# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM32/fasta_for_each_cluster/cluster_342.txt # target HMM database: merged_hmms/CBM32.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM32/CBM32_cluster_342.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: BFZ69239.1|CBM32|GH16_3 [L=911] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-63 197.9 22.7 2.6e-25 75.5 3.7 4.5 6 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.7 1.4 6.9e-23 6.9e-23 5 120 .. 46 179 .. 41 183 .. 0.73 2 ! 75.5 3.7 2.6e-25 2.6e-25 6 123 .. 228 350 .. 223 351 .. 0.81 3 ! 65.9 0.2 2.4e-22 2.4e-22 4 123 .. 381 507 .. 378 508 .. 0.74 4 ? -1.5 0.1 0.17 0.17 70 88 .. 546 563 .. 521 595 .. 0.61 5 ? -3.8 0.0 0.95 0.95 16 27 .. 706 717 .. 700 747 .. 0.58 6 ? -2.1 0.0 0.27 0.27 83 107 .. 751 775 .. 713 789 .. 0.73 Alignments for each domain: == domain 1 score: 67.7 bits; conditional E-value: 6.9e-23 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgntt 85 ++ae+++ +++ + a++++Dgdp trWss g q++tvdL +++ +d+v l+w a +++y++++St++++W+t+a+ + t BFZ69239.1|CBM32|GH16_3 46 KTAEATTVQDQ-FFASYVTDGDPATRWSSLGqdnQSVTVDLAETCIIDRVDLNWegA---FASKYTISGSTNNTDWETLATGTAT- 126 44555555555.9****************5336899******************644...5******************987644. PP CBM32.hmm 86 d.gt........t.....etitfd...kpvta.ryvRltvtkratnawgasia 120 g+ t +++++d + +a r++R+t+ +r +g s++ BFZ69239.1|CBM32|GH16_3 127 GaGKishitadaTpdapsDDVRVDpnlEEKDAiRFLRVTGDERGFMPYGISLY 179 336688776665155665333333336444566*******7766545666665 PP == domain 2 score: 75.5 bits; conditional E-value: 2.6e-25 CBM32.hmm 6 saessssaaggggaenavDgd...pn.trWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekg 82 +a++ss ++++++a+n++Dg pn trWss++ +w+ +dLg+++ +d++ ++w a ++++y++ +S +g tWt+ a+ + BFZ69239.1|CBM32|GH16_3 228 KASASSVQNPDFPAKNVTDGIgagPNgTRWSSNNadnEWISIDLGATYIIDALGIDWegA---YATKYTIDTSVNGWTWTPYASGS 310 45668889999*********6445456*****855799*******************644...5****************987654 PP CBM32.hmm 83 nttd.gttetitfd.kpvtaryvRltvtkratnawgasiaEla 123 + ++ + ++i+ d +p +ar+vRlt+++r + ++g+si+E++ BFZ69239.1|CBM32|GH16_3 311 K-QNaNR-DEIKGDtSP-RARFVRLTAQERLQPTYGVSIWEFE 350 4.44344.688999555.6********7777767*******96 PP == domain 3 score: 65.9 bits; conditional E-value: 2.4e-22 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa...g...qwltvdLgkpttvdkvvltw.aengrikdykvevS.tDgktWttvaek 81 ass++ + +g + ++++D d ++rWs a + w++vdLgk+ +++++ l w + ++k y++e+ + + W+ v+ + BFZ69239.1|CBM32|GH16_3 381 ASSSQDDP-QCPGCTVDKMFDMDLSSRWSVAekdWsdnAWVQVDLGKTAEINQIALRWeN--AYAKGYDIEIAdSENGPWNLVYRT 463 44444344.444488**************9643326899*******************52..56999999999323447**99754 PP CBM32.hmm 82 gnttdgttetitfdkpvtaryvRltvtk....ratnawgasiaEla 123 + + g+ e i++d p+++r+vR+t+++ +a +++g+si+E+ BFZ69239.1|CBM32|GH16_3 464 IGGQGGK-EVINID-PTEGRFVRVTMNDrpivWAGQKFGYSIYEFR 507 3433354.567999.899********7744433344599*****96 PP == domain 4 score: -1.5 bits; conditional E-value: 0.17 CBM32.hmm 70 tDgktWttvaekgnttdgt 88 D ++Wt ++ +++ d++ BFZ69239.1|CBM32|GH16_3 546 ADPHNWT-LDHTAKAGDNN 563 5778888.54333222222 PP == domain 5 score: -3.8 bits; conditional E-value: 0.95 CBM32.hmm 16 gggaenavDgdp 27 ++++++++Dg++ BFZ69239.1|CBM32|GH16_3 706 SEKITFLLDGNE 717 356677777753 PP == domain 6 score: -2.1 bits; conditional E-value: 0.27 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRltv 107 +++ ++ +++f+++ + yvR++ BFZ69239.1|CBM32|GH16_3 751 DWPGsPN-ADTQFPAQMLVDYVRVYQ 775 5543222.466787555678999887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (911 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 52.17 // Query: UCA50916.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-58 180.4 11.4 6.8e-32 96.8 2.7 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.8 2.7 6.8e-32 6.8e-32 7 123 .. 47 160 .. 41 161 .. 0.84 2 ! 87.6 1.8 4.8e-29 4.8e-29 4 123 .. 184 304 .. 180 305 .. 0.77 3 ? -3.7 0.0 0.86 0.86 83 105 .. 553 575 .. 547 576 .. 