30175.1|CBM0|CBM32|GH92 1098 ARNVYVQGLkVNGKSWTST 1116 5555555554567777643 PP == domain 4 score: 25.4 bits; conditional E-value: 8.6e-10 CBM32.hmm 20 enavDgdpntrWssag.qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd. 95 e ++D+ t + + +++++ Lg+ t+ +++lt + ++ + +++S+Dg++W+t++ +++++ + +t+ f+ UIX30175.1|CBM0|CBM32|GH92 1173 EELFDNTSATN--A-TmTSVELPLGGRTKAVQYTLTS-AdRaAAPTGWVLQGSSDGTNWRTLDRRSGESFrWDRQTRAFSv 1249 56778743332..2.1234999999999999999995.234589******************9887654333333556664 PP CBM32.hmm 96 .kpvtaryvRltv 107 ++ + +Rl++ UIX30175.1|CBM0|CBM32|GH92 1250 tSAGSYAQYRLVF 1262 4555566666666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1275 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 138.46 // Query: XKV07825.1|CBM0|CBM32|GH92 [L=1270] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-30 90.9 14.8 1e-22 67.1 0.9 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.1 0.9 1e-22 1e-22 9 123 .. 95 217 .. 88 218 .. 0.80 2 ? 1.5 0.2 0.02 0.02 10 37 .. 713 743 .. 705 758 .. 0.68 3 ! 29.8 0.9 3.7e-11 3.7e-11 17 109 .. 1165 1259 .. 1155 1267 .. 0.73 Alignments for each domain: == domain 1 score: 67.1 bits; conditional E-value: 1e-22 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd 86 s+++++g++ n++Dg t+W + w+++dL++pt++ k+ lt a+ +++ d+++ +StDg++W+t++++++++ XKV07825.1|CBM0|CBM32|GH92 95 SGENTGGKEVKGNLFDGESATKWLTFAptGWIEFDLDEPTRIVKYALTSANdhDeRDPVDWTLKGSTDGEDWKTLDTRSGESF 177 5667788899*******999*****74457******************7334546********************99876554 PP CBM32.hmm 87 gt...tetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++ t+t ++++p++ r+ R+++tk++ ++ + ++aE++ XKV07825.1|CBM0|CBM32|GH92 178 PErfeTRTYDLAEPAEFRHWRVEFTKNKGSDDALQLAEIQ 217 4434233556669999********9988545669999985 PP == domain 2 score: 1.5 bits; conditional E-value: 0.02 CBM32.hmm 10 sssaaggggaenavDgd...pntrWssag.qw 37 + + +++++ +++vDg+ +n +W ++ +w XKV07825.1|CBM0|CBM32|GH92 713 GPD-TPTHTGAKIVDGKvyvNNGFWDTYRtTW 743 444.4559********9553346999863334 PP == domain 3 score: 29.8 bits; conditional E-value: 3.7e-11 CBM32.hmm 17 ggaenavDgdpntrWssagqwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttetit 93 ga +++D+ t ++ tv+L + + +v++t ++ + ++ +++++S Dg+tWt+++ ++++t + +t+ XKV07825.1|CBM0|CBM32|GH92 1165 KGAGALFDNTSAT--GATV--STVELPVTGDTEAVQYTLtSSdHaDAPTGWTLQGSADGETWTDLDRRTDETFrWDRQTRA 1241 5688899983333..3332..59***************973344699*******************998766444333445 PP CBM32.hmm 94 fd..kpvtaryvRltvtk 109 f+ p + ++Rl+ t+ XKV07825.1|CBM0|CBM32|GH92 1242 FSvdRPKSYGHYRLVLTG 1259 554477777888888754 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1270 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.70 // Query: WVM97265.1|CBM32|GH92 [L=1706] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-26 79.1 11.7 4.9e-21 61.7 1.5 4.4 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.7 1.5 4.9e-21 4.9e-21 9 110 .. 101 210 .. 96 233 .. 0.77 2 ? -2.0 0.1 0.25 0.25 38 83 .. 357 421 .. 331 449 .. 0.63 3 ? -3.9 0.3 0.97 0.97 8 34 .. 724 752 .. 719 759 .. 0.58 4 ! 32.5 3.0 5.4e-12 5.4e-12 10 114 .. 1186 1298 .. 1181 1325 .. 0.73 5 ? -2.5 0.1 0.36 0.36 12 33 .. 1513 1540 .. 1508 1560 .. 0.58 Alignments for each domain: == domain 1 score: 61.7 bits; conditional E-value: 4.9e-21 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt.. 88 +s+++++g+ a+n+ D +p+++W + w+ + Lg+p + +++lt a+ + +++kd+++++StDg+tWt+++ +++ + g WVM97265.1|CBM32|GH92 101 ASAENTPGEVAANLADANPDSKWLAFAssAWVRYQLGTPAKAVRYSLTSANdsPeRDPKDFTLQGSTDGTTWTDLDRRTGIDFsGRfa 188 344456669****************74478******************7334547********************9876544334443 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkr 110 ++t+++++p t y+Rl+vt+ WVM97265.1|CBM32|GH92 189 KRTFDVTTPGTYAYYRLNVTAV 210 345566699999*******663 PP == domain 2 score: -2.0 bits; conditional E-value: 0.25 CBM32.hmm 38 ltvdLgkp...ttvdkvvltw...ae.....n..grikdykvevSt......DgktWttvaekgn 83 + +d gk+ +t+d+v + + ++ + g i d++v++ D +++++v +n WVM97265.1|CBM32|GH92 357 VSLDVGKVaagKTIDRVLVGYdntGGatkdtRfgGWIDDVSVQANPavidgaDLTNYVDVRRGTN 421 66777766333588888888765411334442356666777775534553334477888765444 PP == domain 3 score: -3.9 bits; conditional E-value: 0.97 CBM32.hmm 8 essssaaggggaenavDgd...pntrWssa 34 +s+s++a+ + +++ Dg+ +n +W ++ WVM97265.1|CBM32|GH92 724 KSGSATAT-TTNAAVKDGKiyvNNGFWDTY 752 33444444.677777788743223477764 PP == domain 4 score: 32.5 bits; conditional E-value: 5.4e-12 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag..qwltvdLgkp.ttvdkvvltwae.n.grikdykvevS.tDgktWttvaekgnttdgt. 88 +++ a+g++a++++D+ +t + ++ ++t+ L ++ ++ + +++t ++ + g+++ +++e+S +DgktW+t+++++ +t + WVM97265.1|CBM32|GH92 1186 ATDLASGDDAKALFDNTSRTSVAFTSatPSVTFALSGVgQRATWYTVT-SGpKaGDPSAWRLEGSkDDGKTWQTLDTRTAQTFPWr 1270 445566699*******88886555433467******996777777888.44557***********888********9997665332 PP CBM32.hmm 89 tetitfd..kpvtaryvRltvtkratna 114 +t++f+ + t + +Rl+vt++a +a WVM97265.1|CBM32|GH92 1271 VQTRPFEiaHTGTFTTYRLVVTATAGGA 1298 34678887555567999***97765332 PP == domain 5 score: -2.5 bits; conditional E-value: 0.36 CBM32.hmm 12 saaggggaenavDgdpntr......Wss 33 +++ + + n +Dg+ +++ W+ WVM97265.1|CBM32|GH92 1513 KNQDTTATVNFTDGSSTSYkvqygdWCG 1540 3344467778888855554444444544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1706 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 134.33 // Query: XPG33684.1|CBM32|GH92 [L=961] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-13 35.0 2.7 8.8e-13 35.0 2.7 3.3 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.9 0.0 0.11 0.11 87 109 .. 192 212 .. 172 227 .. 0.64 2 ? -4.0 0.1 1 1 24 35 .. 419 430 .. 414 442 .. 0.70 3 ? -0.9 0.6 0.12 0.12 15 34 .. 530 549 .. 521 586 .. 0.76 4 ! 35.0 2.7 8.8e-13 8.8e-13 10 122 .. 837 953 .. 830 955 .. 0.70 Alignments for each domain: == domain 1 score: -0.9 bits; conditional E-value: 0.11 CBM32.hmm 87 gttetitfdkpvtaryvRltvtk 109 gt ++it ++ a y+R+t+ + XPG33684.1|CBM32|GH92 192 GTRTEITPTD--HAAYFRFTAAA 212 2212444332..389****9933 PP == domain 2 score: -4.0 bits; conditional E-value: 1 CBM32.hmm 24 DgdpntrWssag 35 Dg +trW+s g XPG33684.1|CBM32|GH92 419 DGGWTTRWASPG 430 665569999963 PP == domain 3 score: -0.9 bits; conditional E-value: 0.12 CBM32.hmm 15 ggggaenavDgdpntrWssa 34 + g +n++Dg + W + XPG33684.1|CBM32|GH92 530 SATGYANIFDGTSTGTWTGG 549 335679*****544367664 PP == domain 4 score: 35.0 bits; conditional E-value: 8.8e-13 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag...qwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt.te 90 ++ a++ g +n++D t Wss++ w++ +++tv ++lt ++ + +++ +++ +S+Dg +Wtt+++++++ + XPG33684.1|CBM32|GH92 837 TT-ASNATGLKNLNDRTSLTEWSSGTsgaAWIQGSTAtTARTVAIYTLTSSNkTgQDPAGWTLKGSNDGINWTTLDTRQGEV-FAwRR 922 33.334478*******6559****8556899998888455888888888533447********************9987543.33323 PP CBM32.hmm 91 ti.tfd..kpvtaryvRltvtkratnawgasiaEl 122 ++ +f +p +Rl++ +++ ++s++E+ XPG33684.1|CBM32|GH92 923 QVrPFVvkTPGAYSSYRLEI----AGSGAVSLSEF 953 44466654555458999999....33344788887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (961 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 115.32 // Query: BFZ72207.1|CBM32|GH92 [L=1981] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-26 77.3 16.4 2.7e-16 46.4 2.8 4.3 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.4 2.8 2.7e-16 2.7e-16 7 110 .. 119 232 .. 114 245 .. 0.70 2 ? -0.6 0.1 0.092 0.092 36 68 .. 376 422 .. 341 474 .. 0.60 3 ! 37.5 0.5 1.5e-13 1.5e-13 13 110 .. 1204 1308 .. 1196 1333 .. 0.74 4 ? -1.7 0.1 0.21 0.21 52 107 .. 1664 1719 .. 1624 1732 .. 0.67 Alignments for each domain: == domain 1 score: 46.4 bits; conditional E-value: 2.7e-16 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt 88 ++s+++a++++a++a Dgd++t+W + + +l + + +++t +++l ++ + ++++++++ +S++g++Wt+++++++++ ++ BFZ72207.1|CBM32|GH92 119 VSASAENAPNEAAKFAADGDAGTKWLAFTtaATLDYTFTTAQTAVTYKLVSGNdaPeRDPRTWRILGSNNGTDWTELDSQTDQSWkSS 206 3456667787*****************743455777777777777777775234547********************99887654333 PP CBM32.hmm 89 ....tetitfdkpvtaryvRltvtkr 110 +++t++++ t ++Rl + ++ BFZ72207.1|CBM32|GH92 207 ergvAKEFTLKTTGTFSKYRLDIASN 232 44321255666666678888888443 PP == domain 2 score: -0.6 bits; conditional E-value: 0.092 CBM32.hmm 36 qw..ltvdLgkp...ttvdkvvltw....ae....n.grikdykvev 68 qw + vdLg++ +t+d++ l + a+ g d k+e+ BFZ72207.1|CBM32|GH92 376 QWnsVRVDLGRVaqgKTIDRFLLSYdnpgATastaFsGWLDDLKIEA 422 444499****7733458999988865433113332135555666664 PP == domain 3 score: 37.5 bits; conditional E-value: 1.5e-13 CBM32.hmm 13 aaggggaenavDgdpntrWssag..qwltvdLgkp.ttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.tet 91 +g ++ +n+vD+++ + s a+ ++tv +++p ++ + ++lt + + + ++ +++e+S+DgktW +v++++n++ ++ +t BFZ72207.1|CBM32|GH92 1204 RDG-ENTANLVDNNAASQVSFASktPQITVAYQGPaQSPTFYTLTS-GtsTaTAPTGWTLEGSNDGKTWSVVDTRQNQKFDSaLQT 1287 345.789*******9985554422356******9945555556663.2344699*******************9988775333347 PP CBM32.hmm 92 itfd..kpvtaryvRltvtkr 110 ++f+ +p + +Rl+vt+ BFZ72207.1|CBM32|GH92 1288 RPFKiaQPGSFAQFRLNVTSG 1308 78888799999999*999662 PP == domain 4 score: -1.7 bits; conditional E-value: 0.21 CBM32.hmm 52 vltw.aengrikdykvevStDgktWttvaekgnttd.gt.te..titfdkpvtaryvRltv 107 +++w ++ ++i+d+++ + tDg+ t+ ++ ++t+ gt ++ t+ ++ ++ +Rl + BFZ72207.1|CBM32|GH92 1664 RVQWgDG-SDIQDVELGALTDGSA--TITAEHTFTEpGTyPVvvTVYGTSG--TQQLRLSA 1719 4555433.7899999999999976..4544446666566522113322222..36666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1981 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 146.12 // Query: XNN02911.1|CBM0|CBM32|GH92 [L=1285] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-27 82.0 12.4 2.2e-21 62.8 2.3 3.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.8 2.3 2.2e-21 2.2e-21 7 122 .. 101 222 .. 95 224 .. 0.75 2 ! 3.1 0.2 0.0069 0.0069 8 41 .. 724 760 .. 717 795 .. 0.71 3 ! 20.8 0.2 2.3e-08 2.3e-08 22 107 .. 1185 1272 .. 1177 1282 .. 0.69 Alignments for each domain: == domain 1 score: 62.8 bits; conditional E-value: 2.2e-21 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a s+++a+gg+ en+vDg +++W + + wl++dL +p + ++ lt a+ + +++kd+++ +S +g++Wtt+++++++ XNN02911.1|CBM0|CBM32|GH92 101 A-SAENADGGEIKENLVDGEVTSKWLAFDttAWLEFDLSEPVEAVRYALTSANdaPgRDPKDWTLKGSANGSDWTTLDTRKDE 182 3.3455667799*******999*****74478*********8888888886334557*********************99877 PP CBM32.hmm 85 td.gtte..titfdkpvta.ryvRltvtkratnawgasiaEl 122 t + ++ +++fd+ ta +++Rl++t +a ++ +++aE+ XNN02911.1|CBM0|CBM32|GH92 183 TFsSRQQtrEFSFDN-STAfKHFRLEITRNAGDDI-VQLAEV 222 653443312556664.5566*******77554344.888887 PP == domain 2 score: 3.1 bits; conditional E-value: 0.0069 CBM32.hmm 8 essssaaggggaenavDgd...pntrWssag.qwltvd 41 + + +++++++ +++vDg +n +W ++ +w + XNN02911.1|CBM0|CBM32|GH92 724 A-TGENTPTHTGAKIVDGEvyvNNGFWDTYRtTWPAYS 760 3.4455566*********85534569999644454444 PP == domain 3 score: 20.8 bits; conditional E-value: 2.3e-08 CBM32.hmm 22 avDgdpntrWssagqwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd.. 95 ++D+ +t + + vdL + ++v++t ++ + ++ + +++S Dg++W++++ +++++ + ++t+ f+ XNN02911.1|CBM0|CBM32|GH92 1185 LLDNTSGTEAAFE----SVDLPVTEPGRAVQYTLtSSeRgKAPTGWVLQGSPDGEKWRDLDRRSGES-WSwdKQTRVFTvr 1260 5566444543333....699999999999****974344699******************9865432.1133344455544 PP CBM32.hmm 96 kpvtaryvRltv 107 +p t ++Rl+ XNN02911.1|CBM0|CBM32|GH92 1261 TPGTYEHYRLVP 1272 888889999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1285 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 150.02 // Query: WZO46720.1|CBM32|GH92 [L=2007] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-29 87.8 25.4 8e-21 61.0 2.5 6.1 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.0 2.5 8e-21 8e-21 5 111 .. 83 196 .. 79 213 .. 0.73 2 ! 2.6 0.2 0.0098 0.0098 23 64 .. 306 373 .. 292 390 .. 0.62 3 ! 2.8 0.1 0.0081 0.0081 6 34 .. 712 742 .. 707 761 .. 0.71 4 ! 31.9 1.0 8.2e-12 8.2e-12 14 122 .. 1170 1281 .. 1163 1283 .. 0.69 5 ? 1.6 0.3 0.02 0.02 13 68 .. 1296 1355 .. 1284 1392 .. 0.60 Alignments for each domain: == domain 1 score: 61.0 bits; conditional E-value: 8e-21 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd. 86 +a s++++++++a+++ Dg+ +++W + + w+++ L +p+ +++++lt + + +++kd++v++St+g++W+tv+e++++ WZO46720.1|CBM32|GH92 83 VTA--SAQNTPNEAAAFVADGNSSSKWLAFTntAWVQYQLAAPQPMTSYTLTSgNDePdRDPKDFRVQGSTNGTDWVTVDERSGELFs 168 333..44455669****************75579******************7532557********************998765544 PP CBM32.hmm 87 gt.tetitfd..kpvt.aryvRltvtkra 111 g + t+tf+ +p t y+Rl v +++ WZO46720.1|CBM32|GH92 169 GRgE-TRTFTlaTPSTeYLYYRLDVLATK 196 5442.444444455443799999994433 PP == domain 2 score: 2.6 bits; conditional E-value: 0.0098 CBM32.hmm 23 vDgdpntrWss..............ag.........qw..ltvdLg..kpttvdkvvltw.aen.grikdy 64 +D+ +tr s+ ++ qw +tvdLg + +tvd +v+ + + + +++k + WZO46720.1|CBM32|GH92 306 FDD--GTRLSTsgavdsygyganarQQgqanvlwpnQWnkVTVDLGqfAGRTVDDIVFSYdH-PgTDVKGV 373 555..55555544444443333333003334444565666******65569*****999642.22455554 PP == domain 3 score: 2.8 bits; conditional E-value: 0.0081 CBM32.hmm 6 saessssaaggggaenavDgd...pntrWssa 34 sa++++++++ ++ +++vDg+ +n +W ++ WZO46720.1|CBM32|GH92 712 SATTGAASDT-HTNAKIVDGKiyvNNGFWDTY 742 6665666666.9********954334599985 PP == domain 4 score: 31.9 bits; conditional E-value: 8.2e-12 CBM32.hmm 14 aggggaenavDgdpn.t.rWssag.qwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tet 91 +g + +vD++ n t ++ + +l+ + +p ++ +++lt + + ++++++++S Dg+tWt++++++++t t +t WZO46720.1|CBM32|GH92 1170 DG-TPVGSLVDDNMNsTvTFAG-DtAELVWTSQsGPVSIGQYTLTS-AaKgSAPSSWTLSGSIDGTTWTELDSREGET-FTwdSQT 1251 34.7889999999984332222.1334666666599*********5.234599******************9987654.3332358 PP CBM32.hmm 92 itfdkpvta..ryvRltvtkratnawgasiaEl 122 ++f+++ t+ + v+lt+ +t+ ++ s++E+ WZO46720.1|CBM32|GH92 1252 RPFTAKGTGgyTSVKLTA---KTGGPALSLSEV 1281 899955555136666666...355677999887 PP == domain 5 score: 1.6 bits; conditional E-value: 0.02 CBM32.hmm 13 aaggggaenavDgd....pntrWssag....qwltvdLgkpttvdkvvltwaengrikdykvev 68 aag + avD t +++ ++tvd+g +v+ v lt + + +kv++ WZO46720.1|CBM32|GH92 1296 AAG-APQRVAVDTEftgsLATVVGTETdasgYDVTVDYGDGVEVTDVALT--R-DALGGWKVSA 1355 444.66666777642111223222221334557****************9..4.4455555553 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (2007 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 173.43 // Query: XGR15524.1|CBM32|GH92 [L=1925] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-25 74.6 17.6 1.6e-20 60.0 6.9 5.2 7 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.0 6.9 1.6e-20 1.6e-20 8 115 .. 88 203 .. 82 215 .. 0.81 2 ? -1.5 0.1 0.18 0.18 20 55 .. 314 362 .. 306 381 .. 0.58 3 ? 0.0 0.1 0.059 0.059 9 34 .. 703 730 .. 695 746 .. 0.71 4 ? -4.1 0.2 1 1 26 46 .. 914 936 .. 902 943 .. 0.54 5 ! 30.3 2.9 2.5e-11 2.5e-11 10 122 .. 1153 1270 .. 1144 1272 .. 0.69 6 ? -3.8 0.1 0.9 0.9 88 111 .. 1446 1471 .. 1431 1481 .. 0.55 7 ? -2.9 0.2 0.48 0.48 58 73 .. 1647 1664 .. 1601 1690 .. 0.55 Alignments for each domain: == domain 1 score: 60.0 bits; conditional E-value: 1.6e-20 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gt. 88 ++s+++a+g++a +++D++ nt+W ++ w+++ + kpt v+ + lt + +++kd+++e+S+Dg+ W +v++++++t + XGR15524.1|CBM32|GH92 88 TASAENAPGETAVKLTDNNSNTKWLAKAatGWVVYTFAKPTLVTDYALTSgNDsAgRDPKDFTIEGSNDGTVWSPVDAQTGQTFsNRq 175 345567777*****************84467******************7522446********************999988776665 PP CBM32.hmm 89 .tetitfdkpvtaryvRltvtkratnaw 115 t++ +++pvt +R+tvt+++ +a+ XGR15524.1|CBM32|GH92 176 aTNEYHLATPVTFSQYRFTVTQNSGDAY 203 3336677799**********88765444 PP == domain 2 score: -1.5 bits; conditional E-value: 0.18 CBM32.hmm 20 enavDgdpn..t.rWssag......qw..ltvdLgkp..ttvdkvvltw 55 +n++D + t r + ++ +w +++dL + +tv+kv l + XGR15524.1|CBM32|GH92 314 QNLTDANGFgvTaRAHGEQkslfenEWnnIQIDLSSLagRTVQKVLLSY 362 56666642122324444212344443334*****954348999988775 PP == domain 3 score: 0.0 bits; conditional E-value: 0.059 CBM32.hmm 9 ssssaaggggaenavDgd...pntrWssa 34 ++s++++ + +++vDg+ +n +W ++ XGR15524.1|CBM32|GH92 703 TGSATDT-ATNAKVVDGKiyvNNGFWDTY 730 4555555.899******954334599885 PP == domain 4 score: -4.1 bits; conditional E-value: 1 CBM32.hmm 26 dpntrWssag..qwltvdLgkpt 46 dp+t+W ++ + + + +p XGR15524.1|CBM32|GH92 914 DPKTWWGPYTetNAWNFAFHAPF 936 24688887533434555555555 PP == domain 5 score: 30.3 bits; conditional E-value: 2.5e-11 CBM32.hmm 10 sssaaggggaenavDgdpn...trWssagqwltvdLg.kpttvdkvvltw.aen.grikdykvevStDgktWttvaekgnttdgt. 88 ++ ++g +++ +++D++ + t+ ++ + + +v++++lt a + ++ + +e+S Dg++W ++++++++t t XGR15524.1|CBM32|GH92 1153 TTVSDG-SQIGALTDDNSRnvaTFATAT-PAISWTSSsGSVSVNSYTLTSpA-TgAVPTAWHLEGSADGTSWMPLDTRTDQT-FTw 1234 445555.678888888655232332222.2233333326679*******542.4599********************99876.444 PP CBM32.hmm 89 .tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 t+t++f+ p + +++Rlt+ +++t+ ++as+aEl XGR15524.1|CBM32|GH92 1235 aTQTRPFElaHPGSFTHYRLTIDATTTG-TPASLAEL 1270 455778888799999*******554454.559***98 PP == domain 6 score: -3.8 bits; conditional E-value: 0.9 CBM32.hmm 88 t.t.etitfdkpvtaryvRltvtkra 111 t + +ti+fd+ a+++ + +t+++ XGR15524.1|CBM32|GH92 1446 TgNgQTIRFDAGQGATKLSVIGTATQ 1471 23213778884334677777775544 PP == domain 7 score: -2.9 bits; conditional E-value: 0.48 CBM32.hmm 58 n.grikdykvevS.tDgk 73 + ++ d++v+v +Dg XGR15524.1|CBM32|GH92 1647 TyATAGDFTVSVTvDDGL 1664 234556777777733442 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1925 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 165.93 // Query: UOZ04309.1|CBM32|GH92 [L=1436] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-34 105.7 21.3 4.5e-23 68.3 4.8 3.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.3 4.8 4.5e-23 4.5e-23 3 122 .. 87 213 .. 85 215 .. 0.76 2 ? 1.3 0.3 0.024 0.024 11 37 .. 715 744 .. 705 777 .. 0.66 3 ! 44.4 3.1 1.1e-15 1.1e-15 12 123 .. 1178 1291 .. 1173 1292 .. 0.78 Alignments for each domain: == domain 1 score: 68.3 bits; conditional E-value: 4.5e-23 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgntt 85 t++sa ss++++gg+ +n+vDg +t+W s++ w +v+L ++t+v+++ +t a+ +++kd+++++S+D +tWt++++++++t UOZ04309.1|CBM32|GH92 87 TETSA-SSENTDGGEVVANLVDGTSDTKWLSWDptAWAQVNLSEATSVTHYAITSANdhDeRDPKDWTLQGSDDAQTWTDLDKQAGQT 173 45555.566777779********999*****96689******************7334546********************9888877 PP CBM32.hmm 86 dgt...tetitfd.kpvtaryvRltvtkratnawgasiaEl 122 g +++ +++ ++ +++Rl+vt+++ ++ ++aEl UOZ04309.1|CBM32|GH92 174 FGArfqQKDYKLAaPSAPYKFFRLNVTANNGGDI-LQAAEL 213 6545743355666533456*******66443333.666665 PP == domain 2 score: 1.3 bits; conditional E-value: 0.024 CBM32.hmm 11 ssaaggggaenavDgdp..nt.rWssag.qw 37 ++a+ ++ +++vDg++ n+ +W ++ +w UOZ04309.1|CBM32|GH92 715 PDTAT-QTGSKVVDGQTyvNNgFWDTYRtTW 744 44455.899******6422223788853334 PP == domain 3 score: 44.4 bits; conditional E-value: 1.1e-15 CBM32.hmm 12 saaggggaenavDgdpntrWssag.qwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tet 91 +++g ++a +++D+ +r ++a +l++ Lg++ v++++lt + + g++k++++ +S DgktW ++++++n++ ++t UOZ04309.1|CBM32|GH92 1178 TSDG-SDAGALLDNT--SRTQAAVtGTLQYQLGSTdEAVSHYTLTS-QtGaGDPKSWTLKGSYDGKTWAVADQQTNQSF-AwrQQT 1258 3445.8899*****4..4555542236******7769********4.3446******************8888888764.344456 PP CBM32.hmm 92 itfd..kpvtaryvRltvtkratnawgasiaEla 123 + f+ +p+ y++l+vt+++t+a+ a++aE++ UOZ04309.1|CBM32|GH92 1259 RAFKvaNPAHYAYYKLEVTATSTGAP-AQLAEFE 1291 68887799999*******88888766.9****95 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1436 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 173.56 // Query: WAP58824.1|CBM32|GH92 [L=1285] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-28 84.1 13.4 2.3e-21 62.7 2.1 3.