0.62 Alignments for each domain: == domain 1 score: 96.8 bits; conditional E-value: 6.8e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++a+ ++a avDgd++trWss+ + +w+ +dLg+ t++ +vvl+w a ++k y++evS +g++Wtt++e+++ + g UCA50916.1|CBM32|GH16_3 47 ATASSTEAP-FTAPSAVDGDTSTRWSSGfTddEWIRIDLGASTSIGQVVLDWeaA---YAKGYRLEVSGNGTDWTTIHETTTGSGG 128 455677788.*****************853699*******************744...5******************988764324 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ry+R+ +t+rat wg+s++E++ UCA50916.1|CBM32|GH16_3 129 V-ETLTVS--GTGRYIRMHGTERAT-PWGYSLHEFQ 160 3.455666..579*******88876.8*******96 PP == domain 2 score: 87.6 bits; conditional E-value: 4.8e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as++++ + + ++++a+D dp +rW+++ + w+ vdLg+ ++++vvl+w a+ ++ y++e+S++g++Wtt++e UCA50916.1|CBM32|GH16_3 184 ASTSQHDGT-CWECSPDKAFDRDPASRWATSpeggWtdpGWIAVDLGARAEISRVVLQWdpAY---ARAYRIEISDNGTDWTTIHE 265 334433333.44478***************5443326788*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + et +++ t+r+vRl++t r ++++g+s++E++ UCA50916.1|CBM32|GH16_3 266 TTTGTGFK-ETLDVS--GTGRHVRLYATRR-SGEYGYSLWEFQ 304 87644322.344555..679*******665.5579******96 PP == domain 3 score: -3.7 bits; conditional E-value: 0.86 CBM32.hmm 83 nttd.gtte.titfdkpvtaryvRl 105 +++ + + t++f+++ + y+++ UCA50916.1|CBM32|GH16_3 553 DWPGpP--DaTTRFPQKMSIDYIKV 575 444323..33678887788888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.71 // Query: XRV68039.1|CBM32|GH16_3 [L=585] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-54 169.1 15.3 8.7e-32 96.4 5.9 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.4 5.9 8.7e-32 8.7e-32 5 123 .. 60 176 .. 56 177 .. 0.86 2 ! 78.6 0.3 2.8e-26 2.8e-26 7 123 .. 206 324 .. 201 325 .. 0.79 3 ? -3.6 0.1 0.8 0.8 17 34 .. 518 534 .. 512 546 .. 0.59 Alignments for each domain: == domain 1 score: 96.4 bits; conditional E-value: 8.7e-32 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgntt 85 sa+sss++ g+++a++avDgd +trWssa+ w++vdLg+++++d+v+l+w a +++ y++evStDg W t+++++n + XRV68039.1|CBM32|GH16_3 60 RSATSSSTEFGWSTAAAAVDGDRGTRWSSAHadgAWIQVDLGTAHDLDRVELDWetA---YASGYRIEVSTDGAAWATAYSTTNGQ 142 577788899999*****************855689*******************644...5******************9988765 PP CBM32.hmm 86 dgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 g+ et ++d v aryvRlt+t+rat wg+s++El+ XRV68039.1|CBM32|GH16_3 143 GGD-ETLPLD--VAARYVRLTATQRAT-VWGVSLWELQ 176 454.466888..668*******99875.599*****86 PP == domain 2 score: 78.6 bits; conditional E-value: 2.8e-26 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgn 83 +++ + + + ++++a+D dp +rW+++ + w+ vdLg+p v++vvl+w a ++ y +evS+Dg++W++v ++++ XRV68039.1|CBM32|GH16_3 206 SQTLDPNCWDCTPDKALDLDPASRWATSpdTgwvdeGWIAVDLGAPAHVTQVVLQWdpAF---ATGYAIEVSDDGSSWRPVFSTTT 288 333444444578***************5441347788*******************6555...******************98766 PP CBM32.hmm 84 ttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + +eti++d +++r+vR+ +++r++ a+g+s++El+ XRV68039.1|CBM32|GH16_3 289 GSGF-KETIPLD--ADGRHVRVHMNDRSS-AYGYSLWELQ 324 4333.4799**9..568*******66654.79******86 PP == domain 3 score: -3.6 bits; conditional E-value: 0.8 CBM32.hmm 17 ggaenavDgdpntrWssa 34 +g+++ +Dg +t+++s+ XRV68039.1|CBM32|GH16_3 518 EGIQFSLDG-RDTFYASK 534 566667777.45777664 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (585 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.72 // Query: URN04766.1|CBM32|GH3 [L=1038] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-57 179.3 16.7 4.2e-31 94.2 3.2 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.2 3.2 4.2e-31 4.2e-31 7 123 .. 41 154 .. 35 155 .. 0.81 2 ! 90.1 5.7 7.9e-30 7.9e-30 9 123 .. 177 289 .. 171 290 .. 0.83 Alignments for each domain: == domain 1 score: 94.2 bits; conditional E-value: 4.2e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 ++sss+ ++ ++a+++vDgd++trWssa + qw+ +dLg+ +++++vvl+w a +++ ++++vS +g++Wt ++++++ + g+ + URN04766.1|CBM32|GH3 41 TASSSEGDA-YPASAVVDGDAGTRWSSAfSdpQWVRIDLGESRDISQVVLNWeaA---YATAFQIQVSGNGSDWTSIYSTTTGSGGN-Q 124 334455555.