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.7 2.1 2.3e-21 2.3e-21 7 122 .. 101 222 .. 95 224 .. 0.74 2 ? 0.8 0.2 0.035 0.035 8 41 .. 724 760 .. 717 792 .. 0.70 3 ! 26.2 0.4 4.6e-10 4.6e-10 39 109 .. 1198 1274 .. 1177 1283 .. 0.72 Alignments for each domain: == domain 1 score: 62.7 bits; conditional E-value: 2.3e-21 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt 88 a s++++agg+ en+vDg +t+W + + wl++dL +p + ++ lt a+ + +++kd+++ +S +g++Wtt+++++++t + WAP58824.1|CBM32|GH92 101 A-SGENTAGGEIKENLVDGEVTTKWLAVDttAWLEFDLSEPVEAIRYALTSANdaPgRDPKDWTLKGSANGSDWTTLDTRKDETFsSR 187 3.5777888899***************53368*********7777777775335557*********************9987765344 PP CBM32.hmm 89 te..titfdkpvta.ryvRltvtkratnawgasiaEl 122 ++ ++tfd+ ta +++Rl+++ + +++ ++aE+ WAP58824.1|CBM32|GH92 188 QQtrEFTFDN-GTAyQHFRLEISRN-AGDDLIQLAEV 222 3323557774.5566*******443.33333777776 PP == domain 2 score: 0.8 bits; conditional E-value: 0.035 CBM32.hmm 8 essssaaggggaenavDgd...pntrWssag.qwltvd 41 + + +++++++ +++ Dg+ +n +W ++ +w + WAP58824.1|CBM32|GH92 724 A-TGENTPTHTGAKIADGKvyvNNGFWDTYRtTWPAYS 760 3.44555669********85534469999644454444 PP == domain 3 score: 26.2 bits; conditional E-value: 4.6e-10 CBM32.hmm 39 tvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..kpvtaryvRltvtk 109 vdL + ++v++t ++ + ++ + +++S Dgk+W++++ +++++ t ++t+ f+ +p t ++Rl++ + WAP58824.1|CBM32|GH92 1198 SVDLPVTEAGRAVQYTLtSSdRgKAPTGWVLQGSRDGKDWKDLDRRSDES-FTwdKQTRVFSvrTPGTYEHYRLVADG 1274 699999999999*999974344699******************9887755.444444556665599999*****9933 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1285 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 163.68 // Query: WSE32961.1|CBM0|CBM32|GH92 [L=1435] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-33 99.6 19.8 3e-22 65.6 2.6 3.9 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.6 2.6 3e-22 3e-22 3 112 .. 86 203 .. 84 214 .. 0.76 2 ? 1.6 0.2 0.019 0.019 7 37 .. 712 745 .. 706 781 .. 0.68 3 ? -3.2 0.0 0.62 0.62 59 78 .. 1100 1120 .. 1092 1137 .. 0.70 4 ! 41.9 2.0 6.5e-15 6.5e-15 12 122 .. 1178 1289 .. 1171 1291 .. 0.76 Alignments for each domain: == domain 1 score: 65.6 bits; conditional E-value: 3e-22 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvae 80 t++sa ss++++gg+ +n+vDg ++t+W s++ w +v+L +p +++++ + a+ ++++d+++++S+D +Wt++++ WSE32961.1|CBM0|CBM32|GH92 86 TETSA-SSENTDGGEISANLVDGTTDTKWLSWDptAWAQVNLSEPVSITHYAISSANdfAgRDPQDWTLQGSNDARQWTDLDK 167 45555.5666777799***************96689******************7334546********************98 PP CBM32.hmm 81 kgnttdgt...te.titfdkpvta.ryvRltvtkrat 112 +++++ + +e + ++++p a r++Rl vt ++ WSE32961.1|CBM0|CBM32|GH92 168 QSGQSF-DarfQEhQYRLATPSAAyRFYRLDVTRNHG 203 777654.234744455666555556*******66433 PP == domain 2 score: 1.6 bits; conditional E-value: 0.019 CBM32.hmm 7 aessssaaggggaenavDgd...pntrWssag.qw 37 a++++++a+ ++ +++vDg+ +n +W ++ +w WSE32961.1|CBM0|CBM32|GH92 712 AKAGADTAT-QTGSKIVDGQvyvNNGFWDTYRtTW 745 444555556.899******8553446999963334 PP == domain 3 score: -3.2 bits; conditional E-value: 0.62 CBM32.hmm 59 grikdykvevS.tDgktWttv 78 + +k++ v++ +gk Wt WSE32961.1|CBM0|CBM32|GH92 1100 NSAKNVYVQGLkVNGKAWTST 1120 557888888876799999864 PP == domain 4 score: 41.9 bits; conditional E-value: 6.5e-15 CBM32.hmm 12 saaggggaenavDgdpntrWssagqwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt. 88 +++g ++a++++D++ +t + +g +t+ L+++ v++++lt + g++k++++e+S DgktW ++++++++t + WSE32961.1|CBM0|CBM32|GH92 1178 TSDG-SNATALLDNSSRTEAKVTG-AVTYQLNSTdEAVTHYTLTS-PkGaGDPKSWQLEGSYDGKTWAVADKQTSQTFPWr 1255 3445.789******5555433333.6******7769********4.34469*****************8888877665333 PP CBM32.hmm 89 tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 ++t+ f+ +p+ y+Rltvt+++ +++ s+aE+ WSE32961.1|CBM0|CBM32|GH92 1256 QQTRAFAvaNPAHYAYYRLTVTDSSGGQP--SLAEF 1289 45778887799999*******88665555..78888 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1435 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 163.60 // Query: XKG27191.1|CBM0|CBM32|GH92 [L=1680] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-28 84.5 14.8 8.4e-21 60.9 1.4 4.3 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.9 1.4 8.4e-21 8.4e-21 8 112 .. 80 192 .. 75 209 .. 0.77 2 ? -0.4 0.0 0.082 0.082 36 79 .. 333 396 .. 299 422 .. 0.59 3 ? -2.3 0.0 0.32 0.32 18 45 .. 586 617 .. 580 667 .. 0.66 4 ! 29.8 0.6 3.6e-11 3.6e-11 6 109 .. 1164 1273 .. 1159 1308 .. 0.71 5 ? -3.1 0.0 0.56 0.56 50 78 .. 1332 1366 .. 1325 1379 .. 0.64 Alignments for each domain: == domain 1 score: 60.9 bits; conditional E-value: 8.4e-21 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgntt 85 ++++++a++++a+ + D +p+t+W + + w+ ++L kp tv k+++t a+ + +++kd+++++S Dg+tWt+++ +++ + XKG27191.1|CBM0|CBM32|GH92 80 TAGAENAPNEAASSLADANPDTKWLAFEpsGWVRYELAKPATVVKWSMTSANdsPeRDPKDVTLQGSADGTTWTDLDRETGLD 162 456778888*****************74567******************7334547********************8755443 PP CBM32.hmm 86 dgt..te.titfdkpvtaryvRltvtkrat 112 ++ + ++++d+p++ r++Rl vt++++ XKG27191.1|CBM0|CBM32|GH92 163 FPQrfATlDFEVDAPAEYRFYRLDVTANHS 192 344232334455599999*******77443 PP == domain 2 score: -0.4 bits; conditional E-value: 0.082 CBM32.hmm 36 qw..ltvdLgkp...ttvdkvvltw....ae...n..grikdykve...vStDg...ktWttva 79 qw +tv+Lg++ +tvd++ l + a + g d+++e + Dg +++++v XKG27191.1|CBM0|CBM32|GH92 333 QWnaVTVELGRVaagRTVDAILLGYdnptAAadtRfgGWLDDVSIEekpAVVDGrdlTNFVDVR 396 44449*****773346888888886543311233123444455555444333442224555554 PP == domain 3 score: -2.3 bits; conditional E-value: 0.32 CBM32.hmm 18 gaenavDgdpntrWssa.g...qwltvdLgkp 45 ga a Dg ++tr+++ + +t+ L + XKG27191.1|CBM0|CBM32|GH92 586 GAGTAPDGHDGTRYATFdTstdRAVTLRLATS 617 56667778777888774213344566666544 PP == domain 4 score: 29.8 bits; conditional E-value: 3.6e-11 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssa..g..qwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttva 79 sa+++ a+g ++a++++D+ ++r +++ + ++ + L +p ++ + ++lt ++ + g+++ +++e+S+Dgk+W+t++ XKG27191.1|CBM0|CBM32|GH92 1164 SATATGLADG-SSAKALFDD--TSRTAATftTrrLTVSYTLSGPgQRATWYTLT-SGpEkGDPTAWRLEGSKDGKHWKTLD 1240 4555555556.99*******..44555532224556999***996777777777.43546********************9 PP CBM32.hmm 80 ekgnttdgt.tetitfd..kpvtaryvRltvtk 109 +++++ + +t++f+ p +Rl+vt+ XKG27191.1|CBM0|CBM32|GH92 1241 RRSGESFPWrVQTRPFEirHPGAYASYRLVVTA 1273 876644333334668887766656889999954 PP == domain 5 score: -3.1 bits; conditional E-value: 0.56 CBM32.hmm 50 kvvltw.ae..n.grikdykvevSt.Dg.ktWttv 78 +v+++w ++ + gr+k ++ +St g +tWt+ XKG27191.1|CBM0|CBM32|GH92 1332 TVTVDWgDGtsSpGRVKVGDLGTSTvSGsHTWTEP 1366 67888873334357777777777742332689886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1680 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 65.53 // Query: XUA05052.1|CBM32|GH92 [L=1871] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-28 86.3 23.3 4.3e-21 61.9 2.8 5.5 6 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.9 2.8 4.3e-21 4.3e-21 5 112 .. 91 206 .. 88 221 .. 0.79 2 ? -1.0 0.0 0.12 0.12 36 73 .. 347 389 .. 313 436 .. 0.60 3 ? 0.4 0.1 0.046 0.046 6 34 .. 702 732 .. 697 748 .. 0.70 4 ! 33.9 1.3 1.9e-12 1.9e-12 12 122 .. 1164 1280 .. 1160 1282 .. 0.69 5 ? -1.8 0.2 0.22 0.22 43 85 .. 1697 1740 .. 1655 1774 .. 0.66 6 ? -2.1 0.0 0.27 0.27 22 66 .. 1801 1839 .. 1791 1858 .. 0.71 Alignments for each domain: == domain 1 score: 61.9 bits; conditional E-value: 4.3e-21 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd. 86 s+ ++s+++++ + a+n+ D+dp+t+W w+t+ L kp tv +++lt + + +++kd+ +++S+Dg+tWt+++++++++ XUA05052.1|CBM32|GH92 91 SAVTASDENPPREIAANLRDDDPSTKWLVFAstGWVTYQLAKPATVARYTLTAaDDaPtRDPKDFVIQGSNDGSTWTDLDKRAGEKFs 178 45566788899999*************9963367******************7522546********************998876655 PP CBM32.hmm 87 gt..tetitfdkpvtaryvRltvtkrat 112 g t+t +f++p ++Rl+vt+++ XUA05052.1|CBM32|GH92 179 GRfaTKTYSFTNPNAYGFYRLNVTANSG 206 6575457799977445*******76442 PP == domain 2 score: -1.0 bits; conditional E-value: 0.12 CBM32.hmm 36 qw..ltvdLgkpt...tvdkvvltw.aengrikdykvevStDgk 73 qw ++ dLg++ t+d++ l + + + + + +++++ D+ XUA05052.1|CBM32|GH92 347 QWnlVQADLGTVArgkTIDRILLAYdNP-QATGETRFQGWLDDV 389 6666899999874344888888885422.555555555444432 PP == domain 3 score: 0.4 bits; conditional E-value: 0.046 CBM32.hmm 6 saessssaaggggaenavDgd...pntrWssa 34 sa +++s+++ ++ +++vDg+ +n +W ++ XUA05052.1|CBM32|GH92 702 SAPTGASTPT-QTGAKVVDGQiyvNNGFWDTY 732 5554555555.99*******844334599885 PP == domain 4 score: 33.9 bits; conditional E-value: 1.9e-12 CBM32.hmm 12 saaggggaenavDgdpnt...rWssagqwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt.te 90 sa+gg++a++++D++ +t + s++ ++t + + ++ + +++t + g++ d+++++S+Dg tWttv++++++ + ++ XUA05052.1|CBM32|GH92 1164 SATGGQDASKLFDDSSTTqltFTSAT-PQITWAFRgGKQKPKYYTVTS-GaAaGDPADWRLQGSNDGLTWTTVDSRAGQVFPWrNQ 1247 3445599*******988733133333.459999985779999999995.33459********************988755433444 PP CBM32.hmm 91 titfd..kpvtaryvRltvtkratnawgasiaEl 122 t++++ kp + +Rl vtk+ +a +++aE+ XUA05052.1|CBM32|GH92 1248 TRPYSidKPGRFAQFRLAVTKTV-GAAQTNLAEV 1280 55555448887777888886643.3334666665 PP == domain 5 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 43 gkpttvdkvvltwae.n.grikdykvevStD.gktWttvaekgntt 85 g++tt d++++ + + +++v+v tD g t +++a+ ++t XUA05052.1|CBM32|GH92 1697 GTVTTGDAITVA--GsGfAAGEQVTVSVGTDpGRTMKVAASATGTV 1740 455666677777..32346678888888888788877665544322 PP == domain 6 score: -2.1 bits; conditional E-value: 0.27 CBM32.hmm 22 avDgdpntrWssagqwltvdLgkpttvdkvvltwaen.grikdykv 66 +vDg + ++ + + +t+ +g++ v++v+ + + g i+ +v XUA05052.1|CBM32|GH92 1801 MVDG---SGFAPN-EVVTIAFGTELAVSTVRAN---GdGVISGATV 1839 6777...555555.459************9999...2255555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1871 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 140.82 // Query: XQA91725.1|CBM0|CBM32|GH92 [L=1282] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-29 87.0 14.6 5.2e-22 64.8 3.9 3.8 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.8 3.9 5.2e-22 5.2e-22 7 120 .. 100 220 .. 94 225 .. 0.77 2 ? -2.8 0.1 0.46 0.46 16 37 .. 725 750 .. 716 809 .. 0.66 3 ? -1.8 0.0 0.21 0.21 59 78 .. 1105 1125 .. 1085 1141 .. 0.74 4 ! 27.6 0.1 1.8e-10 1.8e-10 39 119 .. 1193 1275 .. 1168 1280 .. 0.70 Alignments for each domain: == domain 1 score: 64.8 bits; conditional E-value: 5.2e-22 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a s++++++g+ a+n++Dg +t+W + + w+++dL+++ ++++++lt a+ +++kd+ + +S Dgk+Wtt+++++++ XQA91725.1|CBM0|CBM32|GH92 100 A-SGENSGSGEVAANLTDGESSTKWLAFTptAWVEYDLDTALKITNYNLTSANdhDeRDPKDWVLKGSADGKDWTTLDSRTGE 181 3.4556667799***************86679******************7334546*********************99876 PP CBM32.hmm 85 tdgt..te.titfdkpvtaryvRltvtkra.tnawgasia 120 + ++ ++ + +++kp++ ++R+++tk++ ++ ++++a XQA91725.1|CBM0|CBM32|GH92 182 SFDKryQTkKYELEKPAEYAHFRVEFTKNNgAG-DATQLA 220 543345342448889999********8865333.235555 PP == domain 2 score: -2.8 bits; conditional E-value: 0.46 CBM32.hmm 16 gggaenavDgdp...ntrWssag.qw 37 +++ +++v g+p n +W ++ +w XQA91725.1|CBM0|CBM32|GH92 725 THTGAKIVEGKPyvnNGFWDTYRtTW 750 46777777776422134676642223 PP == domain 3 score: -1.8 bits; conditional E-value: 0.21 CBM32.hmm 59 grikdykvevS.tDgktWttv 78 + +k++ v++ +gktW + XQA91725.1|CBM0|CBM32|GH92 1105 NSAKNIYVQGVkVNGKTWSKT 1125 567888888765899999865 PP == domain 4 score: 27.6 bits; conditional E-value: 1.8e-10 CBM32.hmm 39 tvdLg.kpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd..kpvtaryvRltvtkrat 112 vdL ++ ++v++t + ++ +k+e+S Dg++W+t++e+++++ +++t+ f+ +p + ++Rl++t+ a XQA91725.1|CBM0|CBM32|GH92 1193 SVDLPvAADGTKAVQYTLtSDdHaKAPTGWKLEASADGSSWKTIDERSGESFaWDKQTRAFSvpNPGSYAHYRLVFTGGA- 1272 57777555667888888863333599******************9987655433344556665599999*******6533. PP CBM32.hmm 113 nawgasi 119 a + XQA91725.1|CBM0|CBM32|GH92 1273 ----ATV 1275 ....334 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1282 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 131.25 // Query: BFF16778.1|CBM32|GH92 [L=1075] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-12 32.8 3.3 1e-11 31.6 0.8 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.0 0.1 0.062 0.062 6 34 .. 367 397 .. 362 419 .. 0.70 2 ! 31.6 0.8 1e-11 1e-11 14 122 .. 835 950 .. 825 952 .. 0.72 Alignments for each domain: == domain 1 score: -0.0 bits; conditional E-value: 0.062 CBM32.hmm 6 saessssaaggggaenavDgd...pntrWssa 34 sa s++++++ ++ + +vDg+ +n +W ++ BFF16778.1|CBM32|GH92 367 SAPSGEATDT-ETNAEVVDGKiyvNNGFWDTY 397 5555556666.89999****854334599885 PP == domain 2 score: 31.6 bits; conditional E-value: 1e-11 CBM32.hmm 14 aggggaenavDgdpntrWssag..qwltvdLg.kpttvdkvvltw.aen.grikdykvevStDgktWttvaekgnttdgt...tetit 93 +g +a+++vD+ ++r a+ ++t d ++ v +++lt ae+ +++ +++e+S Dg+ Wt+++e++ ++ + t+ BFF16778.1|CBM32|GH92 835 DG-TDAAALVDDTSDSRATFATgtPTVTWDGSgAAAAVGTYTLTSgAEGtATPSAWRLEGSHDGERWTVLDERTRQQ-FRwalQ-TRA 919 45.78999***9877764333224569999874779********65334699*******************998654.334443.344 PP CBM32.hmm 94 fd...kpvtaryvRltvtkratnawgasiaEl 122 f+ +p + ++Rl+vt++a + s+aEl BFF16778.1|CBM32|GH92 920 FQvddDPEPYEHLRLVVTATAG-DGDLSLAEL 950 4444866678*******77653.333899997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1075 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 152.26 // Query: XQJ09215.1|CBM32|GH92 [L=1970] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-25 76.5 22.1 3.5e-18 52.5 6.4 3.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 52.5 6.4 3.5e-18 3.5e-18 8 112 .. 95 208 .. 90 223 .. 0.73 2 ! 32.7 1.7 4.7e-12 4.7e-12 7 122 .. 1184 1304 .. 1178 1307 .. 0.65 3 ? -0.7 0.5 0.1 0.1 36 89 .. 1648 1711 .. 1625 1756 .. 0.60 Alignments for each domain: == domain 1 score: 52.5 bits; conditional E-value: 3.5e-18 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt. 88 ++ +++++++ a+n+ Dg+++++W + + +t+ L+++ t+ k++lt a+ + +++k ++v++S+Dg+tWttv++++++ g XQJ09215.1|CBM32|GH92 95 TADAENPPNEVAANLADGSASSKWLAFQktGVITYRLDQAETLAKYSLTSANdsPgRDPKAWTVSGSNDGTTWTTVDTQSGQAFsGRg 182 34566788899***************633446*****************7334547********************998776655553 PP CBM32.hmm 89 tetitfd..kpvtaryvRltvtkra.t 112 t t +++ +p + +Rlt+++++ XQJ09215.1|CBM32|GH92 183 T-TNDYSaaTPGSYSQYRLTISQNSgD 208 2.33555446777899*****665432 PP == domain 2 score: 32.7 bits; conditional E-value: 4.7e-12 CBM32.hmm 7 aessssaaggggaenavDgd..pntrWssagqwltvdLg.kpttvdkvvltw.aen.grikdykvevStDgktWttvaekg..ntt 85 + +++s++g + +++D+ + t + sa+ +t + +p tvd+++lt a + +r++++k+e+S+Dg+tW+++ ++ + XQJ09215.1|CBM32|GH92 1184 YGETTSDDG-TAVGALTDDEslTATTFGSATPAITWKSAqGPVTVDQYTLTTaA-SgTRPTSWKLEGSSDGTTWVPLSTVPraG-- 1265 444555556.67777777753322433333234777766599*********642.349*******************8753112.. PP CBM32.hmm 86 dgt..tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 t +t++f+ p+ ++Rltvt++ t+ s+ E+ XQJ09215.1|CBM32|GH92 1266 -FTaaLQTRPFTvaHPAALSWYRLTVTGTDTGRA-PSLGEF 1304 .223324668886666656*******88666543.566666 PP == domain 3 score: -0.7 bits; conditional E-value: 0.1 CBM32.hmm 36 qwltvdLgkpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekg.nttdgt.......t 89 ++ tv+ g t + + ++t a+ + + ++y+ vS g+ +tv++ + + t+ + + XQJ09215.1|CBM32|GH92 1648 TTATVNWGDGTPLEAATVTVaAGtaTvTGKHTYTAAVS--GTATVTVDDGTgSATVRDrvriaaaP 1711 45788888888888888887533344566677777777..55556676654232222234443331 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1970 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 184.05 // Query: UQT55673.1|CBM0|CBM32|GH92 [L=1291] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-30 90.4 14.8 1e-21 63.8 2.2 4.1 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.8 2.2 1e-21 1e-21 7 112 .. 99 211 .. 93 223 .. 0.74 2 ! 2.9 0.2 0.0077 0.0077 13 47 .. 727 765 .. 717 810 .. 0.75 3 ? -2.6 0.0 0.4 0.4 59 78 .. 1114 1134 .. 1095 1146 .. 0.76 4 ! 30.1 0.3 2.9e-11 2.9e-11 21 107 .. 1188 1278 .. 1174 1288 .. 0.75 Alignments for each domain: == domain 1 score: 63.8 bits; conditional E-value: 1e-21 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a s ++a+gg+ en+vDg p+++W s + w ++dL++p +v ++ lt a+ +++kd+++++StDgk+W+++++++++ UQT55673.1|CBM0|CBM32|GH92 99 A-SDENAGGGEVKENLVDGEPTSKWLSFEptGWAEFDLDEPAKVVTYALTSANdhDeRDPKDWTLQGSTDGKDWKVLDTRKGE 180 3.3455667788***************74467******************7334546********************998765 PP CBM32.hmm 85 tdgt.te..titfdkpvtaryvRltvtkrat 112 ++ ++ + +f++++ ++Rl +t+++ UQT55673.1|CBM0|CBM32|GH92 181 AFDKrHQtkKYDFQNDTAYAHFRLDITANNG 211 5433444223366666555*******66442 PP == domain 2 score: 2.9 bits; conditional E-value: 0.0077 CBM32.hmm 13 aaggggaenavDgdp...ntrWssag.qwltvdLgkptt 47 ++++++ +++vDg+p n +W ++ +w + L +p++ UQT55673.1|CBM0|CBM32|GH92 727 DTPTHTGAKIVDGKPyvnNGFWDTYRtTWPAYSLLTPKK 765 445599*******96331459999744576666665555 PP == domain 3 score: -2.6 bits; conditional E-value: 0.4 CBM32.hmm 59 grikdykvevS.tDgktWttv 78 + +k++ v++ +gk+Wt UQT55673.1|CBM0|CBM32|GH92 1114 NSAKNVYVQGLkVNGKKWTST 1134 567888888876899999965 PP == domain 4 score: 30.1 bits; conditional E-value: 2.9e-11 CBM32.hmm 21 navDgdpntrWssagqwltvdLgkpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekgnttdgt...teti.t 93 +++D+ t s+ vdL +++ ++v++t ++ + ++ + +e+S Dg++W++++++++++ ++++ t UQT55673.1|CBM0|CBM32|GH92 1188 ALFDNTSATDATSD---SAVDLPVAKETKAVQYTLtSSadKaKAPRGWVLEGSADGQKWKELDKRSGESF-AwdkQTRVfT 1264 56777444544444...59***************9833455799******************98776543.2343345558 PP CBM32.hmm 94 fdkpvtaryvRltv 107 +dkp t ++Rl+ UQT55673.1|CBM0|CBM32|GH92 1265 VDKPGTYAHYRLVP 1278 88999999999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1291 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.61 // Query: CAD7385136.1|CBM32|GH92 [L=1120] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- [No hits detected that satisfy reporting thresholds] Domain annotation for each model (and alignments): [No targets detected that satisfy reporting thresholds] Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1120 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 0 (0); expected 0.0 (0.02) Passed bias filter: 0 (0); expected 0.0 (0.02) Passed Vit filter: 0 (0); expected 0.0 (0.001) Passed Fwd filter: 0 (0); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 0 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 974.94 // Query: XOK63258.1|CBM32 [L=528] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-34 104.4 10.6 9.3e-20 57.6 0.9 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.0 3.0 1e-17 1e-17 7 122 .. 42 165 .. 36 167 .. 0.76 2 ! 57.6 0.9 9.3e-20 9.3e-20 8 122 .. 183 303 .. 176 305 .. 