*****************85379********************744...5******************9887655433.3 PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ry+R+++t+rat +g+s++E++ URN04766.1|CBM32|GH3 125 TLDVT--GRGRYIRMYGTARAT-GYGYSLWEFS 154 44555..679*******88776.699*****96 PP == domain 2 score: 90.1 bits; conditional E-value: 7.9e-30 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtteti 92 ++ss++gg+++++a+Dg ++trWss+ qwl vdLg++tt+++v+l+w a +++ y++ vS Dg++Wtt++++++ + g URN04766.1|CBM32|GH3 177 TASSWEGGNAPAAALDGRTTTRWSSEAgdgQWLRVDLGGTTTITGVTLDWeaA---YATGYRLDVSGDGTSWTTLYSTTTGK-GG--VE 259 345567779*********9******84479********************744...5******************9876643.33..34 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 ++d + ++ry+R+ +t+rat +g+s +E++ URN04766.1|CBM32|GH3 260 NLDVTGKGRYIRFSGTDRAT-GYGYSFWEFQ 289 77766789*******88877.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1038 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 138.30 // Query: XQV60729.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-53 167.2 12.9 9.9e-30 89.8 3.5 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.8 3.5 9.9e-30 9.9e-30 7 123 .. 49 164 .. 43 165 .. 0.84 2 ! 82.0 2.0 2.5e-27 2.5e-27 4 123 .. 198 318 .. 194 319 .. 0.77 Alignments for each domain: == domain 1 score: 89.8 bits; conditional E-value: 9.9e-30 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++ss++ +g + ++ avDg+++trW+sa+ qw++vdLg++t v+++ ++w a +++ ++++ S++g+++t+++++++ t g XQV60729.1|CBM32|GH16_3 49 TASSTEVPGAYLPAEAVDGNTGTRWASAYsasQWFQVDLGTATAVSRIAINWeaA---YARAFTIQFSSNGSSYTQAYATTTGTGG 131 334555777799***************96689********************744...5******************887764433 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++i+++ taryvR++ t+ra + +g+s +E++ XQV60729.1|CBM32|GH16_3 132 -QQSIPVT--GTARYVRINLTQRALEIYGYSFWEFQ 164 .3588887..579*******99997679******96 PP == domain 2 score: 82.0 bits; conditional E-value: 2.5e-27 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass + ++ + + ++++a+D dp +rW+++ + w+ vdLg++ ++++vvl+w a+ ++ y+++vS +g++Wt + + XQV60729.1|CBM32|GH16_3 198 ASSWQ-NDVNCNPCSPDKAFDHDPASRWATSsTtgwvdpGWISVDLGATAQISQVVLQWdpAY---ATAYQIQVSGNGSSWTSIFS 279 45554.334444478***************6413457889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkra.tnawgasiaEla 123 +++ + g ++ i+ + t+ryvR+++ +a + +g+s++E++ XQV60729.1|CBM32|GH16_3 280 TTSGN-GLKDVINAT--GTGRYVRMYG--TArGGPYGYSLWEFS 318 76643.223455665..679*******..553446*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.96 // Query: XTB95898.1|CBM32|GH3 [L=1169] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-84 265.6 33.5 4.1e-32 97.5 7.1 3.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 97.5 7.1 4.1e-32 4.1e-32 8 123 .. 53 166 .. 47 167 .. 0.81 2 ! 91.2 5.5 3.6e-30 3.6e-30 7 123 .. 190 305 .. 184 306 .. 0.81 3 ! 88.3 5.0 2.9e-29 2.9e-29 9 123 .. 329 441 .. 322 442 .. 0.81 Alignments for each domain: == domain 1 score: 97.5 bits; conditional E-value: 4.1e-32 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttet 91 ++ss++++g +a++avDgd++trWssa qwl+vdLg+++++++v l+w a +++ ++++vS +g+tWt+++++++ + g ++t XTB95898.1|CBM32|GH3 53 TASSTENAGTPASAAVDGDAGTRWSSAAtdpQWLQVDLGSTQDITQVALNWeaA---YATAFTIQVSGNGTTWTDAYSTTTGP-GGHQT 137 3334444559****************84479********************744...5******************9877644.44345 PP CBM32.hmm 92 itfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +++ryvR+++t+rat +g+s++E++ XTB95898.1|CBM32|GH3 138 LDVT--ASGRYVRIYGTTRAT-GYGYSLWEFQ 166 5555..679*******88776.699*****96 PP == domain 2 score: 91.2 bits; conditional E-value: 3.6e-30 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgk.tWttvaekgnttdgtt 89 a++ss+++gg +a++avDg+++trWssa qwl+vdLg+++++ +v+ltw a +++ ++++vS+ g+ +Wt v++++ gt XTB95898.1|CBM32|GH3 190 ATASSTENGGTPATAAVDGNAGTRWSSAAtdpQWLQVDLGSAQDICQVSLTWetA---YATAFQIQVSDTGTgNWTSVYTTAAGGGGT- 274 445666677799***************84479********************644...5*********99977*****9876432243. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t+ryvR+++t+rat +g+s++E+a XTB95898.1|CBM32|GH3 275 --QNLTVSGTGRYVRMYGTARAT-GYGYSLWEFA 305 ..344433679*******88776.699*****96 PP == domain 3 score: 88.3 bits; conditional E-value: 2.9e-29 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtteti 92 s+ss++g +++++a+Dg +ntrWss + qwl+vdLg+ tv++v+l+w a +++ y + vS+D +tW +++++++ + g XTB95898.1|CBM32|GH3 329 SASSWEGANAPAAALDGRTNTRWSSLYtdsQWLQVDLGGRATVTGVSLNWesA---YATGYHLDVSDDATTWSPLYSTTSGK-GG--VE 411 4566677799***************64468********************644...5******************9887643.33..23 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ + ++ryvRlt+t+rat +g+s++E++ XTB95898.1|CBM32|GH3 412 NLTVNGKGRYVRLTGTARAT-GYGYSLWEFQ 441 55544789*******88776.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1169 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 110.04 // Query: UWZ49939.1|CBM32|GH16_3 [L=694] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-83 261.8 37.3 3e-32 97.9 4.8 4.1 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.1 7.1 1.9e-30 1.9e-30 7 123 .. 27 141 .. 22 142 .. 0.82 2 ! 97.9 4.8 3e-32 3e-32 9 123 .. 167 278 .. 159 279 .. 0.82 3 ! 87.1 4.7 6.7e-29 6.7e-29 4 123 .. 319 439 .. 315 440 .. 0.78 4 ? -1.5 0.2 0.18 0.18 54 54 .. 510 510 .. 466 560 .. 0.44 Alignments for each domain: == domain 1 score: 92.1 bits; conditional E-value: 1.9e-30 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++ss+++a+ +a+ a+Dg+++trWssa + qw++vdLg+++++++v l+w a +++ +++++S+D +Wt+++++++ t g UWZ49939.1|CBM32|GH16_3 27 TASSAESAA-TPASSATDGNAGTRWSSAfTvpQWIQVDLGSQQSITRVALNWeaA---YATAFTIQTSNDAANWTQIYSTTTGTGG 108 233334555.89***************85479********************744...5******************988765545 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + +++++ + ++ryvRl++t+++t ++g s++El+ UWZ49939.1|CBM32|GH16_3 109 S--DVSLAVTGSGRYVRLNATAKST-QYGISLWELQ 141 5..6788766789*******66544.7*******86 PP == domain 2 score: 97.9 bits; conditional E-value: 3e-32 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 ss+++ag +a+ a+Dg+++trWssa qwl vdLg+++ v +v+l+w a +++ +++++S+Dg+tWt ++++++ t g UWZ49939.1|CBM32|GH16_3 167 SSTENAG-TPAASAFDGNTGTRWSSAAsdpQWLRVDLGSVQAVCGVTLNWeaA---YATAFQLQTSNDGNTWTSIYTTTTGT-GG- 246 3344555.9****************84479********************744...5******************9887644.33. PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ + ++ryvR+++t+rat ++g+s++E++ UWZ49939.1|CBM32|GH16_3 247 --VqNLNVTGSGRYVRVNGTARAT-QYGYSLWEFQ 278 ..3356544679*******77766.89******96 PP == domain 3 score: 87.1 bits; conditional E-value: 6.7e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa...g....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as+++ ++++ + ++++a+D+dp +rW+++ g w++vdLg++ +++vvl+w a+ + +y++++StD +Wt +++ UWZ49939.1|CBM32|GH16_3 319 ASTSQ-NDTNCNPCTPDKAFDNDPASRWATSpdnGwvdpGWIYVDLGATAHITQVVLQWdpAY---AVSYQIQTSTDAVNWTSIYT 400 44444.444444478***************5443147788*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ + +et t++ ++ryvR+++t+r++ +g+s++E++ UWZ49939.1|CBM32|GH16_3 401 TTTGKGF-KETLTVN--GNGRYVRMYGTQRSN-GYGYSLWEFK 439 8764333.3455666..568*******77754.799*****96 PP == domain 4 score: -1.5 bits; conditional E-value: 0.18 CBM32.hmm 54 t 54 UWZ49939.1|CBM32|GH16_3 510 V 510 0 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (694 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.82 // Query: WVH81250.1|CBM32|GH16_3 [L=569] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-57 179.0 13.8 1.9e-31 95.3 3.8 2.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 95.3 3.8 1.9e-31 1.9e-31 7 123 .. 42 155 .. 36 156 .. 0.82 2 ! 89.2 1.0 1.5e-29 1.5e-29 13 123 .. 185 297 .. 173 298 .. 0.78 3 ? -1.6 0.0 0.19 0.19 67 80 .. 505 518 .. 482 535 .. 0.63 Alignments for each domain: == domain 1 score: 95.3 bits; conditional E-value: 1.9e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++sss++a+ ++a++avDgd++trWss+ + qw+++dLg+ +vd+vvl w a ++ y++++S Dg++W+++ +++ + g WVH81250.1|CBM32|GH16_3 42 TASSSENAA-FAATAAVDGDAGTRWSSTfSdpQWIQIDLGSSARVDQVVLAWetA---SARAYTLSISPDGTNWRELRRTTTGPGG 123 344566677.*****************85379********************644...5******************765554324 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t et ++ t+ryvRl t+rat +wg+s++E++ WVH81250.1|CBM32|GH16_3 124 T-ETLAVT--GTGRYVRLDLTQRAT-QWGYSLWEFQ 155 4.344555..679*******99887.8*******96 PP == domain 2 score: 89.2 bits; conditional E-value: 1.5e-29 CBM32.hmm 13 aaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 + g ++++a+D dp trW+++ + w+ vdLg+p +++kvvl+w a ++ y++evS+D+ +W++++++++ + WVH81250.1|CBM32|GH16_3 185 NCGRCTPAKAFDRDPATRWATSptNgwvdpGWISVDLGAPAQISKVVLQWdpAF---ATAYRLEVSDDNVNWRQIYSTTTGRGF-K 266 445567***************5431347888*******************6555...