0.77 Alignments for each domain: == domain 1 score: 51.0 bits; conditional E-value: 1e-17 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkp..ttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt..te 90 +s+ +++++++ e a+D+ +t+W + + wl++ + ++ + ++++++t a+ + +++kd+++ +S++gk+Wt++++++n++ ++ ++ XOK63258.1|CBM32 42 VTSNGQSPADQEKEEAFDNLLKTKWLTFQssGWLQYAFPNQssYVITSYSITSANdfPeRDPKDWTLKGSNNGKDWTVLDTRQNESFDSrfQT 134 456777888899***************74477******9543499*******7334657*********************9988765334644 PP CBM32.hmm 91 .titfdkpvta.ryvRltvtkra.tnawgasiaEl 122 t +f++ ta y+Rl+ ++ ++ ++aE+ XOK63258.1|CBM32 135 kTYNFSN-RTAySYYRLEL--SNhSGGI-LQLAEV 165 3778884.5565******9..3222222.666665 PP == domain 2 score: 57.6 bits; conditional E-value: 9.3e-20 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt.teti. 92 ++s ++ +++g ++++Dg+ t+W +++ w+t+ +++p+ + ++vlt a+ + +++ ++++++S+Dgk+W+t++++++++ + ++t XOK63258.1|CBM32 183 TASGEKLPNEGKDKLNDGSSLTKWFTSQksGWVTYRFDRPMAIGGYVLTSANdvPeRDPAEWTLQASNDGKQWVTLDTRKGEQFrYRyQRTSy 275 44556666799*******8779**9975578******************7334657*********************9876554444533222 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEl 122 ++ ++++ y++l++ +a++ ++ ++aE+ XOK63258.1|CBM32 276 SVRSDAKYSYYKLNM--KASEGNKLQLAEI 303 55567889*******..4444455888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (528 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.69 // Query: BFT71546.1|CBM32|GH92 [L=1968] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-31 93.4 29.1 5.5e-21 61.5 6.7 4.7 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.5 6.7 5.5e-21 5.5e-21 10 123 .. 95 215 .. 87 216 .. 0.81 2 ? -2.1 0.1 0.28 0.28 50 83 .. 627 662 .. 597 677 .. 0.63 3 ? -0.3 0.3 0.075 0.075 11 40 .. 723 756 .. 715 785 .. 0.69 4 ! 42.3 4.8 4.9e-15 4.9e-15 12 122 .. 1193 1309 .. 1185 1311 .. 0.76 Alignments for each domain: == domain 1 score: 61.5 bits; conditional E-value: 5.5e-21 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt.te 90 ++ +++g+ a n++D ++n++W ++ w+ ++L ++ v ++ lt a+ +++k++++e+S+Dg+tWtt+++++n+t ++ BFT71546.1|CBM32|GH92 95 GEYTSSGEVAVNLIDSNTNSKWLDTSstSWVRFKLSEASAVMRYALTSANdsAgRDPKNWQFEGSNDGSTWTTLDTRTNQTFsERfQT 182 444555599**************985589******************7334446**********************999886444755 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ +f++ ++ y+Rl++t+++ +++ +++E++ BFT71546.1|CBM32|GH92 183 KVyDFANETPYVYYRLNITANSGDSY-IQLSEFQ 215 66699977889*******77665567.9999986 PP == domain 2 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 50 kvvltwae...n..grikdykvevStDgktWttvaekgn 83 ++++ + + + k+ ++e+S + t++t++ek++ BFT71546.1|CBM32|GH92 627 TMKIA--TsliSldQAKKNLELEISPAD-TFETIKEKAQ 662 33333..123423467889999999443.7999977643 PP == domain 3 score: -0.3 bits; conditional E-value: 0.075 CBM32.hmm 11 ssaaggggaenavDgd...pntrWssag.qwltv 40 s+++++ + ++++Dg+ +n +W ++ w + BFT71546.1|CBM32|GH92 723 STSTATTSCAKINDGKiyvNNGFWDTYRtAWPAY 756 33444489*******9543345999863445444 PP == domain 4 score: 42.3 bits; conditional E-value: 4.9e-15 CBM32.hmm 12 saaggggaenavDgdpntrWssag..qwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt.te. 90 ++++++++ n++D++ ntr ++ w+++ + + ++ ++lt + + g++k++ + +S+Dg++Wt++++++n+t BFT71546.1|CBM32|GH92 1193 DSTNSSTIGNLFDNSSNTRVTLNSakPWIQYQFLgSKKQAAMYTLTS-GnTdGDAKSWMLKGSNDGQNWTVLDQRTNETF-AwRSy 1276 3344589***********977664578****9752778888899994.3346*********************9998664.23233 PP CBM32.hmm 91 titfd..kpvtaryvRltvtkra.tnawgasiaEl 122 t++f+ +p + ++Rl+vt+++ t ++s aE+ BFT71546.1|CBM32|GH92 1277 TRPFTiqTPGKYEFYRLEVTENSgT--ATTSFAEI 1309 557777788999*******887633..33778876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1968 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 185.47 // Query: XPG31226.1|CBM32|GH92 [L=987] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.1 8.8 2.2e-14 40.2 4.8 2.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.2 0.1 0.025 0.025 89 112 .. 201 222 .. 117 252 .. 0.71 2 ! 40.2 4.8 2.2e-14 2.2e-14 11 121 .. 864 981 .. 858 985 .. 0.70 Alignments for each domain: == domain 1 score: 1.2 bits; conditional E-value: 0.025 CBM32.hmm 89 tetitfdkpvt.aryvRltvtkrat 112 +++it + + a y+R+tv ++at XPG31226.1|CBM32|GH92 201 KTEITPT---DhAAYFRFTVPASAT 222 2244333...327999999955332 PP == domain 2 score: 40.2 bits; conditional E-value: 2.2e-14 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag..qwltvdLg..kpttvdkvvltwae...n.grikdykvevStDgktWttvaekgnttdgt.. 88 ss+++ g+ n+ D d +t W+sa+ w++ d +p +v ++ ++ +++k++k+ +S+Dg tW+t++e+ n++ + XPG31226.1|CBM32|GH92 864 SSSTT-GQSGNLYDRDSDTAWQSASanAWIEADAAagQPASVPRIYTLTSGtqgAdQDPKSWKLKASKDGATWVTLDERRNESF-Qwr 949 22233.6899*************866889999876226667777755543244447*********************9887653.343 PP CBM32.hmm 89 tetitfd.kpvtaryvRltvtkratnawgasiaE 121 ++t++f+ k+ t y R++++ ++t+++++ +E XPG31226.1|CBM32|GH92 950 QQTRPFAlKAGTESYSRYRIEFDNTGTMTV--SE 981 458899997777777777773344544534..33 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (987 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 146.27 // Query: BFU43428.1|CBM0|CBM32|GH92 [L=1433] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-26 77.4 13.6 4.1e-16 45.8 4.3 3.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 45.8 4.3 4.1e-16 4.1e-16 14 109 .. 99 202 .. 89 230 .. 0.76 2 ? 1.3 0.0 0.025 0.025 17 71 .. 607 674 .. 594 690 .. 0.70 3 ! 33.4 0.8 2.9e-12 2.9e-12 19 122 .. 1178 1287 .. 1169 1289 .. 0.70 Alignments for each domain: == domain 1 score: 45.8 bits; conditional E-value: 4.1e-16 CBM32.hmm 14 aggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt..t 89 +++++ +n++D dp t+W ++ w + L++p +v ++ lt a+ + ++++d+++e+S Dg+tWttv+++++++ ++ + BFU43428.1|CBM0|CBM32|GH92 99 NPDENGTNLNDADPATKWLVDTptSWARYALDAPARVVRYALTSANdaPeRDPRDWTLEGSADGTTWTTVDTRTGQSFDQrfQ 181 4557899*************86678******************7334547*********************998876433453 PP CBM32.hmm 90 e.titfdkpvtaryvRltvtk 109 + t ++++p++ +Rl +t+ BFU43428.1|CBM0|CBM32|GH92 182 ThTYEVANPASFAVYRLSITG 202 334566688887888888855 PP == domain 2 score: 1.3 bits; conditional E-value: 0.025 CBM32.hmm 17 ggaenavDgdpn.t...rWssa..g.....qwltvdLgkpttvdkvvltwae..n.grikdykvevStD 71 ++ a+D ++ t r +++ + ++l+++L + t+ +v+ a+ + r+++++ve+ + BFU43428.1|CBM0|CBM32|GH92 607 STGYLAFDTSTEkTvtlRIATSliSvaqarHNLELELAASATLESVRDA-AQrqWdARMHTVEVEGASE 674 45677888865443335565533313457899**************988.3345579999999997743 PP == domain 3 score: 33.4 bits; conditional E-value: 2.9e-12 CBM32.hmm 19 aenavDgdpntrWssag..qwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..teti 92 ++vD+ + tr + ++ + ++ + ++lt ++ g+++ +++ +S Dg+ Wtt++e+++++ + +t+ BFU43428.1|CBM0|CBM32|GH92 1178 EPALVDDTTATRVVFPTatPAWQYQFTSAgERAEFYTLT-SGaVaGDPTGWRLRGSYDGTRWTTIDERSGQS-FDwrLQTR 1256 567889888888777533445788888773444445555.323259********************987765.44433477 PP CBM32.hmm 93 tfd..kpvtaryvRltvtkratnawgasiaEl 122 +f+ +p t ry+Rl+vt++ t+++++ +aE+ BFU43428.1|CBM0|CBM32|GH92 1257 PFKiaTPGTYRYYRLEVTGN-TGQPSTTLAEV 1287 8887789999*******554.55666778876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1433 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 169.32 // Query: CAM1103682.1|CBM32|GH92 [L=1152] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-08 20.5 0.0 7.1e-08 19.2 0.0 1.7 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 19.2 0.0 7.1e-08 7.1e-08 22 124 .] 1029 1137 .. 1019 1137 .. 0.69 Alignments for each domain: == domain 1 score: 19.2 bits; conditional E-value: 7.1e-08 CBM32.hmm 22 avDgdpnt.rWssag.qwltvdLg.kpttvdkvvltw.aen.grikdykvevStDgktWttvaekgnttdgt..tetitfd..k 96 + Dgd+ t ++ ++ v + ++++v ++lt a + + d+++++S Dg+ W++++ + ++ ++ + f + CAM1103682.1|CBM32|GH92 1029 LADGDAATsSVLDGShPTIDVHFTdGARRVLMYTLTSaA-TgHGPGDWQLQGSRDGSRWHVLDRRHGEA-FRwpQQLRAFGvtE 1110 668877762333322445999998788999999999651.3367******************9876543.33533433666558 PP CBM32.hmm 97 pvtaryvRltvtkra.tnawgasiaElae 124 p + y+Rl++ ++ ++a +++++E+++ CAM1103682.1|CBM32|GH92 1111 PGDYIYYRLRI--DNgNDAGPVALSEIQW 1137 88899999999..5533344488888875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1152 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 182.81 // Query: WYW18638.1|CBM32|GH92 [L=1430] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-31 93.9 14.7 1.3e-23 70.0 1.7 3.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 70.0 1.7 1.3e-23 1.3e-23 4 122 .. 86 210 .. 83 212 .. 0.76 2 ? 1.0 0.2 0.03 0.03 10 40 .. 717 750 .. 708 786 .. 0.67 3 ! 29.3 1.4 5.3e-11 5.3e-11 18 123 .. 1178 1285 .. 1171 1286 .. 0.73 Alignments for each domain: == domain 1 score: 70.0 bits; conditional E-value: 1.3e-23 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd 86 + sa +s++++++g +n+vDg+++t+W +++ w ++ L +pt+++++ l + ++++d+++ +StDg +Wt+++++++++ WYW18638.1|CBM32|GH92 86 EVSA--NSENTPNEGVANLVDGSTDTKWLAWTptGWAQITLSEPTSITRYALSSaNDfDnRNPQDWTLKGSTDGRSWTDLDKQTGQKF 171 4444..5666677*****************96678******************7522535********************98877654 PP CBM32.hmm 87 gt...tetitfdkpvta.ryvRltvtkratnawgasiaEl 122 ++ +++ +++++ a +++Rl+vtk++ + ++++El WYW18638.1|CBM32|GH92 172 SEpfqKKEYRLAAASAAyKFFRLEVTKNNG-GPIMQLSEL 210 335633366777433455*******76443.244677765 PP == domain 2 score: 1.0 bits; conditional E-value: 0.03 CBM32.hmm 10 sssaaggggaenavDgd...pntrWssag.qwltv 40 + +++++++ +++vDg +n +W ++ w + WYW18638.1|CBM32|GH92 717 G-QDTPTQTGAKLVDGEfyvNNGFWDTYRtVWSAY 750 3.44455899******7654345777752234444 PP == domain 3 score: 29.3 bits; conditional E-value: 5.3e-11 CBM32.hmm 18 gaenavDgdpntrWssag.qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..k 96 g ++ +D+ +t +++ +++ ++ + ++ ++ + g++k++ + +S DgktW ++++++++t + ++t+ f+ + WYW18638.1|CBM32|GH92 1178 GDAAFFDNTSRT--EAKVkAPIQYQVPSTNEAGSFYTLTSGkGaGDAKSWVLKGSYDGKTWAVADQRTDQTF-QwrQQTRAFKiaN 1260 556778884444..443222399999999999999666433447******************9998988764.3434566888779 PP CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEla 123 p+ y+Rl+vt+ t+ as++E++ WYW18638.1|CBM32|GH92 1261 PAHYAYYRLEVTA--TTGGEASLSEFE 1285 9999*******55..333348999985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1430 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 176.61 // Query: WXA84791.1|CBM32|GH92 [L=1320] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-32 97.2 23.0 1.1e-22 67.0 3.4 4.3 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.0 3.4 1.1e-22 1.1e-22 7 113 .. 106 221 .. 100 236 .. 0.76 2 ? -0.7 0.0 0.098 0.098 65 95 .. 429 459 .. 395 469 .. 0.74 3 ? 2.4 0.2 0.011 0.011 10 40 .. 748 782 .. 740 814 .. 0.72 4 ! 37.1 3.7 2e-13 2e-13 15 122 .. 1203 1315 .. 1195 1317 .. 0.75 Alignments for each domain: == domain 1 score: 67.0 bits; conditional E-value: 1.1e-22 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt. 88 ++s++++a+g+ a+n++Dgd++++W + wl+++L++p v++++l a+ ++++d+ +++S+Dg+tW+++++++n++ t WXA84791.1|CBM32|GH92 106 TASGENDASGEVADNLTDGDTRSKWLVFEstGWLVYKLDEPVAVKRYRLASANdfDqRDPRDWALQGSQDGETWVDLDKQTNQNF-Te 192 345677788899*************9963467******************7334645********************99888764.32 PP CBM32.hmm 89 ..tetitfd..kpvta.ryvRltvtkratn 113 + t++f+ ++ta y+Rl++t+++++ WXA84791.1|CBM32|GH92 193 rfQ-TREFNvpGNTTAyLYYRLNITANHSG 221 342.3355544667777*******775433 PP == domain 2 score: -0.7 bits; conditional E-value: 0.098 CBM32.hmm 65 kvevStDgktWttvaekgnttdgt.tetitfd 95 vev t+ ++W++ +n + g+ + +f+ WXA84791.1|CBM32|GH92 429 AVEVRTNPSDWVDTRRGTNSS-GDfSRGNNFP 459 699999*****9997555533.3321233554 PP == domain 3 score: 2.4 bits; conditional E-value: 0.011 CBM32.hmm 10 sssaaggggaenavDgd...pntrWssag.qwltv 40 s + +++++ +++vDg+ +n +W ++ +w + WXA84791.1|CBM32|GH92 748 SGAGSPTNTGAKLVDGKvfvNNGFWDTYRgTWSAY 782 334455599*******9664456999964445444 PP == domain 4 score: 37.1 bits; conditional E-value: 2e-13 CBM32.hmm 15 ggggaenavDgdpntrWssagqwltvdLgkpttvdkvvltw..ae..n.grikdykvevStDgktWttvaekgnttdgt.tetitf 94 g +g +++ D+++nt + ++ + +++ v+ +++t a+ + g+++d+ +e+S+Dg+tW+++++++++ + +t+ f WXA84791.1|CBM32|GH92 1203 GCNGDARLYDNSANTSATVN--AVQCKIQGTAPVRFYTITStaASdtTnGDPTDWVLEGSNDGTTWKELDKRTGQVFPWrLQTRAF 1286 456788999**999965555..4*****************875225546********************99987654334235566 PP CBM32.hmm 95 d...kpvtaryvRltvtkratnawgasiaEl 122 + +++t +Rltvtk + +++++iaE+ WXA84791.1|CBM32|GH92 1287 KvadAAATYANYRLTVTKGT--KTTTAIAEV 1315 66566667788999996644..233678887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1320 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.74 // Query: BFO16417.1|CBM32|GH92 [L=288] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-12 31.9 0.6 3.5e-11 29.9 0.3 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.0 0.094 0.094 29 34 .. 128 133 .. 93 155 .. 0.53 2 ! 29.9 0.3 3.5e-11 3.5e-11 17 109 .. 183 277 .. 169 286 .. 0.72 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.094 CBM32.hmm 29 trWssa 34 rW s+ BFO16417.1|CBM32|GH92 128 KRWDST 133 345553 PP == domain 2 score: 29.9 bits; conditional E-value: 3.5e-11 CBM32.hmm 17 ggaenavDgdpntrWssagqwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd..kpv 98 ga +++D+ t ++ tv+L + + +v++t ++ + ++ + +++S Dg tWt+++ +++++ + +t+ f+ +p BFO16417.1|CBM32|GH92 183 KGAGALFDDTSAT--GATV--STVELPVTGDTEAVQYTLtSSdRaKAPTGWVLQGSADGRTWTDLDRRAGESFrWDRQTRAFTvgEPK 266 5688889983333..3332..59***************974445699******************98876554333346677776765 PP CBM32.hmm 99 taryvRltvtk 109 ++Rl+ t+ BFO16417.1|CBM32|GH92 267 AYGHYRLVLTG 277 45999999954 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (288 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.57 // Query: WHY22107.1|CBM32|GH92 [L=2199] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-29 89.3 15.2 9.9e-21 60.7 4.4 3.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.7 4.4 9.9e-21 9.9e-21 10 122 .. 94 214 .. 86 216 .. 0.80 2 ! 31.8 3.1 8.9e-12 8.9e-12 16 122 .. 1199 1314 .. 1189 1316 .. 0.71 Alignments for each domain: == domain 1 score: 60.7 bits; conditional E-value: 9.9e-21 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt.te 90 +s+++++++ ++++Dg ++t+W + + w+ ++L+++ tv+k+ lt a+ n +++kd+k+++S+D+ tWt+++++++++ + ++ WHY22107.1|CBM32|GH92 94 NSDNPPNETKDKLIDGTETTKWLTRTstGWIKFKLQAADTVTKYALTSANdaNgRDPKDWKLYGSNDDATWTVIDTRTDESFpNRfQR 181 6788899*********999*****64467******************7334667**********************998877565756 PP CBM32.hmm 91 ti.tfd.kpvtaryvRltvtkratnawgasiaEl 122 +i +++ +++ y+++ +tk++ + ++aE+ WHY22107.1|CBM32|GH92 182 QIyDIPnHTTPYLYYKFDITKNNG-ESLLQLAEI 214 666777555557*******66432.344777776 PP == domain 2 score: 31.8 bits; conditional E-value: 8.9e-12 CBM32.hmm 16 gggaenavDgdpn.trWssag.qwltvdLg.kpttvdkvvltwae...n.grikdykvevStDgktWttvaekgnttdgt.te.ti 92 + + +n++D++ t +++ ++++ + ++ +++ ++lt ++ + +++k++ + +S+Dg tW t++++++++ + + t+ WHY22107.1|CBM32|GH92 1199 TVSLKNLFDNNSAsTVLINSTnPTIQYQFTaGAEKISMYTLTSSGlgtEkSDPKSWVLKGSNDGITWDTLDSRKDES-FQwRQyTR 1283 35689*****976364444334569999997779********72255547*********************987754.33434366 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratna.wgasiaEl 122 f+ + +a y R++ + ++tn +++++aE+ WHY22107.1|CBM32|GH92 1284 AFAITGEAEYSRYQLEVTETNGgTSTALAEI 1314 9997788999999995555443255778876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (2199 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 211.22 // Query: XHR97051.1|CBM32 [L=167] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-18 53.8 0.3 1.7e-18 53.5 0.3 1.1 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.5 0.3 1.7e-18 1.7e-18 14 111 .. 45 151 .. 37 166 .. 0.74 Alignments for each domain: == domain 1 score: 53.5 bits; conditional E-value: 1.7e-18 CBM32.hmm 14 aggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt.teti.tfdkp 97 ++g+g ++++Dgd+ t++ ++ + w++++L++p ++lt a+ + ++++ ++ e+S+DgktWt+++ ++n+ ++++ +++ + XHR97051.1|CBM32 45 DNGEGSKKVIDGDDHTKFLADlQgrLWMQFELNEPAVSGVYTLTSANdaPeRDPRAWTYEGSNDGKTWTELDRRSNFFFeERyQTKVfRCS-N 136 56689**************97634789********7777778886334547********************99988765333433444666.5 PP CBM32.hmm 98 vta.ryvRltvtkra 111 +ta +++R+ +++ XHR97051.1|CBM32 137 TTAyKFYRVDISELR 151 6666******95533 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (167 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 57.31 // Query: XRI05794.1|CBM32|GH92 [L=1913] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-21 63.5 9.5 3e-14 39.8 1.5 3.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.8 1.5 3e-14 3e-14 6 111 .. 81 193 .. 76 208 .. 0.74 2 ? -2.8 0.1 0.44 0.44 31 71 .. 337 375 .. 307 382 .. 0.60 3 ! 27.3 0.2 2.1e-10 2.1e-10 43 122 .. 1218 1301 .. 1183 1315 .. 0.67 Alignments for each domain: == domain 1 score: 39.8 bits; conditional E-value: 3e-14 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStD.gktWttvaekgnttd. 86 sa ++++a+g+ a n+ D +p ++W + + ++t+ L++p++ +++lt a+ + ++++d++v +StD g+tW+tv+++++ XRI05794.1|CBM32|GH92 81 SA--TAENAPGEIAVNLSDANPASKWLAFErtASITYLLDSPQSAATWSLTSANdaPtRDPRDVTVLGSTDgGTTWVTVDQRSGMAFs 166 33..556677799***************744567*****************7334557*************679*****986655443 PP CBM32.hmm 87 gttetitfd..kpvtaryvRltvtkra 111 g +t +f+ +p+ +Rl +t++a XRI05794.1|CBM32|GH92 167 GRGTTLDFAvpTPAAYDAYRLDITANA 193 442255777335544477888886543 PP == domain 2 score: -2.8 bits; conditional E-value: 0.44 CBM32.hmm 31 WssagqwltvdLg..kpttvdkvvltw.aengrikdykvevStD 71 W s + v Lg + +tv +vv+t+ + g + d +++++ D XRI05794.1|CBM32|GH92 337 WNS----VRVPLGdlAGKTVESVVFTYdNA-GGTADTRFQGWID 375 333....88888855558999999996422.6677777777655 PP == domain 3 score: 27.3 bits; conditional E-value: 2.1e-10 CBM32.hmm 43 gkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 +p tv++++lt ++ + ++++++e+StDg tW +v+e++++ ++ +t++f+ +p + +++R+ t+++ +a ++El XRI05794.1|CBM32|GH92 1218 SGPVTVSRYTLT-NGptGaAAPTSWTLEGSTDGATWLPVDERAGQAFPSaLQTRPFTvaDPRPFTWYRISTTGTTD-GRAATLSEL 1301 4899********.43554799*******************998876655334667777788888999999966442.233555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1913 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 188.92 // Query: WIB11676.1|CBM32 [L=740] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-12 32.3 0.3 6e-12 32.3 0.3 2.4 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.3 0.3 6e-12 6e-12 44 122 .. 20 101 .. 4 103 .. 0.75 2 ? -3.1 0.4 0.54 0.54 81 81 .. 474 474 .. 439 519 .. 0.51 Alignments for each domain: == domain 1 score: 32.3 bits; conditional E-value: 6e-12 CBM32.hmm 44 kpttvdkvvltw.aen.grikdykvevStDgktWttvaekgnttdgt....tetitfdkpvtaryvRltvtkratnawgasiaEl 122 +p tvd+++lt a + +++++k+e+S+Dg+tW+++ ++++ + t+ +t++ p+ +++Rl vt+++t++ si E+ WIB11676.1|CBM32 20 GPVTVDQYTLTTaA-SgAQPTSWKLEGSSDGTTWVPLSTVAKSA-FDaplqTRPTTIAHPAALTWYRLSVTGTSTGKA-PSIGEF 101 789********752.3489******************9876433.333453222244456656*******99887654.689888 PP == domain 2 score: -3.1 bits; conditional E-value: 0.54 CBM32.hmm 81 k 81 k WIB11676.1|CBM32 474 K 474 1 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (740 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 146.60 // Query: XJY77998.1|CBM32|GH92 [L=1382] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-14 40.1 13.8 8e-13 35.2 1.1 3.6 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.8 0.1 0.44 0.44 13 34 .. 551 575 .. 536 584 .. 0.67 2 ? -3.0 0.5 0.53 0.53 69 83 .. 746 759 .. 735 777 .. 0.67 3 ! 35.2 1.1 8e-13 8e-13 17 122 .. 1018 1132 .. 1011 1134 .. 0.71 4 ! 12.9 0.0 6e-06 6e-06 36 79 .. 1284 1323 .. 1255 1348 .. 0.70 Alignments for each domain: == domain 1 score: -2.8 bits; conditional E-value: 0.44 CBM32.hmm 13 aaggggaenavDgd..pnt.rWssa 34 ++++++ +++ Dg+ nt +W + XJY77998.1|CBM32|GH92 551 SSPTETGAKIADGKvfVNTgFWDTF 575 3344778899999854467688774 PP == domain 2 score: -3.0 bits; conditional E-value: 0.53 CBM32.hmm 69 StDgktWttvaekgn 83 S Dg +Wtt+ ++ + XJY77998.1|CBM32|GH92 746 SADG-EWTTAPDRYD 759 5788.9999965533 PP == domain 3 score: 35.2 bits; conditional E-value: 8e-13 CBM32.hmm 17 ggaenavDgdpnt.rWssag...qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt..tetit 93 + ++++D+ +t +++ + v+ g t+v+ ++lt a ++++ + +e+S+Dg++Wtt++ +++++ ++t++ XJY77998.1|CBM32|GH92 1018 TDVTALFDDTSKTaAVLTGDdpeVRYRVNGGDDTRVTYYTLTSsAAsAdQDPRGWVLEGSDDGTHWTTLDRRTDEEF-RwrNQTRP 1102 667888888555533333323444589999999*********7522446********************99987553.34444555 PP CBM32.hmm 94 fd..kpvtaryvRltvtkra.tnawgasiaEl 122 f p++ r +Rl+v + ++ +s+aE XJY77998.1|CBM32|GH92 1103 FRvdRPASMREYRLRV--VTaDGQQEVSLAEA 1132 555599999*******..44344566899986 PP == domain 4 score: 12.9 bits; conditional E-value: 6e-06 CBM32.hmm 36 qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttva 79 ++t+ L p + ++ v + ++++ ve+StDg++Wttv XJY77998.1|CBM32|GH92 1284 RSFTYRLPVPADGRGTVTL----DIANQFLVEASTDGTHWTTVL 1323 4466666666655555555....4588***************95 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1382 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 159.84 // Query: XAM00599.1|CBM32 [L=378] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-12 33.7 0.0 1.7e-08 21.2 0.0 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 10.3 0.0 4e-05 4e-05 11 122 .. 51 185 .. 45 187 .. 0.63 2 ! 21.2 0.0 1.7e-08 1.7e-08 16 122 .. 221 351 .. 217 353 .. 0.59 Alignments for each domain: == domain 1 score: 10.3 bits; conditional E-value: 4e-05 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltwae..n.grikdykvevStDg...........ktWttvaekg.n 83 + + +++++ a+Dgd +t++ + g +t ++g+ ++ + + + +++ +y + + +D ++Wt + + + XAM00599.1|CBM32 51 YPD-PNEAPGMAIDGDFGTKYLNFGaansgFIITPNFGSSIALSLALFSA-NdaPeRDPLSYALFGTNDTinstdnsfgnaENWTAISSGAlA 141 444.4599***********9888533345667********9999988884.345469********9996422222233333579998766533 PP CBM32.hmm 84 ttdgt...te..titfdkpvtaryvRltvtkra.tn.awgasiaEl 122 + t ++f++++ + +Rl + + + a++++iaE+ XAM00599.1|CBM32 142 PP--AardTPypVVDFANAAAYTSYRLLFPTLVdEGlANSMQIAEV 185 33..233422446688866656999998843222222344778876 PP == domain 2 score: 21.2 bits; conditional E-value: 1.7e-08 CBM32.hmm 16 gggaenavDgdpntrWssag....qwltvdLgkpttvdkvvltwae..n.grikdykvevSt.........Dg..ktWttvaekg.nttdgt. 88 ++a+na+Dgd nt++ + g ++ g+p v+++v+t a+ +++ +y++++ + Dg ++Wt + + + + + + XAM00599.1|CBM32 221 AEAAANAIDGDVNTKFLNFGqsgaGFIVTPSGGPSIVQGMVITTANdfVeRDPDSYEIYGTNdpitspadgDGssENWTLIQAGDlDLP-FDr 312 5789**********998852233445999999***********83345359********999555555544334458998854432322.223 PP CBM32.hmm 89 .te.ti.tfdkpvtaryvRltvtkra..tnawgasiaEl 122 t+ ++ +++ + + +R+++ + ++a +++iaE+ XAM00599.1|CBM32 313 fTDgEFvVINNGDSYTSYRVVFPGVRdgASADSFQIAEI 351 322222122211124666666633221222233666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (378 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.28 // Query: WIX91234.1|CBM32|GH92 [L=1441] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-35 108.4 19.5 1.1e-24 73.5 2.8 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.5 2.8 1.1e-24 1.1e-24 3 121 .. 87 212 .. 85 215 .. 0.77 2 ? 1.1 0.2 0.029 0.029 13 37 .. 721 749 .. 711 817 .. 0.72 3 ! 41.3 3.9 9.8e-15 9.8e-15 12 123 .. 1183 1296 .. 1179 1297 .. 0.77 Alignments for each domain: == domain 1 score: 73.5 bits; conditional E-value: 1.1e-24 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgntt 85 t++sa ss++a+gg+ +n+vDg ++t+W s++ w ++ L +pt+++++ + a+ +++kd+++++S+D + Wt++++++++ WIX91234.1|CBM32|GH92 87 TETSA-SSENAGGGEVVSNLVDGTTDTKWLSWDptAWAQITLSEPTSITHYAISSANdfAeRDPKDWTLQGSNDASAWTDLDSQTGQA 173 45555.4666677789***************96689******************7334546********************9988766 PP CBM32.hmm 86 dgt...te.titfdkpvta.ryvRltvtkratnawgasiaE 121 t ++ + ++++p+ a ry+Rl+vt+++ + +++E WIX91234.1|CBM32|GH92 174 F-TarfQQkDYKLAAPTAAyRYFRLNVTGNNG-GPILQLSE 212 4.334634366888777777*******65332.24466666 PP == domain 2 score: 1.1 bits; conditional E-value: 0.029 CBM32.hmm 13 aaggggaenavDgdp..nt.rWssag.qw 37 ++++++ +++vDg++ n+ +W ++ +w WIX91234.1|CBM32|GH92 721 DTPTQTGAKIVDGQTyvNNgFWDTYRtTW 749 4555889999***6322223788853334 PP == domain 3 score: 41.3 bits; conditional E-value: 9.8e-15 CBM32.hmm 12 saaggggaenavDgdpntrWssag.qwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tet 91 +++g ++a+++vD+ ++r ++a +++ L+++ v++++lt + + g++k++ + +S DgktW +++ ++n+ + ++t WIX91234.1|CBM32|GH92 1183 TSDG-SNAAALVDN--TSRTQAAVtGAVQYQLNSTdEAVTNYTLTS-QtGaGDPKSWVLKGSYDGKTWAVADRQENQA-FSwrQQT 1263 3455.88*******..44555542236******7769********4.3446******************887776765.4454456 PP CBM32.hmm 92 itfd..kpvtaryvRltvtkratnawgasiaEla 123 + f+ +p+ y+Rl+vt+++t+a+ a++aE++ WIX91234.1|CBM32|GH92 1264 RAFKvaDPAHYAYYRLEVTATSTGAP-AQLAEFE 1296 68887799999*******88888766.9****95 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1441 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 172.45 // Query: XPG56250.1|CBM32|GH92 [L=987] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.1 8.8 2.2e-14 40.2 4.8 2.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.2 0.1 0.025 0.025 89 112 .. 201 222 .. 117 252 .. 0.71 2 ! 40.2 4.8 2.2e-14 2.2e-14 11 121 .. 864 981 .. 858 985 .. 0.70 Alignments for each domain: == domain 1 score: 1.2 bits; conditional E-value: 0.025 CBM32.hmm 89 tetitfdkpvt.aryvRltvtkrat 112 +++it + + a y+R+tv ++at XPG56250.1|CBM32|GH92 201 KTEITPT---DhAAYFRFTVPASAT 222 2244333...327999999955332 PP == domain 2 score: 40.2 bits; conditional E-value: 2.2e-14 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag..qwltvdLg..kpttvdkvvltwae...n.grikdykvevStDgktWttvaekgnttdgt.. 88 ss+++ g+ n+ D d +t W+sa+ w++ d +p +v ++ ++ +++k++k+ +S+Dg tW+t++e+ n++ + XPG56250.1|CBM32|GH92 864 SSSTT-GQSGNLYDRDSDTAWQSASanAWIEADAAagQPASVPRIYTLTSGtqgAdQDPKSWKLKASKDGATWVTLDERRNESF-Qwr 949 22233.6899*************866889999876226667777755543244447*********************9887653.343 PP CBM32.hmm 89 tetitfd.kpvtaryvRltvtkratnawgasiaE 121 ++t++f+ k+ t y R++++ ++t+++++ +E XPG56250.1|CBM32|GH92 950 QQTRPFAlKAGTESYSRYRIEFDNTGTMTV--SE 981 458899997777777777773344544534..33 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (987 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 154.90 // Query: XHS38256.1|CBM32|GH92 [L=1954] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-28 84.9 14.4 4.8e-17 48.8 4.6 4.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 48.8 4.6 4.8e-17 4.8e-17 6 107 .. 95 206 .. 91 230 .. 0.78 2 ? 0.2 0.0 0.052 0.052 36 79 .. 352 415 .. 334 439 .. 0.60 3 ! 38.9 0.7 5.5e-14 5.5e-14 11 121 .. 1181 1295 .. 1172 1311 .. 0.71 Alignments for each domain: == domain 1 score: 48.8 bits; conditional E-value: 4.8e-17 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt 88 + ++s ++a++++a +a Dg+p+t+W + wl++ L+++ t +++lt + + +++k++ + +StDg+tW+++++++n+t + XHS38256.1|CBM32|GH92 95 TVTASGENAPNEAAIWAADGNPGTKWLVFQpqGWLQYQLQNVATAVTYTLTSgNDaPeRDPKQWVLKGSTDGSTWVDLDTQTNQTWAD 182 45567778888*****************75567******************7532547*********************988765433 PP CBM32.hmm 89 .....tetitfdkpvtaryvRltv 107 +++ t+++p y++l + XHS38256.1|CBM32|GH92 183 adrgvKKSYTIQTPGAYSYYKLDG 206 455532344555666569999988 PP == domain 2 score: 0.2 bits; conditional E-value: 0.052 CBM32.hmm 36 qw..ltvdLgkp...ttvdkvvltw...ae....n..grikdykve...vStDg...ktWttva 79 qw +++dLg+ +tv++v++++ ++ g+ d+++e + Dg +++++ XHS38256.1|CBM32|GH92 352 QWnqVEIDLGTIaagKTVTAVQFHYdnpGGtadtAfgGYLDDIRIEsapATIDGsslTNYVDTR 415 3444999999762245888888887654113444245777788888444334662223444443 PP == domain 3 score: 38.9 bits; conditional E-value: 5.5e-14 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkv.vltwae.n.grikdykvevStDgktWttvaekgnttd.gtte 90 s+agg++ ++++D++ +t ag ++tv ++++ + ++ +lt + +++ +k+e+S+Dg tW t++e+++ t ++ XHS38256.1|CBM32|GH92 1181 VSSAGGENVAALTDDSSRTQVTFAGatPSVTVTYKGASQAPSFyTLTS-GaAkADPSAWKLEGSDDGVTWSTLDERSGRTFaQRNQ 1265 33456699*******88885544433467******8866666615553.233499******************9977655433345 PP CBM32.hmm 91 titfd..kpvtaryvRltvtkratnawgasiaE 121 t++f+ p++ + +Rltvt+ +++ +++E XHS38256.1|CBM32|GH92 1266 TVPFQieRPAPYQQYRLTVTAG---DPTIALSE 1295 889999888889*******662...23344444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1954 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 189.25 // Query: XUK25539.1|CBM32|GH92 [L=1291] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-31 94.9 8.9 3e-23 68.8 0.5 4.1 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.8 0.5 3e-23 3e-23 6 122 .. 106 230 .. 101 232 .. 0.77 2 ? 1.3 0.2 0.023 0.023 13 47 .. 730 767 .. 723 817 .. 0.77 3 ? -2.3 0.1 0.31 0.31 71 108 .. 1098 1124 .. 1092 1138 .. 0.50 4 ! 27.2 0.0 2.3e-10 2.3e-10 46 116 .. 1205 1281 .. 1174 1289 .. 0.76 Alignments for each domain: == domain 1 score: 68.8 bits; conditional E-value: 3e-23 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt 88 a s++++agg+ a+n+vDg p+t+W + + w ++dL++p+ v+++ l a+ ++++d+++++StDgk+W+t++++++++ t XUK25539.1|CBM32|GH92 106 RA-SGENTAGGEVAANLVDGLPGTKWLAFDteGWAEFDLDAPQPVTRYALVSANdhDeRDPRDWTLQGSTDGKEWKTLDTRAGEKF-T 191 44.577888889****************74467******************7334546*********************9876553.3 PP CBM32.hmm 89 ...te.titfd.kpvtaryvRltvtkratnawgasiaEl 122 + t ++ +p+ ++Rl vt+++ + + ++aE+ XUK25539.1|CBM32|GH92 192 eraQSkTYEIGgTPAAYAHYRLDVTANNGGPDAIQLAEV 230 334222334446677669******776555566999997 PP == domain 2 score: 1.3 bits; conditional E-value: 0.023 CBM32.hmm 13 aaggggaenavDgd...pntrWssag.qwltvdLgkptt 47 +a+ ++ +++vDg+ +n +W ++ +w + L +p++ XUK25539.1|CBM32|GH92 730 TAT-HTGAKIVDGKvyvNNGFWDTYRtTWPAYSLLTPKK 767 444.999******85534569999644576666665555 PP == domain 3 score: -2.3 bits; conditional E-value: 0.31 CBM32.hmm 71 DgktWttvaekgnttdgttetitfdkpvtaryvRltvt 108 +gk++t+ a +gn t ++ + ++ vRl+++ XUK25539.1|CBM32|GH92 1098 NGKKFTVTA-RGNST------KN----IYVQSVRLNGK 1124 555555443.33211......11....11244444443 PP == domain 4 score: 27.2 bits; conditional E-value: 2.3e-10 CBM32.hmm 46 ttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd..kpvtaryvRltvtkratnawg 116 v++v++t + + ++ + +++S Dg++W++++++g+++ ++++t+ f+ p t r++R++ + t+a + XUK25539.1|CBM32|GH92 1205 EAVKAVQYTLtSAdRaKAPSGWVLQGSADGTSWRDLDKRGGESFaYDQQTRVFSvaHPGTYRHYRIVPDGGGTGAAA 1281 578999999873344699*******************999877666644445554499999*****98544454444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1291 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 154.39 // Query: UDY23202.1|CBM32 [L=700] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-21 60.9 22.7 5.7e-15 42.1 10.7 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.1 10.7 5.7e-15 5.7e-15 7 111 .. 314 431 .. 309 445 .. 0.73 2 ! 23.7 4.1 2.9e-09 2.9e-09 7 110 .. 458 607 .. 452 633 .. 0.68 Alignments for each domain: == domain 1 score: 42.1 bits; conditional E-value: 5.7e-15 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw...aengrikdykvevStDgktWttvaekg.nttd 86 a+++s+++ +++ ++vDgd nt+W ++ ++t+ L + +v+++++ a n+++k++++ +S+Dg+tWt++++++ ++++ UDY23202.1|CBM32 314 ANTASDNTYKNQVGRIVDGDLNTYWMVSTnngvtvsktATVTYQLSQKWQVTSYQIGTgptA-NTQPKTWTLKGSNDGTTWTPIDTVAaSYPS 405 333444555589*************995223456677778*****************65432.399*******************98745543 PP CBM32.hmm 87 gtte..titfdkpvtaryvRltvtkra 111 + e + t+d+p +y+ l +t++a UDY23202.1|CBM32 406 TS-EwnSYTVDSPGYYKYYQLAITDNA 431 22.333558888877899999996644 PP == domain 2 score: 23.7 bits; conditional E-value: 2.9e-09 CBM32.hmm 7 aessssaaggggaenavDgdpntrWss....ag..........qwltvdLgkpttvdkvvltw...ae..n.grikdykvevSt..Dg....k 73 +++s+ a++g++ + Dg+ +t++ + ++ ++++ L+ p +v++++l + + ++++++++e+ + D + UDY23202.1|CBM32 458 QSASYVASNGENYRMLMDGNGGTKFYNdygsTSgsgvsymnpnFQVVYVLNDPAKVTSYTLRSgadSAsyKnRNPRNWTLEGTNatDSsgqpT 550 4457888888999*******9996555344311344556666667*****************9865115656*********996443222225 PP CBM32.hmm 74 tWttvaekgnttdgt........t..etitfdkpvtaryvRltvtk...........r 110 W +++++ t dg+ + +t+++++p++ +y+Rltvt UDY23202.1|CBM32 551 GWISLDTRTVT-DGQddagfsgnNsiVTRSLSSPASYKYYRLTVTRirtpyasttllG 607 69999988633.322357777642334889999999********76555555544431 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (700 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.45 // Query: XLW92099.1|CBM0|CBM32|GH92 [L=1435] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-32 96.7 18.1 2.3e-21 62.7 1.4 4.2 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.7 1.4 2.3e-21 2.3e-21 4 112 .. 87 203 .. 84 214 .. 0.76 2 ? 1.4 0.3 0.022 0.022 9 37 .. 714 745 .. 706 793 .. 0.70 3 ? -1.0 0.0 0.13 0.13 59 77 .. 1100 1119 .. 1082 1137 .. 0.79 4 ! 40.3 2.6 2.1e-14 2.1e-14 12 122 .. 1178 1289 .. 1174 1291 .. 0.75 Alignments for each domain: == domain 1 score: 62.7 bits; conditional E-value: 2.3e-21 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaek 81 sa+ s++++gg+ a+n++Dg+++t+W s++ ++t+ L +pt+++++ + a+ + ++++d+++++S+D + Wt+++++ XLW92099.1|CBM0|CBM32|GH92 87 DVSAT-SENTGGGEVAANLIDGSTGTKWLSWDpaASVTFALSAPTSITHYAVSSANdfPgRDPRDWTLQGSNDAQRWTDLDKQ 168 55665.555666699***************966778*****************7334657********************987 PP CBM32.hmm 82 gnttdgt..te.titfdkpvta.ryvRltvtkrat 112 ++++ + ++ + ++++p a y+Rl+vt ++ XLW92099.1|CBM0|CBM32|GH92 169 SGQSFASrfQQnDYKLAAPSAAfAYYRLNVTRNNG 203 77665334733366777666667*******65432 PP == domain 2 score: 1.4 bits; conditional E-value: 0.022 CBM32.hmm 9 ssssaaggggaenavDgdp..nt.rWssag.qw 37 +++++a+ + +++vDg++ n+ +W ++ +w XLW92099.1|CBM0|CBM32|GH92 714 TGADTAT-RTGSKIVDGQTyvNNgFWDTYRtTW 745 3444555.899******6422223788853334 PP == domain 3 score: -1.0 bits; conditional E-value: 0.13 CBM32.hmm 59 grikdykvevS.tDgktWtt 77 + +k++ v++ +gk+Wt XLW92099.1|CBM0|CBM32|GH92 1100 NSAKNVYVQGLkVNGKNWTS 1119 56888899988789****96 PP == domain 4 score: 40.3 bits; conditional E-value: 2.1e-14 CBM32.hmm 12 saaggggaenavDgdpntrWssag.qwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt 88 +++g ++a++++D+ ++r +++ +++ L+++ v++++lt + + g++k++++ +S DgktWt+++++++++ + XLW92099.1|CBM0|CBM32|GH92 1178 TSDG-SDASALLDN--TSRTQAKVtGAVQYQLKSAdEAVTHYTLTS-GtGaGDAKSWTLKGSYDGKTWTVADQQTGQSFPW 1254 3455.89*******..55555642236******6669********4.3446******************888777665433 PP CBM32.hmm 89 .tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 ++t+ f+ +p+ y+Rl+vt++a +a +aE+ XLW92099.1|CBM0|CBM32|GH92 1255 rQQTRAFAvkNPAHYAYYRLEVTATA--GGPATLAEF 1289 445667777699999*******6644..334788988 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1435 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 135.52 // Query: WMT02740.1|CBM32|GH92 [L=1110] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-13 35.3 0.4 2.6e-12 33.5 0.1 2.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.48 0.48 36 79 .. 419 463 .. 410 475 .. 0.68 2 ? -3.9 0.0 0.96 0.96 16 34 .. 532 553 .. 527 562 .. 0.63 3 ! 33.5 0.1 2.6e-12 2.6e-12 17 111 .. 994 1090 .. 981 1105 .. 0.73 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.48 CBM32.hmm 36 qwltvdLgkpttvdkvvltw.ae.ngrikdykvevStDgktWttva 79 w+ ++Lg+ ++v+ t + ++ ++ ++e+ +D+ +++ v WMT02740.1|CBM32|GH92 419 AWYGFELGRDRRVTMRIATSlISlQQAQRNLELEIGEDD-DFERVR 463 478999999988877666633122366778888888776.666665 PP == domain 2 score: -3.9 bits; conditional E-value: 0.96 CBM32.hmm 16 gggaenavDgd...pntrWssa 34 + + +++vDg +n +W ++ WMT02740.1|CBM32|GH92 532 ERSGARIVDGRvyvNNGFWDTY 553 4667889999644234588774 PP == domain 3 score: 33.5 bits; conditional E-value: 2.6e-12 CBM32.hmm 17 ggaenavDgdpnt..rWssagqwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfdk 96 + ++++D+d++t r + l ++++p tv+ ++lt + + g++ + +++S+Dg++Wtt++e+ ++ +t+ f+ WMT02740.1|CBM32|GH92 994 KQTAALFDDDATTsaRLNAPMPLLAWNFKTPATVRLYTLTS-SdKpGDAAAWALQGSNDGQQWTTLDERRDQAF-AwrRQTRAFAI 1077 4578999*999985555553134899**************4.3456*********************9988654.33334779997 PP CBM32.hmm 97 pvtaryvRltvtkra 111 +++a y R++ r WMT02740.1|CBM32|GH92 1078 AAPAAYARYRL--RL 1090 77888888877..33 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1110 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 148.33 // Query: XEM58550.1|CBM32|GH92 [L=1430] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-29 89.5 21.0 1.1e-20 60.6 4.6 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.6 4.6 1.1e-20 1.1e-20 4 122 .. 85 209 .. 82 211 .. 0.78 2 ? 1.8 0.2 0.017 0.017 11 37 .. 708 738 .. 699 779 .. 0.68 3 ! 34.8 3.4 1e-12 1e-12 17 123 .. 1178 1286 .. 1167 1287 .. 0.71 Alignments for each domain: == domain 1 score: 60.6 bits; conditional E-value: 1.1e-20 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd 86 ++sa ss++++g++ + +vDg ++t+W +++ w ++ L ++t+++++ +t a+ + +++kd+++++S+D tWt+++++++++ XEM58550.1|CBM32|GH92 85 ETSA--SSENTSGEDSTMLVDGTADTKWLAWTptAWEQITLSEATSITHYAVTSANdaPeRDPKDWTLQGSNDALTWTDIDKQAGQSF 170 3334..556666699***************97789******************7334547********************98777655 PP CBM32.hmm 87 gt..te.titfdkpvta.ryvRltvtkratnawgasiaEl 122 ++ ++ + ++++p+ a +y+R+ vt ++ + + +++aEl XEM58550.1|CBM32|GH92 171 SDrfQQkDYKLAAPTAAfKYFRYDVTRNN-GGPIMQVAEL 209 334634366888888888*******5533.2355888886 PP == domain 2 score: 1.8 bits; conditional E-value: 0.017 CBM32.hmm 11 ssaaggggaenavDgdp..nt.rWssag.qw 37 +++++++ +++vDg++ n+ +W ++ +w XEM58550.1|CBM32|GH92 708 GADTPTQTGSKIVDGQTyvNNgFWDTYRtTW 738 444555899******6422223788853334 PP == domain 3 score: 34.8 bits; conditional E-value: 1e-12 CBM32.hmm 17 ggaenavDgdpntrWssag.qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd.. 95 ++ ++++D+ ++r +s+ +++ L ++++ ++ + g++k++++ +S Dg++W +++e+++++ + ++t+ f+ XEM58550.1|CBM32|GH92 1178 NAVTALFDN--TSRTESKVtAPIQYQLASTKEAATMYTLTSAkIpGDAKSWTLKGSYDGTNWAVADERTDQSF-QwrQQTRAFKvt 1260 678899999..55666642234******99766666444332336******************9999988664.344446677766 PP CBM32.hmm 96 kpvtaryvRltvtkratnawgasiaEla 123 +p+ +y+Rl+vt+++ ++ +s+aE++ XEM58550.1|CBM32|GH92 1261 NPAHFKYYRLEVTATSGGT--MSLAEFE 1286 89889*******7765433..7999995 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1430 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 169.66 // Query: UFT98676.1|CBM0|CBM32|GH92 [L=1705] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-27 81.7 13.3 3e-18 52.7 0.5 3.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 52.7 0.5 3e-18 3e-18 9 111 .. 92 202 .. 87 219 .. 0.78 2 ? -2.1 0.1 0.27 0.27 10 37 .. 716 746 .. 711 768 .. 0.69 3 ! 34.1 3.3 1.8e-12 1.8e-12 12 122 .. 1183 1299 .. 1175 1301 .. 