******************987653323.3 PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ryvR+++t+r +n +g+s++E++ WVH81250.1|CBM32|GH16_3 267 ETLTVS--GTGRYVRMYGTAR-SNGYGYSLWEFQ 297 456776..578*******665.55799*****96 PP == domain 3 score: -1.6 bits; conditional E-value: 0.19 CBM32.hmm 67 evStDgktWttvae 80 S Dg+ + tv+ WVH81250.1|CBM32|GH16_3 505 TFSVDGTRFFTVDR 518 36789999999864 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (569 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.78 // Query: WYH80281.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-60 187.2 9.7 2.1e-33 101.6 1.5 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 101.6 1.5 2.1e-33 2.1e-33 7 123 .. 47 160 .. 41 161 .. 0.83 2 ! 89.1 1.5 1.5e-29 1.5e-29 4 123 .. 184 304 .. 181 305 .. 0.80 3 ? -2.8 0.0 0.46 0.46 83 105 .. 553 575 .. 548 576 .. 0.67 Alignments for each domain: == domain 1 score: 101.6 bits; conditional E-value: 2.1e-33 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++++ ++a navDgdp+trWssa + qw+ +dLg+ t v ++vl+w a ++k y++e S Dg++Wtt++++++ t g WYH80281.1|CBM32|GH16_3 47 ATASSAEGP-FTAPNAVDGDPGTRWSSAfSddQWIRIDLGASTAVGQIVLNWeaA---YAKGYRIELSADGQQWTTIHSTTTGTGG 128 333444455.*****************85369********************744...5******************988765434 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t et t++ t+r++Rl++t+rat wg+s++E++ WYH80281.1|CBM32|GH16_3 129 T-ETLTVS--GTGRHIRLVGTERAT-PWGYSLYEFQ 160 4.455666..579*******88876.8*******96 PP == domain 2 score: 89.1 bits; conditional E-value: 1.5e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekg 82 as++++ s+ ++ ++++a+D dp +rW+++ + w+ vdLg+p t+++vvl+w+ +++ y++evS++g++W+ +++++ WYH80281.1|CBM32|GH16_3 184 ASTSQHDSTCWQ-CTPDKAFDRDPASRWATSpeggWtdpGWIAVDLGAPATINRVVLQWDP-AHARAYRIEVSDNGTDWRMIHQTT 267 455555566555.89***************5443326788*******************54.56******************9876 PP CBM32.hmm 83 nttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + t +et +++ t+r+vRl++t+r+ +++g+s++E++ WYH80281.1|CBM32|GH16_3 268 TGTGF-KETLNVS--GTGRHVRLYATQRS-GEYGYSLWEFQ 304 64433.2456776..679*******7765.479******96 PP == domain 3 score: -2.8 bits; conditional E-value: 0.46 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRl 105 +++ ++ +t++f+++ ++ y+++ WYH80281.1|CBM32|GH16_3 553 DWPGpPD-TTTRFPQKLSVDYIKV 575 5554343.3669998888999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.65 // Query: XHM89191.1|CBM32|GH16_3 [L=473] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-33 101.6 9.1 2.3e-33 101.5 5.6 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.7 0.1 0.037 0.037 70 83 .. 271 285 .. 245 303 .. 0.66 2 ! 101.5 5.6 2.3e-33 2.3e-33 8 123 .. 356 469 .. 351 470 .. 0.82 Alignments for each domain: == domain 1 score: 0.7 bits; conditional E-value: 0.037 CBM32.hmm 70 tDgktWttvaekg.n 83 Dg+++ tv++ + + XHM89191.1|CBM32|GH16_3 271 LDGTNYFTVKSNQvD 285 599999999643322 PP == domain 2 score: 101.5 bits; conditional E-value: 2.3e-33 CBM32.hmm 8 essssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 ++ss ++++++a++avDg++++rWssa + qwl+vdLg+++t+++v+l+w a ++k +++++StDg++Wtt++++++ t g XHM89191.1|CBM32|GH16_3 356 TASSVENASFPATAAVDGSTTSRWSSAfSdpQWLQVDLGATHTISQVNLNWeaA---YAKAFQIQTSTDGTNWTTIYSTTSGT-GG 437 344555666*********9999****85379********************744...5******************9887644.33 PP CBM32.hmm 89 teti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ ++ryvR+++t+rat ++g+s++E++ XHM89191.1|CBM32|GH16_3 438 ---VqNLSVSGSGRYVRMYGTQRAT-QYGYSLYEFQ 469 ...2255544678*******99887.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (473 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.34 // Query: XIE81712.1|CBM32 [L=145] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-34 105.0 0.7 2.3e-34 104.7 0.7 1.0 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 104.7 0.7 2.3e-34 2.3e-34 8 123 .. 