0.71 Alignments for each domain: == domain 1 score: 52.7 bits; conditional E-value: 3e-18 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd 86 +s+++++++ +n+vD +p+t+W + + +++ ++++ ++ k+ lt + + +++ +++++S+D ++Wt+++e++n++ UFT98676.1|CBM0|CBM32|GH92 92 ASAENPPNEITTNLVDRNPQTKWLAFEptARIEFSFEEEVNIVKYALTSaNDyPeRDPEAWELYGSNDKNEWTKLDEQDNQSF 174 4556788899***************744567*****************7532556*********************9988765 PP CBM32.hmm 87 .gt.teti.tfdkpvtaryvRltvtkra 111 +++ + d++ + ry+Rl+++k+ UFT98676.1|CBM0|CBM32|GH92 175 aERyERKLyEMDNDKKYRYYRLEISKNG 202 44353444488877789*******5532 PP == domain 2 score: -2.1 bits; conditional E-value: 0.27 CBM32.hmm 10 sssaaggggaenavDgdp...ntrWssag.qw 37 ++++a+ ++ +++v g+p n +W ++ +w UFT98676.1|CBM0|CBM32|GH92 716 GENTAT-ETGAKIVNGKPyvnNGFWDTYRtTW 746 445555.8999*****9633145999963345 PP == domain 3 score: 34.1 bits; conditional E-value: 1.8e-12 CBM32.hmm 12 saaggggaenavDgdpntrWss.ag.qwltvdLg.kpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd 86 ++++ g a++ +D+ +t s ++ w++++++ k+++ ++lt + + +++k+++v +S+Dgk Wt ++ ++n + UFT98676.1|CBM0|CBM32|GH92 1183 HSDQ-GVAKAWFDNTSDTTLSLsKEkAWVQYKFDsKAKRAMMYTLTS-GekKeQDPKSWEVIGSNDGKRWTLLDREENVS- 1260 3334.7899999*98776444413478*******6668888888885.24557*******************99776754. PP CBM32.hmm 87 gt.teti.tfd..kpvtaryvRltvtkratnawgasiaEl 122 + ++ +f+ +p + +y+R+++++++ +a+ ++aE+ UFT98676.1|CBM0|CBM32|GH92 1261 FKwRSYTqPFTidNPGDYQYYRIQFKDNQ-GANQIALAEV 1299 444233335555599999*******4443.3455777776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1705 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 179.84 // Query: XHM55276.1|CBM0|CBM32|GH92 [L=1285] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-26 78.8 11.8 9.1e-21 60.8 2.9 3.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.8 2.9 9.1e-21 9.1e-21 7 122 .. 101 222 .. 95 224 .. 0.75 2 ! 3.7 0.3 0.0044 0.0044 8 41 .. 724 760 .. 717 794 .. 0.71 3 ! 17.7 0.1 2.1e-07 2.1e-07 40 107 .. 1199 1272 .. 1178 1282 .. 0.68 Alignments for each domain: == domain 1 score: 60.8 bits; conditional E-value: 9.1e-21 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a s ++++gg+ en+vDg +++W + + wl++dL +p + ++ lt a+ + +++kd+++ +S +g++Wtt+++++++ XHM55276.1|CBM0|CBM32|GH92 101 A-SDENTDGGEIKENLVDGEVTSKWLAFDttAWLEFDLSEPVEAVRYALTSANdaPgRDPKDWTLKGSANGSDWTTLDTSKDE 182 3.4556677799*******999*****74478*********8888888886334557********************998776 PP CBM32.hmm 85 td.gttetitfd..kpvta.ryvRltvtkratnawgasiaEl 122 t + ++t++f+ + + a +++Rl++t +a ++ +++aE+ XHM55276.1|CBM0|CBM32|GH92 183 TFsSRQQTREFSfsSST-AyQHFRLEITRNAGDDI-VQLAEV 222 65333434455542544.55*******77554344.888887 PP == domain 2 score: 3.7 bits; conditional E-value: 0.0044 CBM32.hmm 8 essssaaggggaenavDgd...pntrWssag.qwltvd 41 + + +++++++ +++vDg+ +n +W ++ +w + XHM55276.1|CBM0|CBM32|GH92 724 A-TGENTPTHTGAKIVDGKvyvNNGFWDTYRtTWPAYS 760 3.4455566*********95534569999644564444 PP == domain 3 score: 17.7 bits; conditional E-value: 2.1e-07 CBM32.hmm 40 vdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt.te.ti.tfdkpvtaryvRltv 107 v+L + ++v++t ++ + ++ + +++S Dg++W++++ +++++ + ++ ++ ++++p ++Rl+ XHM55276.1|CBM0|CBM32|GH92 1199 VNLPVTEPGRAVQYTLtSSdRgKAPTGWVLQGSPDGEKWRDLDRRSGESFNWdKQtRVfSVKNPGVYEHYRLVP 1272 666666666788888764344699******************98765443334332333555777678888875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1285 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 167.10 // Query: XDS65795.1|CBM32|GH92 [L=1442] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-24 73.0 25.5 1.2e-18 54.0 3.6 4.3 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 54.0 3.6 1.2e-18 1.2e-18 8 111 .. 105 217 .. 100 238 .. 0.77 2 ? -2.8 0.0 0.44 0.44 36 54 .. 360 383 .. 296 421 .. 0.61 3 ? -1.9 0.1 0.23 0.23 10 34 .. 734 760 .. 726 776 .. 0.67 4 ! 32.6 2.2 5.1e-12 5.1e-12 13 122 .. 1199 1315 .. 1188 1317 .. 0.71 5 ? -1.3 0.2 0.16 0.16 11 56 .. 1343 1405 .. 1332 1435 .. 0.52 Alignments for each domain: == domain 1 score: 54.0 bits; conditional E-value: 1.2e-18 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.. 88 ++s ++ +++ga+n+ D + t+W + w+t+++ +pt ++++ lt a+ ++++ +++++StDg+tW+tv+e+++ + + XDS65795.1|CBM32|GH92 105 TASGENLPNEGAANIADASSATKWLTFArtGWVTYEMTEPTVISAYALTSANdfAdRDPQAWTLQGSTDGETWETVDERSGAEFAErf 192 3455556669********999*****74467******************7334556********************997654433345 PP CBM32.hmm 89 teti.tfd.kpvtaryvRltvtkra 111 +++i +++ ++++ +++Rl vt++ XDS65795.1|CBM32|GH92 193 EQQIfELAeTTAPYTWYRLDVTQNG 217 4566699865556799999997743 PP == domain 2 score: -2.8 bits; conditional E-value: 0.44 CBM32.hmm 36 qw..ltvdLgkp...ttvdkvvlt 54 qw + vdL ++ +t+d+v l XDS65795.1|CBM32|GH92 360 QWnsVRVDLPRAargKTIDQVLLG 383 222266666644222355555555 PP == domain 3 score: -1.9 bits; conditional E-value: 0.23 CBM32.hmm 10 sssaaggggaenavDgd...pntrWssa 34 ++++++ ++ + +vDg+ +n +W ++ XDS65795.1|CBM32|GH92 734 GAATDT-ETNAEIVDGKiyvNNGFWDTY 760 444455.889999***854334589885 PP == domain 4 score: 32.6 bits; conditional E-value: 5.1e-12 CBM32.hmm 13 aaggggaenavDgdpn..trWssagqwltvdLg.kpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt..te 90 +g+ + + +vD+ + t +++++ ++t d ++ tv +++lt + + ++ +++e+S+Dg+tWt+++e+++++ + XDS65795.1|CBM32|GH92 1199 GDGDTPSAGLVDNTSDsrTTFATGTPTVTWDGSgTAATVGTYTLTS-GvtGtAAPSAWRLEGSDDGETWTVLDERAGEE-FRwaLQ 1282 4566778889999655235566642569999874779********5.3444599******************9987654.334424 PP CBM32.hmm 91 titfd..kpvtaryvRltvtkratnawgasiaEl 122 t+tf+ +p +Rl+vt++a + s+aEl XDS65795.1|CBM32|GH92 1283 TRTFQveDPEAYGQLRLVVTASAG-EGDLSLAEL 1315 556666466545*******66543.333888887 PP == domain 5 score: -1.3 bits; conditional E-value: 0.16 CBM32.hmm 11 ssaaggggaenavDgdpntrWss..............ag.....qwltvdLgkpttvdkvvltw.a 56 ++aa+ g+ae a g t W++ +g ++t d+g+ t+ + +l + a XDS65795.1|CBM32|GH92 1343 NEAAA-GEAEDAATG--ITVWAApfcadgdsalrvlvDGaegasVQVTSDFGSKTQRGSGELVFeA 1405 22223.445555555..5899886665554444443300334443578888887776666666652 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1442 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 80.16 // Query: XJY99055.1|CBM0|CBM32|GH92 [L=1295] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-28 85.0 8.9 3e-22 65.6 1.2 3.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.6 1.2 3e-22 3e-22 7 111 .. 96 207 .. 90 220 .. 0.75 2 ? -1.7 0.2 0.2 0.2 17 47 .. 734 768 .. 724 826 .. 0.56 3 ! 22.6 0.1 6e-09 6e-09 21 106 .. 1191 1281 .. 1186 1292 .. 0.65 Alignments for each domain: == domain 1 score: 65.6 bits; conditional E-value: 3e-22 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a s+++a++g+ aen+vDg ++++W + w+++dL++p +v ++ lt a+ ++++d+++ +S Dgk+W++++e++++ XJY99055.1|CBM0|CBM32|GH92 96 A-SGENAGSGEVAENLVDGEATSKWLTFAtsGWVEFDLKEPAEVVTYALTSANdhApRDPRDWTLKGSADGKEWKVLDERKGE 177 3.4666777799*******999*****63367******************7334547********************998766 PP CBM32.hmm 85 td.gtteti..tfdkpvta.ryvRltvtkra 111 g ++t+ +f+++ ta r++Rl vt+++ XJY99055.1|CBM0|CBM32|GH92 178 AFdGRHKTKkyDFANA-TAyRHYRLDVTANN 207 6556654440366655.555*******5533 PP == domain 2 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 17 ggaenavDgdp...ntrWssag.qwltvdLgkptt 47 ++ +++v g+p n +W ++ +w + L +p++ XJY99055.1|CBM0|CBM32|GH92 734 HTGAKIVEGKPyvnNGFWDTYRtTWPAYSLLTPKK 768 55666666653221235655423344444433333 PP == domain 3 score: 22.6 bits; conditional E-value: 6e-09 CBM32.hmm 21 navDgdpntrWssa.gqwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gttetitfd. 95 +++D++ t s+ g +++ gk+t+ +++lt + + ++ + +e+S Dg tW+ ++e+++++ +++t+ f+ XJY99055.1|CBM0|CBM32|GH92 1191 ALFDDSSATAATSEpG-AVELPVGKATKAVQYTLTS-StdRaKAPRGWVLEGSADGRTWKRLDERSGESFaWDQQTRVFTv 1269 5788866666555433.4666666666666666663.2355699******************9987655433344444443 PP CBM32.hmm 96 .kpvtaryvRlt 106 p t ++Rl+ XJY99055.1|CBM0|CBM32|GH92 1270 aRPGTYGHYRLV 1281 366666666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1295 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 144.08 // Query: BGA75584.1|CBM32|GH92 [L=1430] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-30 90.3 12.8 6.1e-22 64.6 1.2 3.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.6 1.2 6.1e-22 6.1e-22 4 121 .. 86 209 .. 82 212 .. 0.75 2 ? 1.2 0.2 0.025 0.025 10 40 .. 716 750 .. 708 786 .. 0.68 3 ! 30.0 0.7 3.2e-11 3.2e-11 18 123 .. 1178 1285 .. 1170 1286 .. 0.74 Alignments for each domain: == domain 1 score: 64.6 bits; conditional E-value: 6.1e-22 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd 86 ++s ++s++++++g +n+vDg+++t+W +++ +v L +pt+++++ l + ++++d+++++S Dg+ Wt+++++++++ BGA75584.1|CBM32|GH92 86 ETS--ANSENTPNEGVSNLVDGSTDTKWLAWTpnGFAQVVLSEPTSITRYALSSaNDfDnRDPQDWTLQGSADGQAWTDLDKQTGQKF 171 334..46666777*****************8545569****************7522535********************99887664 PP CBM32.hmm 87 gt..te.titfdkpvta.ryvRltvtkratnawgasiaE 121 ++ + + +++++ a +++Rl++tk++ ++ ++++E BGA75584.1|CBM32|GH92 172 SErfQAkEYRLPAASAAyKFFRLNITKNNGGDI-MQLSE 209 334633366888444455*******77554343.56666 PP == domain 2 score: 1.2 bits; conditional E-value: 0.025 CBM32.hmm 10 sssaaggggaenavDgd...pntrWssag.qwltv 40 + +++++++ +++vDg +n +W ++ w + BGA75584.1|CBM32|GH92 716 TGQDTPTQTGAKLVDGEfyvNNGFWDTYRtVWSAY 750 4445556999******7654445777752234444 PP == domain 3 score: 30.0 bits; conditional E-value: 3.2e-11 CBM32.hmm 18 gaenavDgdpntrWssag.qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt.tetitfd..kp 97 g ++ +D+ +t +++ +++ ++++ ++ ++ + g++k++ + +S DgktW ++++++++ + ++t+ f+ +p BGA75584.1|CBM32|GH92 1178 GDAAFFDNTSRT--EAKVkAPIQYQVPSTKEAGSFYTLTSGkGaGDAKSWVLKGSYDGKTWAVADARTDQAFPWrQQTRAFKiaNP 1261 567788984445..44322249*******999999777433447******************999998876533345668887799 PP CBM32.hmm 98 vtaryvRltvtkratnawgasiaEla 123 + y+Rl+vt+ t+ as++E++ BGA75584.1|CBM32|GH92 1262 AHYAYYRLEVTA--TTGGEASLSEFE 1285 999*******55..333348999985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1430 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 167.30 // Query: XTR41169.1|CBM0|CBM32|GH92 [L=1274] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-31 95.3 8.8 4.8e-23 68.2 2.7 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.2 2.7 4.8e-23 4.8e-23 9 119 .. 99 217 .. 92 222 .. 0.77 2 ? -1.7 0.0 0.21 0.21 59 78 .. 1097 1117 .. 1077 1133 .. 0.74 3 ! 28.0 0.1 1.3e-10 1.3e-10 49 119 .. 1196 1267 .. 1171 1272 .. 0.75 Alignments for each domain: == domain 1 score: 68.2 bits; conditional E-value: 4.8e-23 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd 86 s ++a+gg++ en++Dg +++W + + w+++dL++p +v+++ lt a+ +++kd+++ +S Dgk+Wtt+++++++ XTR41169.1|CBM0|CBM32|GH92 99 SDENAGGGETKENLLDGESTSKWLAFTptAWVEYDLDEPAKVTQYALTSANdhAeRDPKDWTLKGSADGKEWTTLDSRSGEAF 181 3456677799*******9899****86679******************7334546********************99876554 PP CBM32.hmm 87 gt..te.titfdkpvtaryvRltvtkra.tnawgasi 119 ++ ++ t +++kp++ y+R+++tk++ + + ++++ XTR41169.1|CBM0|CBM32|GH92 182 DKrfQTkTYKLEKPAEFAYFRVEFTKNNgA-SDATQL 217 334633366888************886532.233455 PP == domain 2 score: -1.7 bits; conditional E-value: 0.21 CBM32.hmm 59 grikdykvevS.tDgktWttv 78 + +k++ v++ +gktW + XTR41169.1|CBM0|CBM32|GH92 1097 NSAKNIYVQGVkVNGKTWSKT 1117 567888888765899999865 PP == domain 3 score: 28.0 bits; conditional E-value: 1.3e-10 CBM32.hmm 49 dkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt.tetitfd..kpvtaryvRltvtkratnawgasi 119 ++v++t + + + +k+e+S Dg++W+tv+e+++++ g ++t+ f+ +p + +++Rl++t+ a a + XTR41169.1|CBM0|CBM32|GH92 1196 KAVQYTLtSDdKaKAPAGWKLEASADGTSWKTVDERSGESFGWnKQTRAFSvaSPGSYKHYRLVFTGGA-----ATV 1267 567777653345689******************9987544433235667777799999*******6633.....334 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1274 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 169.11 // Query: XPG74564.1|CBM32|GH92 [L=987] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-14 41.1 8.8 2.2e-14 40.2 4.8 2.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.2 0.1 0.025 0.025 89 112 .. 201 222 .. 117 252 .. 0.71 2 ! 40.2 4.8 2.2e-14 2.2e-14 11 121 .. 864 981 .. 858 985 .. 0.70 Alignments for each domain: == domain 1 score: 1.2 bits; conditional E-value: 0.025 CBM32.hmm 89 tetitfdkpvt.aryvRltvtkrat 112 +++it + + a y+R+tv ++at XPG74564.1|CBM32|GH92 201 KTEITPT---DhAAYFRFTVPASAT 222 2244333...327999999955332 PP == domain 2 score: 40.2 bits; conditional E-value: 2.2e-14 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag..qwltvdLg..kpttvdkvvltwae...n.grikdykvevStDgktWttvaekgnttdgt.. 88 ss+++ g+ n+ D d +t W+sa+ w++ d +p +v ++ ++ +++k++k+ +S+Dg tW+t++e+ n++ + XPG74564.1|CBM32|GH92 864 SSSTT-GQSGNLYDRDSDTAWQSASanAWIEADAAagQPASVPRIYTLTSGtqgAdQDPKSWKLKASKDGATWVTLDERRNESF-Qwr 949 22233.6899*************866889999876226667777755543244447*********************9887653.343 PP CBM32.hmm 89 tetitfd.kpvtaryvRltvtkratnawgasiaE 121 ++t++f+ k+ t y R++++ ++t+++++ +E XPG74564.1|CBM32|GH92 950 QQTRPFAlKAGTESYSRYRIEFDNTGTMTV--SE 981 458899997777777777773344544534..33 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (987 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.27 // Query: WWQ67229.1|CBM32|GH92 [L=1287] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-34 103.5 10.2 2.8e-25 75.4 3.2 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.4 3.2 2.8e-25 2.8e-25 9 122 .. 103 224 .. 96 226 .. 0.80 2 ? -4.1 0.0 1 1 60 73 .. 668 681 .. 654 688 .. 0.69 3 ! 30.5 0.1 2.3e-11 2.3e-11 49 122 .. 1208 1283 .. 1174 1285 .. 0.70 Alignments for each domain: == domain 1 score: 75.4 bits; conditional E-value: 2.8e-25 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt..t 89 s+++++gg+ a+n+vDg ++t+W + + w+++dL++p +++k+ lt a+ +++kd+++ +S Dgk+Wtt+++++++t g+ + WWQ67229.1|CBM32|GH92 103 SGENSGGGEVAANLVDGEATTKWLAFTptAWVEYDLDEPVKITKYALTSANdhDeRDPKDWTLKGSADGKDWTTLDTRSGETFGErfQ 190 4666777799***************86679******************7334546*********************988766655463 PP CBM32.hmm 90 e.titfdkpvtaryvRltvtkra.tnawgasiaEl 122 t ++++p++ r++R+++tk++ +n ++++a + WWQ67229.1|CBM32|GH92 191 AkTYDLQTPAEYRHFRIEFTKNNgAN-DATQLADF 224 33668889999********8877544.34777766 PP == domain 2 score: -4.1 bits; conditional E-value: 1 CBM32.hmm 60 rikdykvevStDgk 73 +k+++ve+ tD++ WWQ67229.1|CBM32|GH92 668 LMKKVEVEGATDDQ 681 47888999988864 PP == domain 3 score: 30.5 bits; conditional E-value: 2.3e-11 CBM32.hmm 49 dkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 ++v++t + + + +k+e+S+Dg++W+tv+++++++ + ++t+ f+ +p t +++Rl++ ++ +a +aE+ WWQ67229.1|CBM32|GH92 1208 KAVQYTLtSDdRaKAPAGWKLEASNDGTSWKTVDARSGESF-SwdKQTRAFSvsAPGTYQHYRLVFA----GTEPATLAEV 1283 5666776533445899*****************98876443.33345667777699999*******3....3334666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1287 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 172.11 // Query: WZP01264.1|CBM32 [L=3057] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-44 136.8 45.8 2.8e-20 59.2 5.4 5.2 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.2 5.4 2.8e-20 2.8e-20 9 112 .. 1593 1712 .. 1588 1730 .. 0.75 2 ! 50.6 8.0 1.3e-17 1.3e-17 6 113 .. 1741 1858 .. 1733 1869 .. 0.75 3 ! 46.1 3.2 3.3e-16 3.3e-16 9 111 .. 1888 2002 .. 1882 2031 .. 0.76 4 ? -2.6 5.5 0.39 0.39 17 81 .. 2569 2639 .. 2506 2711 .. 0.68 Alignments for each domain: == domain 1 score: 59.2 bits; conditional E-value: 2.8e-20 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLg..kpttvdkvvltw...ae..n.grikdykvevStDgktWttvaekg.nttd.g 87 s+s+aa+g g+++a+D dp t W+s+ w+++ L ++++v+++++t a + +++kd+ + +S Dg+tWttv++++ + + WZP01264.1|CBM32 1593 SASTAAAGKGPDAAFDADPATAWASTAaaAWVQIQLAgnAAQRVTTYSVTAaadAAtyPgRTPKDWALKGSADGTTWTTVDTRTgQAAAlN 1683 345556669****************85588******954559********8754225657*********************9883444444 PP CBM32.hmm 88 t...te.titfdkpvtaryvRltvtkrat 112 t t+ + +++p + ry+Rl vt+++ WZP01264.1|CBM32 1684 TgsgTTlSYAVTTPGSYRYYRLDVTANNG 1712 46432333344488899*******66442 PP == domain 2 score: 50.6 bits; conditional E-value: 1.3e-17 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag.qwltvdLg..kpttvdkvvltw..ae...n.grikdykvevStDgktWttvaekgnttd. 86 sa ss+ +a+ +ga a+D ++t W s++ wl++ +g +++ v++++lt ++ + + +kd+++++S Dg +W t+++++n + WZP01264.1|CBM32 1741 SA-SSTPSAT-QGAGVAFDQTTGTTWLSGTtPWLQYQFGngEAYAVTQYQLTSgsDTftyQgRAPKDWQLQGSVDGVSWATLDSRTNAAVt 1829 22.2333444.89*******999*****9779******98678*********8752256668*********************99865554 PP CBM32.hmm 87 gt.te.titfdkpvtaryvRltvtkratn 113 + t+ t t+++p r++Rl+vt+++ + WZP01264.1|CBM32 1830 ANsTTtTYTVASPGVYRFYRLNVTANNGD 1858 4433324466688878*******665432 PP == domain 3 score: 46.1 bits; conditional E-value: 3.3e-16 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag.qw..ltvdLgkpttvdkvvltw..ae...n.grikdykvevStDgktWttvaekgnttd.gt. 88 +ss+ ++++ga+ a+D d+nt W +++ w l++ g+++tv+++++t ++ + + +k++++++S+Dg W t++++ n+ d WZP01264.1|CBM32 1888 ASSTPSPTQGAATAFDQDTNTTWLADTtPWvrLQFAGGAAYTVTEYRFTSgfDTptyPgRAPKSWQLQGSNDGLVWSTLDTRINQADaAGl 1978 3444556699***************8666644788889***********76632555579********************98888764447 PP CBM32.hmm 89 te.titfdkpvtaryvRltvtkra 111 + + t+++p + + +Rl+v +++ WZP01264.1|CBM32 1979 HAtSYTVATPGSYKNYRLYVPTNN 2002 5425588888999*******3322 PP == domain 4 score: -2.6 bits; conditional E-value: 0.39 CBM32.hmm 17 ggaenavDgdpntrWssag....qwltvdLgkpttvdkvvltw.ae...n.grikdykvevStDgktWttvaek 81 g ++++D++ +t +s+g +++ +d +++++ ++ ++ ++++ y++e+ +t+++ WZP01264.1|CBM32 2569 VGYAYTNDDQLTTVTHSNGsfagESFGFDSNGNRNTGSYATGTgNRtssDgTYTYGYDLEGNLTS---KTLDAN 2639 34556666666788888634567778888888888888888875324443588888888877655...334322 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (3057 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 159.15 // Query: XPG88179.1|CBM32|GH92 [L=994] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-13 38.0 6.7 2.8e-13 36.6 5.1 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.0 0.3 0.3 91 109 .. 216 232 .. 194 261 .. 0.67 2 ! 36.6 5.1 2.8e-13 2.8e-13 11 122 .. 871 989 .. 865 991 .. 0.69 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.3 CBM32.hmm 91 titfdkpvt.aryvRltvtk 109 +it + + a y+R+t+ + XPG88179.1|CBM32|GH92 216 EITPT---DhAAYFRFTAPA 232 33333...227999999933 PP == domain 2 score: 36.6 bits; conditional E-value: 2.8e-13 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag..qwltvdLg..kpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekgnttdgt.. 88 ss+a+ g+ +n+ D + +t W s++ w++ d +p +v k+ ++ ++++++k+ +S+Dg W+t++e++n++ t XPG88179.1|CBM32|GH92 871 SSSAT-GQLANVYDRNSDTAWRSTSanAWIEADAAtgQPASVPKIYTLTsGTqdAgQDPRSWKLKASKDGVAWVTLDERSNES-FTwr 956 34455.79***************86689*999987336677777755544224437*********************998865.5554 PP CBM32.hmm 89 tetitfd...kpvtaryvRltvtkratnawgasiaEl 122 ++t++f+ + + ++R+++ ++t++ + +aE+ XPG88179.1|CBM32|GH92 957 QQTRPFAlkaGAESYSKYRIEF--DNTGT--MTVAEF 989 4577888844333356666666..43433..456666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (994 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 125.38 // Query: XOA45075.1|CBM32|GH92 [L=1290] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-24 73.0 8.0 2.4e-19 56.2 0.6 3.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.2 0.6 2.4e-19 2.4e-19 4 122 .. 101 225 .. 98 228 .. 0.73 2 ? -0.8 0.1 0.11 0.11 13 37 .. 724 752 .. 718 784 .. 0.69 3 ! 19.3 0.1 6.6e-08 6.6e-08 42 106 .. 1200 1268 .. 1167 1283 .. 0.65 Alignments for each domain: == domain 1 score: 56.2 bits; conditional E-value: 2.4e-19 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd 86 a a+ ++++++g+ en++Dg t+W wl++ L +p ++ lt a+ + ++++d+++ +S+Dgk+Wt +++++++t XOA45075.1|CBM32|GH92 101 AVRAS-GENTEAGEVKENLIDGESATKWLVFArtAWLEFQLSEPVAAVRYALTSANdaPaRDPRDWTFLGSDDGKSWTALDTREDETF 187 44554.555566699*******999****974578*********8888888886335557*********************9987665 PP CBM32.hmm 87 .gtte..titfdkpvtaryvRltvtkratnawgasiaEl 122 ++ ++ f+ + + r +Rl++t ++ ++ +++aE+ XOA45075.1|CBM32|GH92 188 eRRQQtrEFAFEPDHPYRQYRLEITRNN-GDAITQLAEV 225 34333124455555567*******5533.2344778876 PP == domain 2 score: -0.8 bits; conditional E-value: 0.11 CBM32.hmm 13 aaggggaenavDgd...pntrWssag.qw 37 ++++ + +++vDg +n +W ++ w XOA45075.1|CBM32|GH92 724 NTPTRTGAKIVDGEvyvNNGFWDTYRtAW 752 44558899*****8553345998853345 PP == domain 3 score: 19.3 bits; conditional E-value: 6.6e-08 CBM32.hmm 42 Lgkpttvdkvvltwae..n.grikdykvevS.tDgktWttvaekgnttdgt..tetitfd..kpvtaryvRlt 106 L+++ v++++lt + + + ++++ +e+S +Dg+tW +v+ +++++ +t+ f+ + + y R++ XOA45075.1|CBM32|GH92 1200 LDGAGPVTSYTLTS-GtdRgRAPRSWVLEGSaDDGETWAEVDRRDGESF-AwnRQTRVFQvtRA--GAYGRYR 1268 45666899999995.2344699*********888*******98765433.23223445652222..2443333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1290 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 162.44 // Query: UOX93223.1|CBM32|GH92 [L=1438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-33 100.8 19.1 1.5e-22 66.6 1.9 3.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.6 1.9 1.5e-22 1.5e-22 3 122 .. 87 213 .. 85 215 .. 0.77 2 ? 1.7 0.2 0.018 0.018 10 37 .. 716 746 .. 707 786 .. 0.67 3 ! 39.9 4.9 2.7e-14 2.7e-14 12 123 .. 1180 1293 .. 1176 1294 .. 0.78 Alignments for each domain: == domain 1 score: 66.6 bits; conditional E-value: 1.5e-22 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgntt 85 t+ssa+ s++++gg+ +n++Dg ++t+W s++ w ++ L +pt+++++ l + +++kd+++++S+D tWt++++++++ UOX93223.1|CBM32|GH92 87 TESSAS-SENTSGGEVVSNLFDGTTDTKWLSWDptAWAQLSLSEPTSITHYALSSaNDfDnRDPKDWTLQGSNDALTWTDLDKQADQA 173 666765.66666669****************96689******************7522535********************9888866 PP CBM32.hmm 86 dgt...te.titfdkpvta.ryvRltvtkratnawgasiaEl 122 t ++ + t+++p a +++Rl+vt ++ + + +++El UOX93223.1|CBM32|GH92 174 F-TarfQQkDYTLAAPSAAfKFFRLNVTRNN-GGPILQLSEL 213 4.334733366777666667*******5532.2344666665 PP == domain 2 score: 1.7 bits; conditional E-value: 0.018 CBM32.hmm 10 sssaaggggaenavDgdp..nt.rWssag.qw 37 +++ +++++ +++vDg++ n+ +W ++ +w UOX93223.1|CBM32|GH92 716 GAD-TPTQTGSKIVDGQTyvNNgFWDTYRtTW 746 334.444899******6422223788853334 PP == domain 3 score: 39.9 bits; conditional E-value: 2.7e-14 CBM32.hmm 12 saaggggaenavDgdpntrWssag.qwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tet 91 +++g ++a+++vD+ ++r ++a +++ L+++ v++++lt + + g++k++++ +S DgktW ++++++n+ + ++t UOX93223.1|CBM32|GH92 1180 TSDG-SDAKALVDN--TSRTQAAVtGAVQYQLNSTdEAVTNYTLTS-QtGaGDPKSWTLKGSYDGKTWAVADQQANQA-FSwrQQT 1260 3455.89*******..44555542236******7769********4.3446******************888777765.4454456 PP CBM32.hmm 92 itfd..kpvtaryvRltvtkratnawgasiaEla 123 + f+ +p+ y++l+vt+++t+a+ a++aE++ UOX93223.1|CBM32|GH92 1261 RAFKvaNPAHYAYYKLEVTATSTGAP-AQLAEFE 1293 68887799999*******88888766.9****95 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1438 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 170.51 // Query: XRV68829.1|CBM0|CBM32|GH92 [L=1806] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-29 88.4 28.9 2.7e-22 65.7 2.1 5.6 6 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.7 2.1 2.7e-22 2.7e-22 8 112 .. 102 215 .. 97 229 .. 0.77 2 ? -2.3 0.0 0.32 0.32 61 83 .. 646 666 .. 611 683 .. 0.67 3 ! 3.0 0.2 0.0074 0.0074 5 34 .. 721 752 .. 717 769 .. 0.72 4 ? -1.5 0.0 0.17 0.17 10 32 .. 1107 1129 .. 1102 1146 .. 0.62 5 ! 33.3 4.2 3.1e-12 3.1e-12 13 122 .. 1189 1305 .. 1177 1307 .. 0.69 6 ? -1.2 0.2 0.15 0.15 22 79 .. 1669 1734 .. 1654 1767 .. 0.52 Alignments for each domain: == domain 1 score: 65.7 bits; conditional E-value: 2.7e-22 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgntt 85 ++s+++ +++ga+n+ Dg+ +t+W + w+ +++ +p ++ ++++t + +++k++++e+S+Dg+tWt+++++++++ XRV68829.1|CBM0|CBM32|GH92 102 TASAQNLPNEGAANLADGSSGTKWLAFAstGWVRYEFAEPVSFVAYSMTSgDDsAgRDPKTWTIEGSNDGSTWTPLDQRTDED 184 3344556669****************63367******************7522446*********************998876 PP CBM32.hmm 86 d.gtte..titfdkpvta.ryvRltvtkrat 112 + ++ ++++d+p++a +y+Rl+vt+++ XRV68829.1|CBM0|CBM32|GH92 185 FpNRQQtrSFELDEPTEAyTYLRLNVTANSG 215 6555432255666999999*******66442 PP == domain 2 score: -2.3 bits; conditional E-value: 0.32 CBM32.hmm 61 ikdykvevStDgktWttvaekgn 83 k+ ++ev gkt+t+v++ + XRV68829.1|CBM0|CBM32|GH92 646 RKNLDLEVT--GKTFTEVKAAAA 666 456667766..999999965433 PP == domain 3 score: 3.0 bits; conditional E-value: 0.0074 CBM32.hmm 5 ssaessssaaggggaenavDgd...pntrWssa 34 sa+++s++++ ++ +++vDg+ +n +W ++ XRV68829.1|CBM0|CBM32|GH92 721 VSATTGSATDT-QTNAKIVDGKiyvNNGFWDTY 752 57777788777.99*******954334599885 PP == domain 4 score: -1.5 bits; conditional E-value: 0.17 CBM32.hmm 10 sssaaggggaenavDgdpntrWs 32 ++s ++ + + avDg ++t s XRV68829.1|CBM0|CBM32|GH92 1107 NNSVDNVYVQSLAVDGEARTSTS 1129 34445559999*****8876433 PP == domain 5 score: 33.3 bits; conditional E-value: 3.1e-12 CBM32.hmm 13 aaggggaenavDgdpntr..WssagqwltvdLgkpt.tvdkvvltw.aen.grikdykvevStDgktWttvaekgnttdgt 88 +++ +a++++D+ +tr +++a+ ++t ++ + tv +++lt a++ ++ +++e+S+Dg+tWtt++e+++++ XRV68829.1|CBM0|CBM32|GH92 1189 GDATTSAAALTDNTSGTRttFATATPSITWAGNGIRpTVGSYTLTSgASGtASPSAWTLEGSDDGETWTTLDERSGEQ-FR 1268 34447899999998766511444324577777777569*******65224599******************9987644.33 PP CBM32.hmm 89 ..tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 +t++f+ +p+ +R+tvt++a + + s+aE+ XRV68829.1|CBM0|CBM32|GH92 1269 waLQTRPFTvaEPTAFARYRVTVTATAG-SGALSLAEV 1305 3334668887677655888999966552.345899997 PP == domain 6 score: -1.2 bits; conditional E-value: 0.15 CBM32.hmm 22 avDgdpn..trWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevSt...DgktWttva 79 ++Dg+ + +++ag +++vd g + +v +v +t ++ + + ++v vSt gk ++ v XRV68829.1|CBM0|CBM32|GH92 1669 VTDGSVTgaHAYAAAGtytAYVVVDDGWTSQVVEVPVTVtEG-QPTLAIDVTVSTrclAGKAYVAVR 1734 455533211122222123445666666666666666664322.334444444444222466666553 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1806 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 164.88 // Query: WZO58469.1|CBM32|GH92 [L=2006] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-28 86.3 25.2 5e-22 64.9 1.4 6.0 6 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.9 1.4 5e-22 5e-22 7 109 .. 82 193 .. 77 213 .. 0.76 2 ! 2.7 0.4 0.0089 0.0089 15 66 .. 320 374 .. 306 392 .. 0.64 3 ? 1.1 0.1 0.027 0.027 7 34 .. 712 741 .. 706 760 .. 0.69 4 ! 30.0 1.0 3.2e-11 3.2e-11 15 122 .. 1169 1280 .. 1165 1282 .. 0.68 5 ? -0.5 0.1 0.085 0.085 36 67 .. 1325 1353 .. 1302 1387 .. 0.73 6 ? -2.8 0.0 0.46 0.46 38 72 .. 1628 1669 .. 1611 1698 .. 0.73 Alignments for each domain: == domain 1 score: 64.9 bits; conditional E-value: 5e-22 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gt 88 ++s+++++++ga+n+ Dg+++t+W + + w+++ L +p+ + +++lt + + +++kd++v++S++g++W tv++++++ g WZO58469.1|CBM32|GH92 82 VTASAQNTPNEGAANVADGNAGTKWLAFQntGWVQYQLSTPQPMVRYTLTSgGDaQeRDPKDFRVQGSNNGTDWDTVDQRSGELFtGR 169 34455566779****************74467******************7522567********************98766443344 PP CBM32.hmm 89 .tetitfd..kpvta.ryvRltvtk 109 + t++f+ +p +a +y+Rl v++ WZO58469.1|CBM32|GH92 170 gE-TRSFTlaTPSPAyTYYRLDVQA 193 32.4455544888888*****9943 PP == domain 2 score: 2.7 bits; conditional E-value: 0.0089 CBM32.hmm 15 ggggaenavDgdpntrWssagqw..ltvdLg..kpttvdkvvltw.aen.grikdykv 66 g++a++ g+ n+ W ++ w +tvdLg + +tvd v +t+ + + ++++ ++v WZO58469.1|CBM32|GH92 320 YGYAANAKAKGQSNSLWPNQ--WnrVTVDLGqfAGRTVDDVLFTYdH-PgSDVHAVEV 374 33444444456666777664..444******65569**999999642.2255555555 PP == domain 3 score: 1.1 bits; conditional E-value: 0.027 CBM32.hmm 7 aessssaaggggaenavDgd...pntrWssa 34 +++s++++ ++ +++vDg+ +n +W ++ WZO58469.1|CBM32|GH92 712 PTTGSATDT-QTNAKIVDGKiyvNNGFWDTY 741 455666666.899******954334599985 PP == domain 4 score: 30.0 bits; conditional E-value: 3.2e-11 CBM32.hmm 15 ggggaenavDgdpn..trWssagqwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttd.gttetitf 94 g + ++vD++ n t ++ a+ +l+ + +p ++ +++lt + + + ++++++++StDg +Wt++++++++t +t+t++f WZO58469.1|CBM32|GH92 1169 DGTPVGALVDDNMNskTTFAGATAELVWTSQsGPVSIGQYTLT-DAaKgSAPSSWTLSGSTDGVNWTELDSRTGETFaWDTQTRPF 1253 4478999****99844444443234666666599*********.546579********************9987654343468899 PP CBM32.hmm 95 dkpvta..ryvRltvtkratnawgasiaEl 122 +++ ++ + ++l t+ ++ + s++E+ WZO58469.1|CBM32|GH92 1254 TANGEGgyTSIKLSLTG--AG-DALSLSEV 1280 96666512555555522..22.33666665 PP == domain 5 score: -0.5 bits; conditional E-value: 0.085 CBM32.hmm 36 qwltvdLgkpttvdkvvltwaengrikdykve 67 ++tvd+g t v +v+lt + ++ +kv+ WZO58469.1|CBM32|GH92 1325 YTVTVDYGDGTPVPSVKLT--R-DDLGGWKVS 1353 469**************99..4.555555554 PP == domain 6 score: -2.8 bits; conditional E-value: 0.46 CBM32.hmm 38 ltvdLgkpttvdkvvltw...ae..n.grikdykvevS.tDg 72 +v+ g v++v + + + + +y+v v +Dg WZO58469.1|CBM32|GH92 1628 AVVNWGDGSPVSTVDVASgavTGthTyAAAGTYTVTVTaDDG 1669 677788888888888886533113335666677777773444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (2006 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 168.55 // Query: WKU47537.1|CBM32|GH92 [L=1274] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-26 77.9 2.5 9.4e-21 60.8 0.6 3.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.8 0.6 9.4e-21 9.4e-21 6 122 .. 70 193 .. 65 195 .. 0.75 2 ! 15.5 0.1 1e-06 1e-06 47 106 .. 1190 1254 .. 1170 1267 .. 0.75 Alignments for each domain: == domain 1 score: 60.8 bits; conditional E-value: 9.4e-21 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdg 87 a s+++a++g+ en+vDg +t+W + + wl++dL +p t ++ lt a+ + ++++d+ +++S+Dg +Wt++++++++t + WKU47537.1|CBM32|GH92 70 RA-SGENAGSGEVKENLVDGESTTKWLTFEksgAWLEFDLAEPVTAVRYALTSANdaPgRDPRDWVLQGSQDGRSWTPLDTRKGETFD 156 44.4666777799*******999*****744589*********9999999996334557********************997765543 PP CBM32.hmm 88 t...tetitfdkpvtaryvRltvtkratnawgasiaEl 122 + t++++f+++++ ++Rl t ++ ++ +++aE+ WKU47537.1|CBM32|GH92 157 KrfqTREFSFANTTPYGHYRLDLTRNSGEDI-TQLAEV 193 3353336677777778*****9966553333.677776 PP == domain 2 score: 15.5 bits; conditional E-value: 1e-06 CBM32.hmm 47 tvdkvvltwae.n.grikdykvevStDgk.tWttvaekgnttd.gttetitfd..kpvtaryvRlt 106 +v++++lt + + + +e+S+Dg+ +W++v+ ++++ + +t+ f+ p r++Rl+ WKU47537.1|CBM32|GH92 1190 RVTSYTLTS-AdRaKAPGGWVLEGSQDGTgEWQEVDRRTDEAFaWDRQTRVFSvaRPGAYRHYRLR 1254 678888884.23458899*********9879****9998765433333445553366656999997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1274 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 175.59 // Query: UUU25540.1|CBM0|CBM32|GH92 [L=1264] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-32 98.3 16.2 3.3e-24 71.9 1.0 4.0 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.9 1.0 3.3e-24 3.3e-24 9 115 .. 92 207 .. 85 216 .. 0.76 2 ? 1.2 0.8 0.026 0.026 14 46 .. 710 746 .. 702 835 .. 0.81 3 ? -4.0 0.0 1 1 60 77 .. 1090 1108 .. 1082 1110 .. 0.74 4 ! 33.9 0.3 1.9e-12 1.9e-12 20 117 .. 1162 1255 .. 1145 1262 .. 0.71 Alignments for each domain: == domain 1 score: 71.9 bits; conditional E-value: 3.3e-24 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd 86 s+++++gg+ en+vDg p+t+W + + w+++dL+kp +v ++ lt a+ + +++kd+++++S+Dgk+W++++++++++ UUU25540.1|CBM0|CBM32|GH92 92 SGENTGGGEVKENLVDGEPGTKWLTFQptGWVEFDLDKPAKVVTYALTSANdfEtRDPKDWTLQGSSDGKEWKVLDTRSGESF 174 5667788899***************75567******************7334657********************99876544 PP CBM32.hmm 87 gt...tetitfd.kpvtaryvRltvtkratnaw 115 + t++ +++ ++++ ry+Rl +tk++ ++ UUU25540.1|CBM0|CBM32|GH92 175 EErfrTKSYDIPgDAAEYRYFRLDITKNNGASM 207 223533333444667889*******77442223 PP == domain 2 score: 1.2 bits; conditional E-value: 0.026 CBM32.hmm 14 aggggaenavDgd...pntrWssag.qwltvdLgkpt 46 +++++ +++vDg+ +n +W ++ +w + L +p+ UUU25540.1|CBM0|CBM32|GH92 710 TPTHTGAKIVDGKvyvNNGFWDTYRtTWPAYSLLTPR 746 45599999****8553346999964456555555554 PP == domain 3 score: -4.0 bits; conditional E-value: 1 CBM32.hmm 60 rikdykvevS.tDgktWtt 77 +k++ v++ +gk+Wt UUU25540.1|CBM0|CBM32|GH92 1090 SAKNVYVQGLkVNGKSWTS 1108 5677778877679999985 PP == domain 4 score: 33.9 bits; conditional E-value: 1.9e-12 CBM32.hmm 20 enavDgdpntrWssagqwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd 95 ++D+ +t s tv L +p ++v++t ++ + ++ +++++S Dg+tW+t++++++++ t +t+ f+ UUU25540.1|CBM0|CBM32|GH92 1162 GELFDNTSSTTA-S-V--TTVPLPTPAPAKAVQYTLtSSdPtEAPTGWTLQASADGTTWKTLDKRSGEP-FTwdRQTRAFS 1237 456777333332.2.2..69***************974444699******************9887655.44433455777 PP CBM32.hmm 96 ..kpvta.ryvRltvtkratnawga 117 +p +a r+ Rl+ ++ a UUU25540.1|CBM0|CBM32|GH92 1238 vpAP-KAyRHHRLVLDDT------A 1255 5344.355*****99332......3 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1264 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.50 // Query: XSC37379.1|CBM32|GH92 [L=1069] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-15 41.4 3.3 9.3e-15 41.4 3.3 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.1 0.5 0.5 70 84 .. 398 412 .. 382 450 .. 0.58 2 ! 41.4 3.3 9.3e-15 9.3e-15 12 121 .. 948 1064 .. 939 1067 .. 0.71 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.5 CBM32.hmm 70 tDgktWttvaekgnt 84 t g+ W+ +a+++n+ XSC37379.1|CBM32|GH92 398 TGGTGWVRFATTANQ 412 344455555444332 PP == domain 2 score: 41.4 bits; conditional E-value: 9.3e-15 CBM32.hmm 12 saaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt.tet 91 ++++g++ ++++D+ t+W + +lt L ++ v++++lt + + ++++++++++S+Dg tWttv+++++ + g+ et XSC37379.1|CBM32|GH92 948 ENGAGEARDKLTDDTSLTKWLTFAatATLTDQLTGAAAVRQYTLTSaDDfPaRDPRSWTLQGSDDGVTWTTVDSRSDVDFGDrRET 1033 344448899****95559****634567*****************75236579********************9987655664345 PP CBM32.hmm 92 itfd..kpvtaryvRltvtkratnawgasiaE 121 + f ++ +Rl++t+++ +a +++aE XSC37379.1|CBM32|GH92 1034 RAFVvsGGASYSRYRLQITANH-GAAETQLAE 1064 5777443344566666664432.233456665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1069 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 134.90 // Query: XDK56862.1|CBM32|GH92 [L=1237] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-10 27.6 0.0 7.4e-10 25.6 0.0 2.0 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.6 0.0 7.4e-10 7.4e-10 13 107 .. 1023 1124 .. 1017 1143 .. 0.69 Alignments for each domain: == domain 1 score: 25.6 bits; conditional E-value: 7.4e-10 CBM32.hmm 13 aaggggaenavDgdpntrWssag..qwltvdLg.kpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.te. 90 ++ g+a na+D++ t + ++ w++++++ + ++ ++lt + + +++k++ + +S+Dg++W++++ k+ + + XDK56862.1|CBM32|GH92 1023 SDY-GPALNAFDNNSLTQLKMNHnkPWIQYEFEdGKKEALLYTLTS-GleEnQDPKSWVLLGSNDGEDWEVLDRKEHVH-FKwRRy 1105 444.8899*****8778776664578*******6667777777774.344349*******************9775533.443232 PP CBM32.hmm 91 titfd..kpvtaryvRltv 107 t+ f +p ++R++ XDK56862.1|CBM32|GH92 1106 TKAFIieNPGAFSHYRFEL 1124 3355454555448888777 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1237 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 187.48 // Query: WWR50528.1|CBM32|GH92 [L=1292] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-23 67.4 7.7 8.6e-17 48.0 1.8 3.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 48.0 1.8 8.6e-17 8.6e-17 11 112 .. 100 212 .. 95 223 .. 0.75 2 ? -1.1 0.1 0.13 0.13 14 35 .. 717 741 .. 709 776 .. 0.73 3 ! 20.8 0.0 2.2e-08 2.2e-08 42 104 .. 1191 1259 .. 1169 1273 .. 0.66 Alignments for each domain: == domain 1 score: 48.0 bits; conditional E-value: 8.6e-17 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt....t 89 ++ ++g+ en+vD +p t+W + w+++d ++p +v ++ lt a+ ++++d+++ +S+Dg +W+ +++++++ + t WWR50528.1|CBM32|GH92 100 ENGGAGEVKENLVDLQPATKWLGFQssAWIEFDTDTPVKVVRYALTSANdfAaRDPRDWSLKGSSDGRDWKILDTRTGEAF-DqrfqT 186 44455588***************75589******************73345569*****************99*9987554.324532 PP CBM32.hmm 90 etitfd.kpvta.ryvRltvtkra.t 112 +t ++d +++ta ++Rl++t+++ + WWR50528.1|CBM32|GH92 187 RTYDIDaAATTAyAHYRLEITANNgA 212 3556667677788*******664422 PP == domain 2 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 14 aggggaenavDgd...pntrWssag 35 +++ + +++vDg +n +W ++ WWR50528.1|CBM32|GH92 717 TPTRTGAKLVDGRvyvNNGFWDTYR 741 3447899*****7443345888853 PP == domain 3 score: 20.8 bits; conditional E-value: 2.2e-08 CBM32.hmm 42 Lgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd..kpvtaryvR 104 L + ++v++t ++ + + + + +++S Dg+tWt+v+ +++++ + +t+ f+ p t +R WWR50528.1|CBM32|GH92 1191 LPVAAGTRAVQYTLtSSaKgTAPAGWVLQGSHDGTTWTDVDRRSGESFaWDRQTRVFTvgRPGTFERYR 1259 5555556778888763345699******************98766543233234445433555544444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1292 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 167.92 // Query: BBC32168.1|CBM0|CBM32|GH92 [L=1265] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-28 84.9 14.2 1.6e-20 60.0 1.2 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 60.0 1.2 1.6e-20 1.6e-20 7 111 .. 91 203 .. 85 217 .. 0.75 2 ? -0.2 0.5 0.072 0.072 15 37 .. 712 738 .. 708 782 .. 0.76 3 ! 31.5 0.6 1.1e-11 1.1e-11 18 121 .. 1161 1260 .. 1153 1263 .. 0.73 Alignments for each domain: == domain 1 score: 60.0 bits; conditional E-value: 1.6e-20 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a s++++++g+ en+vDg p+t+W + w ++++++p +v ++ lt a+ +++kd+++++StDg+ W+t+++++++ BBC32168.1|CBM0|CBM32|GH92 91 A-SGENTGAGEVKENLVDGEPGTKWLTFAptGWAEFEFDAPVKVVTYALTSANdaAeRDPKDWTLQGSTDGSGWQTLDTRSGQ 172 3.4555666699***************64457******************7334546*********************98765 PP CBM32.hmm 85 tdgt..tetitfd...kpvtaryvRltvtkra 111 + ++ t+++d +p + r++Rl +t+++ BBC32168.1|CBM0|CBM32|GH92 173 DFDErfR-TKSYDiggTPGEYRHFRLDITGNN 203 4333331.4455555889999*******6633 PP == domain 2 score: -0.2 bits; conditional E-value: 0.072 CBM32.hmm 15 ggggaenavDgd...pntrWssag.qw 37 ++++ +++vDg+ +n +W ++ +w BBC32168.1|CBM0|CBM32|GH92 712 PTHTGAKIVDGKvyvNNGFWDTYRtTW 738 458899999998553345898853334 PP == domain 3 score: 31.5 bits; conditional E-value: 1.1e-11 CBM32.hmm 18 gaenavDgdpntrWssagqwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetitf 94 ga ++D+ +t+ s + + + + t+v +++lt + + ++ +++++S Dg+tW+t++ +++++ t +t+ f BBC32168.1|CBM0|CBM32|GH92 1161 GAGELFDNTSSTKVSVER--IALPTSGRTKVVQYTLTS-AdRtDAPTGWTLQASADGTTWKTLDRRSGES-FTwdRQTRAF 1237 577788887778887764..777777778888888884.344599******************9876644.4443335566 PP CBM32.hmm 95 d..kpvtaryvRltvtkratnawgasiaE 121 + +p t +++Rl+ +++a +aE BBC32168.1|CBM0|CBM32|GH92 1238 SipAPGTYKHYRLVL------DNAATVAE 1260 65588899*****99......33455555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1265 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.87 // Query: XCJ73866.1|CBM0|CBM32|GH92 [L=1282] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-31 94.3 10.5 4.5e-23 68.3 2.2 3.8 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.3 2.2 4.5e-23 4.5e-23 7 120 .. 