25 139 .. 20 140 .. 0.84 Alignments for each domain: == domain 1 score: 104.7 bits; conditional E-value: 2.3e-34 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd.gttetit 93 ++ss +a+g +a++avDg+ ++rW+sa+ qwl vdLg+p +++++l+w a ++++y++++S Dg+tWt+++++++ d gt +++ XIE81712.1|CBM32 25 TASSVEAAGLEADKAVDGQSTSRWASAEgidpQWLRVDLGAPAALSRIRLDWeaA---YARSYRLQGSLDGTTWTDLHSTTSG-DgGT-DDVA 112 4456667779********9999****855789********************744...5******************988764.3254.6777 PP CBM32.hmm 94 fdkpvtaryvRltvtkratnawgasiaEla 123 ++ taryvR+++t+rat +g+s++E++ XIE81712.1|CBM32 113 VT--GTARYVRVYGTQRAT-PYGYSLYEFK 139 77..579*******88876.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (145 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 31.82 // Query: BFO17211.1|CBM32 [L=260] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-27 80.7 0.4 6.4e-27 80.7 0.4 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 80.7 0.4 6.4e-27 6.4e-27 11 123 .. 45 187 .. 36 188 .. 0.74 2 ? -1.6 0.1 0.19 0.19 70 88 .. 223 239 .. 214 257 .. 0.57 Alignments for each domain: == domain 1 score: 80.7 bits; conditional E-value: 6.4e-27 CBM32.hmm 11 ssaaggggaenavDg.......dpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt... 88 +++ag +++++++Dg +++rWss++ w+ vdLg+ tvd++ l+w a ++ dy+++vS+D+ tW+tv+ + ++ + BFO17211.1|CBM32 45 YQHAG-NSPAFVTDGgrpadlkADQSRWSSDWnadRWVSVDLGARSTVDTIDLYWeaA---YAVDYELQVSDDNRTWRTVYRPSAAEVASrra 133 44555.99*******77764422459****866899*******************744...5******************9543322222355 PP CBM32.hmm 89 ......t.....etitfdkpvtaryvRltvtk........ratnawgasiaEla 123 + ++i++++p+t+ryvR+ +++ at ++g+s++E++ BFO17211.1|CBM32 134 nvkspgEavgvrDSIRLPQPATGRYVRMLGKErrsfynpaPATAQFGYSLYEFE 187 555444155553599***************77656665433355789*****96 PP == domain 2 score: -1.6 bits; conditional E-value: 0.19 CBM32.hmm 70 tDgktWttvaekgnttdgt 88 D +W++v + ++ g+ BFO17211.1|CBM32 223 LDRAKWRVVRTGTEM--GS 239 578889988654432..33 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (260 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 48.90 // Query: WUY02470.1|CBM32|GH16_3 [L=578] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-58 182.5 11.1 3e-32 97.9 2.8 2.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 97.9 2.8 3e-32 3e-32 9 123 .. 48 160 .. 41 161 .. 0.83 2 ! 87.9 1.5 3.7e-29 3.7e-29 4 123 .. 185 305 .. 181 306 .. 0.77 3 ? -2.1 0.0 0.28 0.28 83 106 .. 554 577 .. 547 578 .] 0.68 Alignments for each domain: == domain 1 score: 97.9 bits; conditional E-value: 3e-32 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 ++ss++g++ga++avDgd+ trWssa g +wl +dLg+ t++ +vvl+w a ++k y++evS +g++Wtt++++++ g WUY02470.1|CBM32|GH16_3 48 TASSTEGTFGAAAAVDGDTATRWSSAfGddEWLRIDLGASTSIGQVVLDWeaA---YAKGYRLEVSGNGSDWTTIHSTTTGAGGV- 129 34555677*****************853699*******************744...5******************9876643233. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ry+R+ +t+rat awg+s++E++ WUY02470.1|CBM32|GH16_3 130 ETLTVS--GTGRYIRMHGTERAT-AWGYSLHEFQ 160 455666..579*******88876.7*******96 PP == domain 2 score: 87.9 bits; conditional E-value: 3.7e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekg 82 as++++ + + ++++a+D dp +rW+++ + w+ vdLg+ ++++vvl+w+ +++ y++evS++g++Wtt++e++ WUY02470.1|CBM32|GH16_3 185 ASTSQHDGT-CWECSPDKAFDRDPASRWATSpeggWtdpGWIAVDLGARAEINRVVLQWDP-AHARAYRIEVSDNGTDWTTIHETA 268 334433333.44478***************5443326788*******************54.56******************9887 PP CBM32.hmm 83 nttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + t + et +++ t+r+vRl++t+r+ +++g+s++E++ WUY02470.1|CBM32|GH16_3 269 SGTGFK-ETLDVS--GTGRHVRLYATQRS-GEYGYSLWEFQ 305 644322.344555..679*******7765.479******96 PP == domain 3 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 83 nttd.gtte.titfdkpvtaryvRlt 106 +++ + + t++f+++ ++ y+++ WUY02470.1|CBM32|GH16_3 554 DWPGpP--DaTTRFPQKMSVDYIKVW 577 554333..337799988999999985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (578 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.73 // Query: WNV84132.1|CBM32|GH16_3 [L=596] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-53 164.7 19.8 2.6e-29 88.4 5.6 3.