100 220 .. 94 224 .. 0.78 2 ? -3.7 0.0 0.84 0.84 38 78 .. 989 1028 .. 960 1033 .. 0.62 3 ? -1.6 0.0 0.19 0.19 59 78 .. 1105 1125 .. 1085 1142 .. 0.74 4 ! 28.9 0.1 7e-11 7e-11 49 119 .. 1204 1275 .. 1180 1280 .. 0.74 Alignments for each domain: == domain 1 score: 68.3 bits; conditional E-value: 4.5e-23 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a s+++++gg+ a+n++Dg +t+W + + w+++dL++p +++++vlt a+ +++kd+ + +S Dgk+Wtt+++++++ XCJ73866.1|CBM0|CBM32|GH92 100 A-SGENSGGGEVAANLTDGESSTKWLAFTptAWVEYDLDTPLKITNYVLTSANdhDeRDPKDWVLKGSADGKDWTTLDSRTGE 181 3.5667777799***************86679******************7334546*********************99876 PP CBM32.hmm 85 tdgt..te.titfdkpvtaryvRltvtkra.tnawgasia 120 + ++ ++ + +++kp++ ++R+++tk++ ++ ++++a XCJ73866.1|CBM0|CBM32|GH92 182 SFDKrfQTkKYELEKPAEYAHFRVEFTKNNgAG-DATQLA 220 543346442558889999********8865333.335555 PP == domain 2 score: -3.7 bits; conditional E-value: 0.84 CBM32.hmm 38 ltvdLgkpttvdkvvltwaengrikdykvevStDgktWttv 78 ++ ++ ++++v+ ++ +++ + +++++ + g+ W+t XCJ73866.1|CBM0|CBM32|GH92 989 VIHEMTEARDVRMGQYGHSN-QVAHHVTYMYDAAGQPWKTQ 1028 44555666666666666423.66777777777777777765 PP == domain 3 score: -1.6 bits; conditional E-value: 0.19 CBM32.hmm 59 grikdykvevS.tDgktWttv 78 + +k++ v++ +gktW + XCJ73866.1|CBM0|CBM32|GH92 1105 NSAKNVYVQGVkVNGKTWSKT 1125 567888888765899999865 PP == domain 4 score: 28.9 bits; conditional E-value: 7e-11 CBM32.hmm 49 dkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttetitfd..kpvtaryvRltvtkratnawgasi 119 ++v++t + + ++ +k+e+S Dg+tW+t++e+++++ +++t+ f+ kp + ++Rl++t+ a a + XCJ73866.1|CBM0|CBM32|GH92 1204 KAVQYTLtSAdKaKAPTGWKLEASADGTTWKTLDERSGESFaWDKQTRAFSvpKPGSYAHYRLVFTGGA-----ATV 1275 567777653345699******************9987655433344556665599999*******6533.....334 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1282 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 161.16 // Query: XPG81445.1|CBM32|GH92 [L=994] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-13 36.3 7.2 8.1e-13 35.1 5.3 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.0 0.27 0.27 91 109 .. 216 232 .. 194 268 .. 0.67 2 ! 35.1 5.3 8.1e-13 8.1e-13 11 122 .. 871 989 .. 865 991 .. 0.70 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.27 CBM32.hmm 91 titfdkpvt.aryvRltvtk 109 +it + + a y+R+t+ + XPG81445.1|CBM32|GH92 216 EITPT---DhAAYFRFTAPA 232 33333...227999999933 PP == domain 2 score: 35.1 bits; conditional E-value: 8.1e-13 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag..qwltvdLg..kpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekgnttdgt.. 88 ss+a+ g+ +n+ D + +t W s++ w++ d +p +v k+ ++ ++++++k+ +S+Dg W+t++e++n++ t XPG81445.1|CBM32|GH92 871 SSSAT-GQLANVYDRSSDTAWRSTSanAWIEADAAtgQPASVPKIYTLTsGTqdAgQDPRSWKLKASKDGVAWVTLDERSNES-FTwr 956 34455.79***************86689*999987336677777755544224437*********************998865.5554 PP CBM32.hmm 89 tetitfd.kpvt..aryvRltvtkratnawgasiaEl 122 ++t++f+ k+ t ++R+++ ++t++ + +aE+ XPG81445.1|CBM32|GH92 957 QQTRPFAlKAGTesYSKYRIEF--DNTGT--MTVAEF 989 4577999966662245555555..43433..456776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (994 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 137.62 // Query: UFQ18722.1|CBM0|CBM32|GH92 [L=1294] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-28 84.1 14.0 1.5e-22 66.6 1.2 3.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.6 1.2 1.5e-22 1.5e-22 7 113 .. 101 212 .. 95 225 .. 0.76 2 ? -2.3 1.0 0.32 0.32 45 48 .. 765 768 .. 723 827 .. 0.53 3 ! 25.7 0.2 6.8e-10 6.8e-10 19 106 .. 1188 1280 .. 1173 1291 .. 0.65 Alignments for each domain: == domain 1 score: 66.6 bits; conditional E-value: 1.5e-22 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a s++++++g+ aen+vDg ++++W + w+++dL++p +v ++ lt a+ +++kd+++ +S Dgk+W++++e+g++ UFQ18722.1|CBM0|CBM32|GH92 101 A-SGENTGSGEVAENLVDGEATSKWLTFArsGWVEFDLKEPAKVVTYALTSANdhApRDPKDWTLKGSADGKDWKVLDERGGE 182 3.4667777799*******999*****74467******************7334547**********************9976 PP CBM32.hmm 85 td.gtte..titfdkpvta.ryvRltvtkratn 113 g ++ + +f+++ ta r++Rl + +a+n UFQ18722.1|CBM0|CBM32|GH92 183 VFdGRHKtkKYDFTNA-TAyRHYRLDI--SANN 212 6656654223466655.555*******..4332 PP == domain 2 score: -2.3 bits; conditional E-value: 0.32 CBM32.hmm 45 pttv 48 p++ UFQ18722.1|CBM0|CBM32|GH92 765 PKKA 768 3333 PP == domain 3 score: 25.7 bits; conditional E-value: 6.8e-10 CBM32.hmm 19 aenavDgdpntrWssa.gqwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt.teti. 92 ++D++ t s+ g +++ gk+t+ +++lt ++ + ++ + +e+S Dg tW++++++++++ + ++++ UFQ18722.1|CBM0|CBM32|GH92 1188 EGTLFDNSSATAATSEsG-AVELPVGKETKAVQYTLT-SStdKaKAPRGWVLEGSVDGRTWKQLDKRSGESFaWDrQTRVf 1266 567899977776555422.355555555555555555.33455799******************98876543333322333 PP CBM32.hmm 93 tfdkpvtaryvRlt 106 t++ p t ++Rl+ UFQ18722.1|CBM0|CBM32|GH92 1267 TVARPGTYGHYRLV 1280 44466666666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1294 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 93.28 // Query: XTM33450.1|CBM32|GH92 [L=1313] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-29 87.2 22.5 1.3e-18 53.8 8.7 3.7 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.8 8.7 1.3e-18 1.3e-18 6 109 .. 72 182 .. 67 198 .. 0.79 2 ? -2.8 0.0 0.45 0.45 20 54 .. 289 349 .. 280 365 .. 0.53 3 ? -2.2 0.0 0.29 0.29 67 78 .. 1096 1107 .. 1080 1130 .. 0.77 4 ! 40.4 1.8 1.9e-14 1.9e-14 14 107 .. 1165 1264 .. 1154 1278 .. 0.72 Alignments for each domain: == domain 1 score: 53.8 bits; conditional E-value: 1.3e-18 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.g 87 +a ++++++gg+ a+na Dgd+ t+W + wl++ +p ++k+ lt a+ +++k+++v++S+Dg+tWtt+++++n++ + XTM33450.1|CBM32|GH92 72 TA-NGENTGGGEIATNAADGDKFTKWLVFEptGWLVYQTSAPVVIKKYALTSANdaDgRDPKNWTVSGSNDGTTWTTLDTQTNQDFaN 158 34.5667777788********99*****74467******************7334546**********************99988766 PP CBM32.hmm 88 t.te.titfdkpvtaryvRltvtk 109 ++ + +f++++ +y++l vt XTM33450.1|CBM32|GH92 159 RfQTkEYSFANDTAYTYFKLDVTL 182 674437788876656*****9944 PP == domain 2 score: -2.8 bits; conditional E-value: 0.45 CBM32.hmm 20 enavDgdpntrWss................ag.......qw..ltvdLgkp...ttvdkvvlt 54 + a+D+ +t+ s ++ qw ++ dLg++ +t++++ + XTM33450.1|CBM32|GH92 289 DLAFDD--GTYLSDlkakdhhgfelsprgqGDskalytnQWnnVEADLGAVaagKTIKRILIG 349 566666..6665444444444444443333003334445455588999976223466666665 PP == domain 3 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 67 evStDgktWttv 78 +v +gk+Wt XTM33450.1|CBM32|GH92 1096 SVKVNGKNWTST 1107 466799999964 PP == domain 4 score: 40.4 bits; conditional E-value: 1.9e-14 CBM32.hmm 14 aggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt...te.t 91 agg + ++++D+d++t +g ++tv L + + v ++lt + + + ++ +++e+S+Dg+tWttv+ ++++ + t XTM33450.1|CBM32|GH92 1165 AGGTDVSKLIDNDAKTQVTLTGarPTVTVALPQGRPVGMYTLTS-GtTgTAPSAWTLEGSNDGTTWTTVDRRTGE---SwawASyT 1246 455789********996555433667*****************4.344599******************987653...22232324 PP CBM32.hmm 92 itfd..kpvtaryvRltv 107 ++f+ +p + +Rl++ XTM33450.1|CBM32|GH92 1247 RSFSvaSPKAYTQYRLVF 1264 477764554449999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1313 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 158.53 // Query: WCL88339.1|CBM0|CBM32|GH92 [L=1294] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-28 84.1 14.0 1.5e-22 66.6 1.2 3.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.6 1.2 1.5e-22 1.5e-22 7 113 .. 101 212 .. 95 225 .. 0.76 2 ? -2.3 1.0 0.32 0.32 45 48 .. 765 768 .. 723 827 .. 0.53 3 ! 25.7 0.2 6.8e-10 6.8e-10 19 106 .. 1188 1280 .. 1173 1291 .. 0.65 Alignments for each domain: == domain 1 score: 66.6 bits; conditional E-value: 1.5e-22 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a s++++++g+ aen+vDg ++++W + w+++dL++p +v ++ lt a+ +++kd+++ +S Dgk+W++++e+g++ WCL88339.1|CBM0|CBM32|GH92 101 A-SGENTGSGEVAENLVDGEATSKWLTFArsGWVEFDLKEPAKVVTYALTSANdhApRDPKDWTLKGSADGKDWKVLDERGGE 182 3.4667777799*******999*****74467******************7334547**********************9976 PP CBM32.hmm 85 td.gtte..titfdkpvta.ryvRltvtkratn 113 g ++ + +f+++ ta r++Rl + +a+n WCL88339.1|CBM0|CBM32|GH92 183 VFdGRHKtkKYDFTNA-TAyRHYRLDI--SANN 212 6656654223466655.555*******..4332 PP == domain 2 score: -2.3 bits; conditional E-value: 0.32 CBM32.hmm 45 pttv 48 p++ WCL88339.1|CBM0|CBM32|GH92 765 PKKA 768 3333 PP == domain 3 score: 25.7 bits; conditional E-value: 6.8e-10 CBM32.hmm 19 aenavDgdpntrWssa.gqwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt.teti. 92 ++D++ t s+ g +++ gk+t+ +++lt ++ + ++ + +e+S Dg tW++++++++++ + ++++ WCL88339.1|CBM0|CBM32|GH92 1188 EGTLFDNSSATAATSEsG-AVELPVGKETKAVQYTLT-SStdKaKAPRGWVLEGSVDGRTWKQLDKRSGESFaWDrQTRVf 1266 567899977776555422.355555555555555555.33455799******************98876543333322333 PP CBM32.hmm 93 tfdkpvtaryvRlt 106 t++ p t ++Rl+ WCL88339.1|CBM0|CBM32|GH92 1267 TVARPGTYGHYRLV 1280 44466666666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1294 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 95.29 // Query: XAU38659.1|CBM32|GH92 [L=1651] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-24 71.8 16.5 4.7e-17 48.8 3.0 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 48.8 3.0 4.7e-17 4.7e-17 8 112 .. 53 165 .. 48 179 .. 0.79 2 ? -0.3 0.1 0.078 0.078 35 56 .. 298 333 .. 268 375 .. 0.65 3 ! 28.3 2.5 1e-10 1e-10 15 117 .. 1142 1250 .. 1132 1268 .. 0.73 Alignments for each domain: == domain 1 score: 48.8 bits; conditional E-value: 4.7e-17 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gt. 88 ++s+++a+g+ a+n D +p+t+W + w+ + L +p++ ++++t + + ++++++++++StDg +Wt+v+++++ t g XAU38659.1|CBM32|GH92 53 TASAENAPGEVAANPSDANPDTKWLAFAstGWVRYQLAAPKRALTWSMTSgDDaPeRDPRNVTLQGSTDGASWTDVDQRTGVTFaGRk 140 3455677779****************63367******************6522546*********************99888776764 PP CBM32.hmm 89 .tetitfdkpvtaryvRltvtkrat 112 ++t+t+++p + ++Rl+vt++++ XAU38659.1|CBM32|GH92 141 tKQTFTVTTPGDYGFYRLNVTANQS 165 2235566688899*******76543 PP == domain 2 score: -0.3 bits; conditional E-value: 0.078 CBM32.hmm 35 g........qw..ltvdLg.kp..ttvdkvvltw.a 56 g qw +++dLg k+ +t+d+v l + + XAU38659.1|CBM32|GH92 298 GvgkilyaaQWnsVVIDLGdKAqgKTIDAVLLGYdN 333 13334445545559*****54434577777777532 PP == domain 3 score: 28.3 bits; conditional E-value: 1e-10 CBM32.hmm 15 ggggaenavDgdpnt..rWssagqwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetit 93 + ++ +++D++ +t + +a+ ++ + L + ++ + ++lt ++ g +++++ve+S++g tW+t+++++++ t+t++ XAU38659.1|CBM32|GH92 1142 AATTPGALFDNSSTTatTFNTATPTVAYTLSGIgQRATFYSLT-NGaAaGEPSTWRVEGSKNGRTWETIDSRTGQAF-AwrTQTRP 1225 4467999***976652134443256999999886777777777.3344699*******************9987654.33356779 PP CBM32.hmm 94 fd..kpvtaryvRltvtkratnawga 117 f+ +p t + +Rl+vt++ t++++ XAU38659.1|CBM32|GH92 1226 FKiaEPGTYTSYRLVVTAS-TGTPTL 1250 999899999*******553.444433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1651 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 139.95 // Query: BFE55481.1|CBM32|GH92 [L=1857] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-31 94.0 24.3 3.6e-23 68.6 4.0 5.4 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.6 4.0 3.6e-23 3.6e-23 6 111 .. 85 198 .. 81 214 .. 0.80 2 ! 3.1 0.1 0.0069 0.0069 6 34 .. 695 725 .. 690 743 .. 0.72 3 ! 30.7 2.8 2e-11 2e-11 13 122 .. 1158 1273 .. 1154 1275 .. 0.66 4 ? -3.9 0.0 0.99 0.99 90 114 .. 1458 1482 .. 1444 1498 .. 0.55 5 ? 0.9 0.1 0.033 0.033 12 51 .. 1688 1723 .. 1677 1766 .. 0.66 Alignments for each domain: == domain 1 score: 68.6 bits; conditional E-value: 3.6e-23 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.g 87 +a++s+++++++ a+++ Dg+p+t+W + + w+ + L++p tv k++lt a+ + +++kd++v++S+Dg++Wt+++ ++++t g BFE55481.1|CBM32|GH92 85 AATASAENPPNEIAARLADGNPSTKWLAFNptGWVAYQLKAPATVVKYSLTSANdaPgRDPKDFTVQGSNDGSQWTDLDRRTGQTFsG 172 4555777888899***************75567******************7334557*********************999888766 PP CBM32.hmm 88 t..tetitfdkpvtaryvRltvtkra 111 t+t +f++++ y+Rl+vt+++ BFE55481.1|CBM32|GH92 173 RfaTNTYSFTNTAAYSYYRLNVTANS 198 675558899965556*******7644 PP == domain 2 score: 3.1 bits; conditional E-value: 0.0069 CBM32.hmm 6 saessssaaggggaenavDgd...pntrWssa 34 sa ++ss+++ ++ +++vDg+ +n +W ++ BFE55481.1|CBM32|GH92 695 SAPTGSSTPT-NTGAKLVDGQiyvNNGFWDTY 725 6666777777.9********844334599885 PP == domain 3 score: 30.7 bits; conditional E-value: 2e-11 CBM32.hmm 13 aaggggaenavDgdpntrWssag..qwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tet 91 a+gg++a++++D+ t a+ ++ + + ++ + +++t ++ n g++ d+k+++S+Dg +Wttv++++++ t ++t BFE55481.1|CBM32|GH92 1158 ATGGQDASKLFDDTSATQMTFATgtPQIGWAYRgGKQKPTWYTIT-SGaNpGDPADWKLQGSKDGVSWTTVDSRKDEV-FTwrNQT 1241 455588999999976674433321222333333244555555666.33466********************9987644.5554557 PP CBM32.hmm 92 itfd..kpvtaryvRltvtkratnawgasiaEl 122 ++f+ p + + +Rl+vtk+ +a +++aE+ BFE55481.1|CBM32|GH92 1242 RPFQisHPGKFTQFRLVVTKTV-GAAQTNLAEI 1273 79998899999*******7743.2334667765 PP == domain 4 score: -3.9 bits; conditional E-value: 0.99 CBM32.hmm 90 etitfdkpvtaryvRltvtkratna 114 +ti+++ p +a+ + +++ +++ n+ BFE55481.1|CBM32|GH92 1458 KTIELNLPSDAKSISFVGAGTQGNQ 1482 2666665566777777774433222 PP == domain 5 score: 0.9 bits; conditional E-value: 0.033 CBM32.hmm 12 saaggggaenavDgdpntrWssagqwltvdLgkp.ttvdkv 51 ++++ +ga+ avDg t + ++ +++tv+L + tv++ BFE55481.1|CBM32|GH92 1688 ATPA-SGAAIAVDG---TGFTAG-EQVTVKLAASdVTVKAT 1723 3444.89999****...766665.24777777432555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1857 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.22 // Query: XPG77029.1|CBM32|GH92 [L=961] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-13 35.0 2.7 8.8e-13 35.0 2.7 3.3 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.9 0.0 0.11 0.11 87 109 .. 192 212 .. 172 227 .. 0.64 2 ? -4.0 0.1 1 1 24 35 .. 419 430 .. 414 442 .. 0.70 3 ? -0.9 0.6 0.12 0.12 15 34 .. 530 549 .. 521 586 .. 0.76 4 ! 35.0 2.7 8.8e-13 8.8e-13 10 122 .. 837 953 .. 830 955 .. 0.70 Alignments for each domain: == domain 1 score: -0.9 bits; conditional E-value: 0.11 CBM32.hmm 87 gttetitfdkpvtaryvRltvtk 109 gt ++it ++ a y+R+t+ + XPG77029.1|CBM32|GH92 192 GTRTEITPTD--HAAYFRFTAAA 212 2212444332..389****9933 PP == domain 2 score: -4.0 bits; conditional E-value: 1 CBM32.hmm 24 DgdpntrWssag 35 Dg +trW+s g XPG77029.1|CBM32|GH92 419 DGGWTTRWASPG 430 665569999963 PP == domain 3 score: -0.9 bits; conditional E-value: 0.12 CBM32.hmm 15 ggggaenavDgdpntrWssa 34 + g +n++Dg + W + XPG77029.1|CBM32|GH92 530 SATGYANIFDGTSTGTWTGG 549 335679*****544367664 PP == domain 4 score: 35.0 bits; conditional E-value: 8.8e-13 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag...qwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt.te 90 ++ a++ g +n++D t Wss++ w++ +++tv ++lt ++ + +++ +++ +S+Dg +Wtt+++++++ + XPG77029.1|CBM32|GH92 837 TT-ASNATGLKNLNDRTSLTEWSSGTsgaAWIQGSTAtTARTVAIYTLTSSNkTgQDPAGWTLKGSNDGINWTTLDTRQGEV-FAwRR 922 33.334478*******6559****8556899998888455888888888533447********************9987543.33323 PP CBM32.hmm 91 ti.tfd..kpvtaryvRltvtkratnawgasiaEl 122 ++ +f +p +Rl++ +++ ++s++E+ XPG77029.1|CBM32|GH92 923 QVrPFVvkTPGAYSSYRLEI----AGSGAVSLSEF 953 44466654555458999999....33344788887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (961 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 104.03 // Query: WCN84078.1|CBM32|GH92 [L=1870] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-28 85.5 27.1 3e-21 62.4 3.8 5.7 6 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.4 3.8 3e-21 3e-21 5 112 .. 90 205 .. 86 221 .. 0.79 2 ? 1.0 0.0 0.03 0.03 36 83 .. 346 413 .. 311 443 .. 0.65 3 ? -2.2 0.0 0.29 0.29 21 51 .. 586 613 .. 577 664 .. 0.64 4 ? 1.7 0.0 0.018 0.018 6 34 .. 701 731 .. 696 748 .. 0.70 5 ! 32.1 2.6 7.2e-12 7.2e-12 12 122 .. 1163 1279 .. 1159 1281 .. 0.68 6 ? -2.1 0.3 0.27 0.27 46 85 .. 1699 1739 .. 1660 1776 .. 0.61 Alignments for each domain: == domain 1 score: 62.4 bits; conditional E-value: 3e-21 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd. 86 s+ ++s+++++ + a+n+ D+dp+t+W + w+t+ L kp tv +++lt a+ + +++kd+ v++S+Dg+tWt+++++++++ WCN84078.1|CBM32|GH92 90 STVTASAEYPPREIAANLKDDDPSTKWLMFEpaGWVTYQLAKPATVVRYSLTAANdaPtRDPKDFVVQGSNDGSTWTDLDKRTGEKFs 177 56677888999999**************974567******************7334557********************999876665 PP CBM32.hmm 87 gt..tetitfdkpvta.ryvRltvtkrat 112 g t++ +f++ +ta y+Rl+vt+++ WCN84078.1|CBM32|GH92 178 GRfaTNKYSFTN-TTAyGYYRLNVTANSG 205 657444668885.5566*******77552 PP == domain 2 score: 1.0 bits; conditional E-value: 0.03 CBM32.hmm 36 qw..ltvdLgkp...ttvdkvvltw....ae....n.grikdykvevSt...Dg...ktWttvaekgn 83 qw ++ dLg++ +t+d+v l + a+ g d+++e+S Dg +++++ +n WCN84078.1|CBM32|GH92 346 QWnlVQADLGTVargKTIDRVLLAYddpqATeetrFqGWLDDIELEASPasiDGsklTNYVDTRRGTN 413 66768999998843459999999987654214444147777889996643448833335655543333 PP == domain 3 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 21 navDgdpntrWssagqwltvdLgkpttvdkv 51 a+D p+t +++ +t+d + ++v+ WCN84078.1|CBM32|GH92 586 GAFDRAPTTSAATS---VTFDISASREVTMR 613 57888888877665...88888888887644 PP == domain 4 score: 1.7 bits; conditional E-value: 0.018 CBM32.hmm 6 saessssaaggggaenavDgd...pntrWssa 34 sa +++s+++ ++ +++vDg+ +n +W ++ WCN84078.1|CBM32|GH92 701 SAPTGASTPT-HTGAKIVDGQiyvNNGFWDTY 731 5555555555.*********844334599885 PP == domain 5 score: 32.1 bits; conditional E-value: 7.2e-12 CBM32.hmm 12 saaggggaenavDgdpnt...rWssagqwltvdLg.kpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt.te 90 +a+gg++a++++D++ +t + s++ ++ + + ++ + +++t + + g++ +++v++S+Dg tWttv++++++ + ++ WCN84078.1|CBM32|GH92 1163 TATGGQDASKLFDDSSTTqltFTSAT-PQINWAFRgGKQKPKYYTVTS-GaSaGDPAEWRVQGSNDGLTWTTVDSRKDQVFPWrNQ 1246 3456689*******888633133333.346666654678899999994.34459********************998765433444 PP CBM32.hmm 91 titfd..kpvtaryvRltvtkratnawgasiaEl 122 t++++ kp + +Rl vtk+ +a + iaE+ WCN84078.1|CBM32|GH92 1247 TRPYTidKPGRFAQFRLAVTKTV-GAAQTTIAEI 1279 44444448887788888886643.3444778876 PP == domain 6 score: -2.1 bits; conditional E-value: 0.27 CBM32.hmm 46 ttvdkvvltwae.n.grikdykvevStD.gktWttvaekgntt 85 tt +++++ + + +++v+v tD g t +++a+ ++t WCN84078.1|CBM32|GH92 1699 TTGGAITVD--GsGfAAGEQVTVSVGTDpGRTMKVAASATGTV 1739 333344444..21234467788888877777777555444322 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1870 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 152.41 // Query: WIY07557.1|CBM32|GH92 [L=1436] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-35 108.0 21.1 3.6e-24 71.8 3.9 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.8 3.9 3.6e-24 3.6e-24 3 122 .. 87 213 .. 85 215 .. 0.77 2 ? 1.3 0.2 0.024 0.024 9 37 .. 713 744 .. 705 778 .. 0.68 3 ! 42.6 4.1 4e-15 4e-15 12 123 .. 1178 1291 .. 1171 1292 .. 0.78 Alignments for each domain: == domain 1 score: 71.8 bits; conditional E-value: 3.6e-24 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgntt 85 t++sa ss++++gg+ +n+vDg ++t+W s++ w ++ L +pt+++++ l + +++kd+++++S+D +tWt++++++++ WIY07557.1|CBM32|GH92 87 TETSA-SSENTDGGEVVSNLVDGTTDTKWLSWDptAWAQITLSEPTSITHYALSSaNDfDnRDPKDWTLQGSNDASTWTDLDKQAGQA 173 45555.566777779****************96689******************7522535********************9877765 PP CBM32.hmm 86 dgt...te.titfdkpvta.ryvRltvtkratnawgasiaEl 122 t ++ + ++++p+ a +y+Rl++t+++ + + +++El WIY07557.1|CBM32|GH92 174 F-TarfQQkDYKLAAPTAAyKYFRLNITANN-GGPILQLSEL 213 4.334633366888777777*******5532.2344777665 PP == domain 2 score: 1.3 bits; conditional E-value: 0.024 CBM32.hmm 9 ssssaaggggaenavDgd...pntrWssag.qw 37 +++++a+ ++ +++vDg+ +n +W ++ +w WIY07557.1|CBM32|GH92 713 TGADTAT-QTGSKVVDGQmyvNNGFWDTYRtTW 744 3445555.899******8553346999963334 PP == domain 3 score: 42.6 bits; conditional E-value: 4e-15 CBM32.hmm 12 saaggggaenavDgdpntrWssag.qwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tet 91 +++g ++a++++D+ ++r ++a l++ L+++ v++++lt + + g++k++++ +S DgktW ++++++n+ + ++t WIY07557.1|CBM32|GH92 1178 TSDG-SDAAALIDN--TSRTQAAVtGALQYQLNNTdEAVTHYTLTS-QtGaGDPKSWTLKGSYDGKTWAVADQQTNQA-FSwrQQT 1258 3455.89*******..44555542236******7769********4.3446******************888887865.4454456 PP CBM32.hmm 92 itfd..kpvtaryvRltvtkratnawgasiaEla 123 + f+ +p+ y++l+vt+++t+a+ a++aE++ WIY07557.1|CBM32|GH92 1259 RAFKvaNPAHYAYYKLEVTATSTGAP-AQLAEFE 1291 68887799999*******88888766.9****95 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1436 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 171.63 // Query: XCH28951.1|CBM32|GH92 [L=1462] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-12 34.0 12.0 1.1e-10 28.2 0.4 4.7 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.2 0.0 0.073 0.073 32 82 .. 432 478 .. 405 502 .. 0.65 2 ? -3.7 0.0 0.85 0.85 15 34 .. 545 567 .. 541 576 .. 0.70 3 ! 28.2 0.4 1.1e-10 1.1e-10 14 122 .. 1008 1122 .. 1001 1124 .. 0.68 4 ? -0.3 0.1 0.073 0.073 46 76 .. 1192 1222 .. 1151 1246 .. 0.62 5 ! 9.2 0.1 8.4e-05 8.4e-05 59 84 .. 1287 1313 .. 1267 1344 .. 0.72 Alignments for each domain: == domain 1 score: -0.2 bits; conditional E-value: 0.073 CBM32.hmm 32 ssagqwltvdLgkp.ttvdkvvltwaen.grikdykvevStDgktWttvaekg 82 ++++ + +d g++ ++v + l + + k+ ++e+ +D t++++++ + XCH28951.1|CBM32|GH92 432 ATSY--VSFDAGTVeMRVATSLLG---TaQAKKNLELEIADDA-TFEDLVADA 478 4443..777777662333333333...3377999******776.9*9996432 PP == domain 2 score: -3.7 bits; conditional E-value: 0.85 CBM32.hmm 15 ggggaenavDgd..pnt.rWssa 34 ++++ ++++Dg+ nt +W + XCH28951.1|CBM32|GH92 545 PTETGARILDGKlfVNTgFWDTF 567 457889999**855477799884 PP == domain 3 score: 28.2 bits; conditional E-value: 1.1e-10 CBM32.hmm 14 aggggaenavDgdpntrWssa..g..qw..ltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gtt 89 ++gg+a +++D+ t +++ g w + v g+ v+ ++lt + +++++ +e+S+Dg++Wt+++e++++t + XCH28951.1|CBM32|GH92 1008 SSGGEAGALFDDTSAT--QTTltGdePWvrYLVSGGTDVPVHFYTLTS-GtdAaLDPTHWVLEGSDDGESWTVLDERTDQTFpWRN 1090 344789999**94444..332222466722456677889999999996.2333589********************9987753334 PP CBM32.hmm 90 etitfd..kpvtaryvRltvtkratnawgasiaEl 122 +t++f +++t +R+++ ++a ++++aE+ XCH28951.1|CBM32|GH92 1091 QTRPFRlaDDATMAQYRVRFLDTA---GSVQLAEV 1122 555666667778899999995533...22667765 PP == domain 4 score: -0.3 bits; conditional E-value: 0.073 CBM32.hmm 46 ttvdkvvltw.aengrikdykvevStDgktWt 76 t ++v++t+ a+ ++ y++ev +W XCH28951.1|CBM32|GH92 1192 TVTRTVTVTPsAS-VAPRAYTLEVAATTGSWA 1222 3345566666532.458888888886555776 PP == domain 5 score: 9.2 bits; conditional E-value: 8.4e-05 CBM32.hmm 59 grikdykvevStDgktWttv.aekgnt 84 + +++y v++S D +tWt+v +++g+ XCH28951.1|CBM32|GH92 1287 DLANQYLVSASADRETWTEVlKAEGSP 1313 34789***************5555442 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1462 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.62 // Query: XBL14544.1|CBM32 [L=267] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-19 55.2 0.8 9e-19 54.4 0.8 1.4 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 54.4 0.8 9e-19 9e-19 10 118 .. 140 253 .. 131 264 .. 0.76 Alignments for each domain: == domain 1 score: 54.4 bits; conditional E-value: 9e-19 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt...tetit 93 + +a+g++g +++D++ +t++ s++ w+ +++++p +++t + + ++++d+++++S Dg+tW t++++++++ ++ t+++ XBL14544.1|CBM32 140 NGGANGSEGSLKLIDNNLDTKYLSGYvapFWINLEFDTPVIAGYYSFTSgNDaPsRDPRDWEIQGSLDGTTWDTLDTRTEYSFPDrklTREFY 232 44455668999*************866789******************7532547*********************99987765544444667 PP CBM32.hmm 94 fdkpvta.ryvRltvtkratnawgas 118 f++ ta +y+R+ v k++ n s XBL14544.1|CBM32 233 FENS-TAyKYYRFDVLKNNGN----S 253 7754.455*******664322....2 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (267 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 65.37 // Query: WET76405.1|CBM32|GH92 [L=1428] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-32 99.4 14.7 5.6e-25 74.4 2.3 3.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 74.4 2.3 5.6e-25 5.6e-25 4 122 .. 84 208 .. 80 210 .. 0.76 2 ? 1.2 0.2 0.026 0.026 10 40 .. 714 748 .. 706 784 .. 0.68 3 ! 30.2 1.0 2.8e-11 2.8e-11 18 123 .. 1176 1283 .. 1169 1284 .. 0.73 Alignments for each domain: == domain 1 score: 74.4 bits; conditional E-value: 5.6e-25 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd 86 ++s ++s++++++g +n+vDg+++t+W +++ w +v L +pt+++++ l + ++++d+++ +S Dg++Wt+++++++++ WET76405.1|CBM32|GH92 84 ETS--ANSENTPNEGVSNLVDGSTDTKWLAWTptGWAQVTLSEPTSITRYALSSaNDfDnRNPQDWTLRGSADGQNWTELDKQTGQKF 169 334..46666777*****************96678******************7522535********************99887654 PP CBM32.hmm 87 gt..te.titfdkpvta.ryvRltvtkratnawgasiaEl 122 ++ ++ + +++++ a +y+Rl+vtk++ + ++++El WET76405.1|CBM32|GH92 170 SEplQTkEYRLAAASAAyKYFRLEVTKNNG-GPIMQLSEL 208 335633366777443455*******76443.244677765 PP == domain 2 score: 1.2 bits; conditional E-value: 0.026 CBM32.hmm 10 sssaaggggaenavDgd...pntrWssag.qwltv 40 + +++++++ +++vDg +n +W ++ w + WET76405.1|CBM32|GH92 714 TGQDTPTQTGAKLVDGEffvNNGFWDTYRtVWSAY 748 4445556999******7664445777752234344 PP == domain 3 score: 30.2 bits; conditional E-value: 2.8e-11 CBM32.hmm 18 gaenavDgdpntrWssag.qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt..tetitfd..k 96 g ++ +D+ r +++ +++ ++ + ++ ++ + g++k++ + +S DgktW +++ +++++ + ++t+ f+ + WET76405.1|CBM32|GH92 1176 GDAAFFDNTS--RTEAKVeAPIQYQVPSTNEAGSFYTLTSGkGaGDAKSWVLKGSYDGKTWAVADRRTDQK-FSwrQQTRAFKiaN 1258 5567788844..44443222399999999999999666433447******************888888765.44444566888779 PP CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEla 123 p+ y+Rl+vt at+ as+aE++ WET76405.1|CBM32|GH92 1259 PAHYAYYRLEVT--ATTGGEASLAEFE 1283 9999*******4..44344499***96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1428 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 166.48 // Query: BGA02923.1|CBM32 [L=1279] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-22 67.0 1.0 1.1e-22 67.0 1.0 1.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.0 1.0 1.1e-22 1.1e-22 6 122 .. 186 309 .. 182 311 .. 0.74 2 ? -3.9 0.1 0.96 0.96 45 71 .. 571 593 .. 548 603 .. 0.60 Alignments for each domain: == domain 1 score: 67.0 bits; conditional E-value: 1.1e-22 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssagqwltvdLgkpttvdkvvltw..ae..n.grikdykvevStDgktWttvaekgnttdgt..te. 90 s +++++++++++aen++Dgd nt+W + + + t+dL+ + v + ++ a+ +++k++++++StDg+tWt+++++++++ ++ t BGA02923.1|CBM32 186 SVSANAENPPNEDAENLIDGDSNTKWLAFEPTATIDLEMEEAVVATRYALtsANdfAgRDPKNWTLQGSTDGETWTDLDTQADQEFPDrfTPm 278 55567888999*****************632367777777777666666654335646*********************99887665546434 PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEl 122 + +f++ + +++Rl +t++a ++ +++aE+ BGA02923.1|CBM32 279 DYRFENETAYQHYRLDITANAGDDL-TQLAEI 309 8899965545*******77654343.778776 PP == domain 2 score: -3.9 bits; conditional E-value: 0.96 CBM32.hmm 45 pttvdkvvltwaengrikdykvevStD 71 +tv++++++ ae +++++ ++ +D BGA02923.1|CBM32 571 KRTVSRFTYD-AE---ANTIDQSTRKD 593 5677777777.33...44444444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1279 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 175.71 // Query: XPG52744.1|CBM32|GH92 [L=994] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-13 36.3 7.2 8.1e-13 35.1 5.3 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.0 0.27 0.27 91 109 .. 216 232 .. 194 268 .. 0.67 2 ! 35.1 5.3 8.1e-13 8.1e-13 11 122 .. 871 989 .. 865 991 .. 0.70 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.27 CBM32.hmm 91 titfdkpvt.aryvRltvtk 109 +it + + a y+R+t+ + XPG52744.1|CBM32|GH92 216 EITPT---DhAAYFRFTAPA 232 33333...227999999933 PP == domain 2 score: 35.1 bits; conditional E-value: 8.1e-13 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag..qwltvdLg..kpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekgnttdgt.. 88 ss+a+ g+ +n+ D + +t W s++ w++ d +p +v k+ ++ ++++++k+ +S+Dg W+t++e++n++ t XPG52744.1|CBM32|GH92 871 SSSAT-GQLANVYDRSSDTAWRSTSanAWIEADAAtgQPASVPKIYTLTsGTqdAgQDPRSWKLKASKDGVAWVTLDERSNES-FTwr 956 34455.79***************86689*999987336677777755544224437*********************998865.5554 PP CBM32.hmm 89 tetitfd.kpvt..aryvRltvtkratnawgasiaEl 122 ++t++f+ k+ t ++R+++ ++t++ + +aE+ XPG52744.1|CBM32|GH92 957 QQTRPFAlKAGTesYSKYRIEF--DNTGT--MTVAEF 989 4577999966662245555555..43433..456776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (994 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 132.87 // Query: BFZ65684.1|CBM32|GH92 [L=1978] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-26 79.0 15.0 5.3e-16 45.4 2.5 4.3 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 45.4 2.5 5.3e-16 5.3e-16 7 110 .. 117 230 .. 112 243 .. 0.69 2 ? -0.6 0.1 0.092 0.092 36 68 .. 374 420 .. 339 472 .. 0.60 3 ! 38.9 0.3 5.6e-14 5.6e-14 13 122 .. 1201 1314 .. 1193 1323 .. 0.74 4 ? -1.1 0.1 0.14 0.14 52 107 .. 1661 1716 .. 1621 1732 .. 0.70 Alignments for each domain: == domain 1 score: 45.4 bits; conditional E-value: 5.3e-16 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gt 88 ++s+++a++++a +a Dgd++t+W + + +l + + +++t +++l ++ + ++++++++ +S++g++Wt+++++++++ ++ BFZ65684.1|CBM32|GH92 117 VSASAENAPNEAARFAADGDAGTKWLTFTtaATLDYTFTTAQTAVTYKLVSGNdaPeRDPRTWRILGSNNGTDWTELDSQTDQSWkSS 204 3456667787*****************743455777777777777777775234547********************99887654333 PP CBM32.hmm 89 ..tetitfd.kpvta.ryvRltvtkr 110 + ++f+ k++ a ++Rl + ++ BFZ65684.1|CBM32|GH92 205 erGVAKEFTlKTTGAfSKYRLDIASN 230 43123355543444559999988443 PP == domain 2 score: -0.6 bits; conditional E-value: 0.092 CBM32.hmm 36 qw..ltvdLgkp...ttvdkvvltw....ae....n.grikdykvev 68 qw + vdLg++ +t+d++ l + a+ g d k+e+ BFZ65684.1|CBM32|GH92 374 QWnsVRVDLGRVaqgKTIDRFLLSYdnpgATastaFsGWLDDLKIEA 420 444499****7733458999988865433113332135555666664 PP == domain 3 score: 38.9 bits; conditional E-value: 5.6e-14 CBM32.hmm 13 aaggggaenavDgdpntrWssag..qwltvdLgkp.ttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttdgt.tet 91 +g ++ +n+vD+++ + s a+ ++tv +++p ++ + ++lt + + ++ +++e+S+DgktW +v++++n++ ++ +t BFZ65684.1|CBM32|GH92 1201 RDG-ENTANLVDNNAASQVSFASktPQITVAYQGPaQSPSFYTLTS-GtsAaTAPTGWTLEGSNDGKTWSVVDTRQNQKFDSaLQT 1284 345.789*******9985554422356******9955666667774.2343699*******************9988775333347 PP CBM32.hmm 92 itfd..kpvtaryvRltvtkratnawgasiaEl 122 ++f+ +p + +Rl+vt+ ++ +++aEl BFZ65684.1|CBM32|GH92 1285 RPFKiaQPGSFAQFRLNVTS--GGDS-VALAEL 1314 7888879999999*****55..3233.667765 PP == domain 4 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 52 vltw.aengrikdykvevStDgktWttvaekgnttd.gt.teti.tfdkpvtaryvRltv 107 +++w ++ ++i+d+++ + tDg+ t+a++ ++t+ gt ++ + f + ++ +Rl + BFZ65684.1|CBM32|GH92 1661 RVQWgDG-SDIQDVELGAFTDGSA--TIAAEHTFTEpGTyPVVVtVFG-ASGTQQLRLSA 1716 4555433.8899999999999976..7877777777777633332444.22247777766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1978 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 146.81 // Query: WWY83955.1|CBM32|GH92 [L=1266] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-28 86.3 16.6 6.4e-21 61.3 3.3 4.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.3 3.3 6.4e-21 6.4e-21 8 111 .. 94 205 .. 88 224 .. 0.79 2 ! 2.8 1.0 0.0084 0.0084 9 37 .. 705 737 .. 698 776 .. 0.75 3 ! 28.8 0.2 7.2e-11 7.2e-11 20 108 .. 1162 1254 .. 1147 1263 .. 0.74 Alignments for each domain: == domain 1 score: 61.3 bits; conditional E-value: 6.4e-21 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnttd.gtt 89 +ss++++gg+ en+vD p+t+W + + w+++d+++p +++++ lt a+ +++ d+++ +StDgk+W+t++++++++ + + WWY83955.1|CBM32|GH92 94 ASSENKQGGEVKENLVDTEPTTKWLTFEktGWVEFDMDAPVKLKTYALTSANdvVeRDPADWTLKGSTDGKDWKTIDTRSGQSFaDRQ 181 3456778889****************74467******************73345359********************98877653433 PP CBM32.hmm 90 etitfd..kpvtaryvRltvtkra 111 +t ++d +p++ +++Rl +tk++ WWY83955.1|CBM32|GH92 182 TTNSYDlaEPAEYQHFRLDFTKNH 205 333444449999********7743 PP == domain 2 score: 2.8 bits; conditional E-value: 0.0084 CBM32.hmm 9 ssssaaggggaenavDgd...pntrWssag.qw 37 ++ +++++++ +++vDg+ +n +W ++ +w WWY83955.1|CBM32|GH92 705 ATGENTPTHTGAKIVDGKvyvNNGFWDTYRtTW 737 34555666*********8553346999863334 PP == domain 3 score: 28.8 bits; conditional E-value: 7.2e-11 CBM32.hmm 20 enavDgdpntrWssagqwltvdLg.kpttvdkvvltw.ae..n.grikdykvevStDgktWttvaekgnttd.gttetitfd..kp 97 +++D+ +t s+ tvdL + + ++v++t + ++ +++++S+Dg++W+t++e+++++ + +t+ f+ + WWY83955.1|CBM32|GH92 1162 GALFDNTSSTEASA----TTVDLPlSGDRAKAVQYTLtSPadHtKAPTGWTLQASSDGTHWRTLDERSGESFrWDRQTRAFTipHA 1243 57899866666555....599**9888999******9732443599*******************987655333333556664466 PP CBM32.hmm 98 vtaryvRltvt 108 ++ ++Rl+ t WWY83955.1|CBM32|GH92 1244 ASYAHYRLVLT 1254 66788888774 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1266 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 86.89 // Query: UKD57794.1|CBM0|CBM32|GH92 [L=1435] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-32 99.4 19.4 3.9e-22 65.2 1.3 4.2 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.2 1.3 3.9e-22 3.9e-22 6 112 .. 89 203 .. 84 214 .. 0.75 2 ? 2.5 0.4 0.01 0.01 9 37 .. 714 745 .. 706 798 .. 0.72 3 ? -1.0 0.0 0.12 0.12 59 77 .. 1100 1119 .. 1082 1137 .. 0.79 4 ! 39.9 3.4 2.8e-14 2.8e-14 12 122 .. 1178 1289 .. 1174 1291 .. 0.75 Alignments for each domain: == domain 1 score: 65.2 bits; conditional E-value: 3.9e-22 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgn 83 sa+ s++++gg+ a+n++Dg+++t+W s++ ++t+ L +p +++++ + a+ + ++++d+++ +S+DgktWt+++++++ UKD57794.1|CBM0|CBM32|GH92 89 SAT-SENTGGGEVAANLIDGSTGTKWLSWDpaASVTFTLSEPVKITHYAVSSANdaPgRDPQDWTLRGSDDGKTWTDLDKQSG 170 444.556677799***************966778*****************7334557********************98776 PP CBM32.hmm 84 ttdgt...tetitfd.kpvtaryvRltvtkrat 112 ++ ++ +++ +++ ++ ry+ + vt ++ UKD57794.1|CBM0|CBM32|GH92 171 QSFDKrfqQNDYKLAaPSAPYRYYQMDVTRNHG 203 654335743355666433456*******66443 PP == domain 2 score: 2.5 bits; conditional E-value: 0.01 CBM32.hmm 9 ssssaaggggaenavDgdp..nt.rWssag.qw 37 +++++a+ ++ +++vDg++ n+ +W ++ +w UKD57794.1|CBM0|CBM32|GH92 714 TGTDTAT-QTGSKVVDGQTyaNNgFWDTYRtTW 745 4455555.899******7422224899863334 PP == domain 3 score: -1.0 bits; conditional E-value: 0.12 CBM32.hmm 59 grikdykvevS.tDgktWtt 77 + +k++ v++ +gk+Wt UKD57794.1|CBM0|CBM32|GH92 1100 NSAKNVYVQGLkVNGKNWTS 1119 56888999988789****96 PP == domain 4 score: 39.9 bits; conditional E-value: 2.8e-14 CBM32.hmm 12 saaggggaenavDgdpntrWssag.qwltvdLgkp.ttvdkvvltwae.n.grikdykvevStDgktWttvaekgnttdgt 88 +++g ++a++++D+ ++r +++ +++ L+++ v++++lt + + g++k++++ +S DgktWt+++++++++ + UKD57794.1|CBM0|CBM32|GH92 1178 TSDG-SDASALLDN--TSRTQAKVtGAVQYQLKSTdEAVTHYTLTS-GtGaGDAKSWTLKGSYDGKTWTVADQQTDQSFPW 1254 3455.89*******..55555642236******7769********4.3446******************888887765533 PP CBM32.hmm 89 .tetitfd..kpvtaryvRltvtkratnawgasiaEl 122 ++t+ f+ +p+ y+Rl+vt++a +a +aE+ UKD57794.1|CBM0|CBM32|GH92 1255 rQQTRAFAvkNPAHYAYYRLEVTATA--GGPATLAEF 1289 445667777699999*******6644..334788988 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1435 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 162.22 // Query: UXN61502.1|CBM32|GH92 [L=982] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-13 37.6 2.2 1.4e-13 37.6 2.2 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.1 0.0 0.56 0.56 24 34 .. 421 431 .. 400 460 .. 0.64 2 ! 37.6 2.2 1.4e-13 1.4e-13 14 122 .. 836 949 .. 830 951 .. 0.72 Alignments for each domain: == domain 1 score: -3.1 bits; conditional E-value: 0.56 CBM32.hmm 24 DgdpntrWssa 34 Dg +trWs+ UXN61502.1|CBM32|GH92 421 DGGWTTRWSNP 431 34334677764 PP == domain 2 score: 37.6 bits; conditional E-value: 1.4e-13 CBM32.hmm 14 aggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltw..ae..n.grikdykvevStDgktWttvaekgnttdgt..teti 92 +++ g +n++D +t W s + ++ v L++ +t v+l+ ++ +k++++ +S+Dg+tW+t++e++++t +t+ UXN61502.1|CBM32|GH92 836 NTTTGSANLFDRTSGTEWTSVSgaAQIDVALKADRTAIPVSLYTltDGndItKGPKSWTLKGSNDGTTWVTLDERKDETF-LwpRQTR 922 344789******999*****4335569999999998888888876533443699*******************9987543.2423477 PP CBM32.hmm 93 tfd.kpvtaryvRltvtkratnawgasiaEl 122 +f+ k ++a y +++ ++ ++ iaE+ UXN61502.1|CBM32|GH92 923 PFAlK-TPAAYAKYRL--EL-GTDAVTIAEF 949 99952.5566666666..11.2345788887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (982 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.55 // Query: UTO62522.1|CBM0|CBM32|GH92 [L=1285] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-27 82.6 11.5 3.8e-21 62.1 3.1 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.1 3.1 3.8e-21 3.8e-21 7 122 .. 101 222 .. 95 224 .. 0.75 2 ! 3.4 0.2 0.0054 0.0054 8 41 .. 724 760 .. 717 794 .. 0.71 3 ! 20.4 0.0 3e-08 3e-08 22 107 .. 1185 1272 .. 1176 1282 .. 0.70 Alignments for each domain: == domain 1 score: 62.1 bits; conditional E-value: 3.8e-21 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag..qwltvdLgkpttvdkvvltwae..n.grikdykvevStDgktWttvaekgnt 84 a s ++++gg+ en+vDg +++W + + wl++dL +p + ++ lt a+ + +++kd+++ +S +g++Wtt+++++++ UTO62522.1|CBM0|CBM32|GH92 101 A-SDENTDGGEIKENLVDGEVTSKWLAFDttAWLEFDLSEPVKAVRYALTSANdaPgRDPKDWTLKGSANGSDWTTLDTRKDE 182 3.4556677799*******999*****74478*********7777777775335557*********************99877 PP CBM32.hmm 85 td.gt.te.titfdkpvtaryvRltvtkratnawgasiaEl 122 t + ++ +++fd+ + +++Rl++t +a ++ +++aE+ UTO62522.1|CBM0|CBM32|GH92 183 TFsSRqQTrEFSFDSSTAYQHFRLEITRNAGDDI-VQLAEV 222 6534442236677755445*******77554344.888887 PP == domain 2 score: 3.4 bits; conditional E-value: 0.0054 CBM32.hmm 8 essssaaggggaenavDgd...pntrWssag.qwltvd 41 +++++ +++++ +++vDg+ +n +W ++ +w + UTO62522.1|CBM0|CBM32|GH92 724 AAGEN-TPTHTGAKIVDGKvyvNNGFWDTYRtTWPAYS 760 33444.555*********95534569999644564444 PP == domain 3 score: 20.4 bits; conditional E-value: 3e-08 CBM32.hmm 22 avDgdpntrWssagqwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt..te.ti.tfd 95 ++D+ +t + + vdL ++ ++v++t ++ + ++ + +++S Dg++W++++ +++++ + ++ ++ +++ UTO62522.1|CBM0|CBM32|GH92 1185 LLDNTSGTEAAFE----SVDLPVTKPGRAVQYTLtSSdRgKAPTGWVLQGSPDGEKWRDLDRRSGESF-SwdKQtRVfSVK 1260 5666444544333....699**9999*******974444699******************98765443.334332333555 PP CBM32.hmm 96 kpvtaryvRltv 107 +p ++Rl+ UTO62522.1|CBM0|CBM32|GH92 1261 NPGVYEHYRLVP 1272 777678888875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1285 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 168.16 // [ok]