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.4 5.6 2.6e-29 2.6e-29 4 123 .. 54 167 .. 48 168 .. 0.82 2 ! 84.2 2.6 5.1e-28 5.1e-28 5 123 .. 201 322 .. 197 323 .. 0.80 3 ? -1.9 0.1 0.24 0.24 59 77 .. 370 389 .. 353 404 .. 0.70 Alignments for each domain: == domain 1 score: 88.4 bits; conditional E-value: 2.6e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnt 84 ass + ++ + a+ avDgd++trWss g qwl vdLg++++v + +l+w a +++ y++++S Dg+ Wt+v+++++ WNV84132.1|CBM32|GH16_3 54 ASSV---EVGSP-FVATSAVDGDAGTRWSSVpGdpQWLRVDLGSTQNVCGATLNWeaA---YATAYQIQTSADGNAWTQVYSTTTS 132 3333...34445.99***************533589*******************744...5******************987664 PP CBM32.hmm 85 tdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t g ++++f+ ++ry+R++ t+rat +wg+s++E+a WNV84132.1|CBM32|GH16_3 133 TGGV-QNVSFT--GSGRYIRVNTTARAT-QWGVSLWEFA 167 4344.578999..568*******77766.8*******96 PP == domain 2 score: 84.2 bits; conditional E-value: 5.1e-28 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag.......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgk.tWttvae 80 +s+++++++ gg + ++a+D dp trW++a+ w++vdLg++ +++kvvl+w a k+y+++vS +g+ +Wt++++ WNV84132.1|CBM32|GH16_3 201 ASTQQNDANCGGCTTDKAFDFDPATRWATATdvgwvdpGWIQVDLGATAQIHKVVLQWdpAF---GKSYEIQVSPNGTgNWTPIYS 283 34455666677799***************6334457889*******************6555...9********99977*****98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + +t t++ ++ryvR+++t+r + a+g+s++E++ WNV84132.1|CBM32|GH16_3 284 TTTSTGFK-QTLTVN--GSGRYVRMYGTARGS-AYGYSLWEFQ 322 87654333.455666..568*******66543.69******96 PP == domain 3 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 59 grikdykvevS.tDgktWtt 77 g+ ++ ++++ ++++t+t+ WNV84132.1|CBM32|GH16_3 370 GTGQNAELQYYtNNNNTFTD 389 66777888877344566665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (596 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.47 // Query: XIJ14715.1|CBM32|GH16_3 [L=569] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-55 170.7 16.0 1.2e-31 95.9 3.1 2.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 95.9 3.1 1.2e-31 1.2e-31 8 123 .. 43 155 .. 36 156 .. 0.81 2 ! 82.4 2.3 1.9e-27 1.9e-27 5 123 .. 178 297 .. 173 298 .. 0.76 3 ? -2.8 0.0 0.45 0.45 68 80 .. 506 518 .. 486 531 .. 0.69 Alignments for each domain: == domain 1 score: 95.9 bits; conditional E-value: 1.2e-31 CBM32.hmm 8 essssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 +sss++ + +ga++avDgd++trWss+ + qw+++dLg+ +vd+vvl w a ++ y++++S Dg++W+++ +++ + g XIJ14715.1|CBM32|GH16_3 43 ASSSENVA-FGAAAAVDGDAGTRWSSTfSdpQWIQIDLGSSARVDQVVLAWetA---SARAYTLSISADGNSWQELRRTTTGP-GG 123 33444555.*****************85379********************644...5******************7655543.33 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEla 123 t t++ + t+ryvRl t+rat +wg+s++E++ XIJ14715.1|CBM32|GH16_3 124 --TETLPVTGTGRYVRLDLTQRAT-QWGYSLWEFQ 155 ..3455544679*******99887.8*******96 PP == domain 2 score: 82.4 bits; conditional E-value: 1.9e-27 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaek 81 ss++ +++ + + +a+D dp +rW+++ + w+ vdLg++ +++kvvl+w a ++ y++evS+D+ +W++++++ XIJ14715.1|CBM32|GH16_3 178 SSSQ-DDGTCWQCFPVRAFDRDPASRWATSpvngWvdpGWISVDLGATAQISKVVLQWdaAF---ATAYRLEVSDDNANWRQIYST 259 3333.23333335699*************5443337788*******************7445...******************987 PP CBM32.hmm 82 gnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++ +et t+ t+ryvR+++t+r +n +g+s++E++ XIJ14715.1|CBM32|GH16_3 260 TTGRGF-KETLTVG--GTGRYVRMYGTAR-SNGYGYSLWEFQ 297 653322.2455665..679*******665.55799*****96 PP == domain 3 score: -2.8 bits; conditional E-value: 0.45 CBM32.hmm 68 vStDgktWttvae 80 S Dg+ + tv+ XIJ14715.1|CBM32|GH16_3 506 FSVDGNRFFTVDR 518 5788888888864 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (569 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.04 // Query: WOP13376.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-59 183.8 8.3 3.1e-32 97.9 1.6 2.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 97.9 1.6 3.1e-32 3.1e-32 7 123 .. 47 160 .. 41 161 .. 0.82 2 ! 88.7 0.9 2.1e-29 2.1e-29 5 123 .. 185 304 .. 181 305 .. 0.78 3 ? -3.4 0.0 0.68 0.68 83 105 .. 553 575 .. 548 576 .. 0.66 Alignments for each domain: == domain 1 score: 97.9 bits; conditional E-value: 3.1e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++++ ++a navDg+ +trWss+ + qw+ +dLg+ t v +vvl+w a ++k y+++ S Dg++Wtt++++++ t g WOP13376.1|CBM32|GH16_3 47 ATASSAEGP-FTAPNAVDGNRGTRWSSEfTddQWIRIDLGTSTAVGQVVLDWeaA---YAKGYRIQLSADGQQWTTIHSTTTGTGG 128 333444455.*****************85369********************744...5******************988764423 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et ++ t+ry+Rl +t+rat wg+s++E++ WOP13376.1|CBM32|GH16_3 129 V-ETLAVS--GTGRYIRLLGTQRAT-PWGYSLHEFQ 160 3.344555..679*******88876.8*******96 PP == domain 2 score: 88.7 bits; conditional E-value: 2.1e-29 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaek 81 s++++ + + + g+++a+D dp +rW+++ + w+ vdLg+ ++++vvl+w a+ ++ y++evS++g++W+t++++ WOP13376.1|CBM32|GH16_3 185 STSQHDGTCW-ECGPDKAFDRDPASRWATSpeggWtdpGWIAVDLGARAEIRRVVLQWdpAY---ARAYRIEVSDNGTDWRTIHQT 266 4444444444.488***************5443326788*******************6555...******************987 PP CBM32.hmm 82 gnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++ t +et +++ t+r+vRl++t+r+ +++g+s++E++ WOP13376.1|CBM32|GH16_3 267 TTGTGF-KETLNVT--GTGRHVRLYATQRS-GQYGYSLWEFQ 304 664433.2455666..679*******7765.47*******96 PP == domain 3 score: -3.4 bits; conditional E-value: 0.68 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRl 105 +++ ++ t++f+++ ++ y+++ WOP13376.1|CBM32|GH16_3 553 DWPGpPD-STTRFPQKLSVDYIKV 575 5554333.3669998888999997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.58 // Query: UWE12062.1|CBM32|GH16_3 [L=475] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-35 106.7 7.5 5.5e-35 106.7 7.5 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.1 0.27 0.27 70 81 .. 271 282 .. 249 297 .. 0.66 2 ! 106.7 7.5 5.5e-35 5.5e-35 5 123 .. 355 471 .. 351 472 .. 0.86 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.27 CBM32.hmm 70 tDgktWttvaek 81 Dg ++ tv ++ UWE12062.1|CBM32|GH16_3 271 LDGANYFTVNST 282 588888888543 PP == domain 2 score: 106.7 bits; conditional E-value: 5.5e-35 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgntt 85 ++a++ss+++g+++a+navDg+++trWssa + qw++vdLg+ +t+++v+l+w a + k +++++S +g++Wttv+++++ t UWE12062.1|CBM32|GH16_3 355 KTATASSTENGSFPAANAVDGNTGTRWSSAfSdpQWIQVDLGASHTISQVKLNWeaA---YGKAFQIQTSANGTSWTTVYSTTTGT 437 456667778888*****************85379********************744...5******************9887755 PP CBM32.hmm 86 dgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 g+ +ti+++ ++ryvR+++t+rat a+g+s++E++ UWE12062.1|CBM32|GH16_3 438 GGN-QTIDVS--GSGRYVRVYGTQRAT-AYGYSLYEFQ 471 533.588888..568*******99876.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (475 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.05 // Query: WDT90482.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-57 178.3 13.3 6.8e-32 96.8 2.7 2.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.8 2.7 6.8e-32 6.8e-32 7 123 .. 47 160 .. 41 161 .. 0.84 2 ! 87.1 1.7 6.9e-29 6.9e-29 4 123 .. 184 304 .. 180 305 .. 0.77 3 ? -1.5 0.0 0.17 0.17 83 105 .. 553 575 .. 500 577 .] 0.66 Alignments for each domain: == domain 1 score: 96.8 bits; conditional E-value: 6.8e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++a+ ++a avDgd++trWss+ + +w+ +dLg+ t++ +vvl+w a ++k y++evS +g++Wtt++e+++ + g WDT90482.1|CBM32|GH16_3 47 ATASSTEAP-FTAPSAVDGDTSTRWSSGfTddEWIRIDLGASTSIGQVVLDWeaA---YAKGYRLEVSGNGTDWTTIHETTTGSGG 128 455677788.*****************853699*******************744...5******************988764324 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ry+R+ +t+rat wg+s++E++ WDT90482.1|CBM32|GH16_3 129 V-ETLTVS--GTGRYIRMHGTERAT-PWGYSLHEFQ 160 3.455666..579*******88876.8*******96 PP == domain 2 score: 87.1 bits; conditional E-value: 6.9e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as++++ + + ++++a+D dp +rW+++ + w+ vdLg+ ++++vvl+w a+ ++ y++evS++g +Wtt++e WDT90482.1|CBM32|GH16_3 184 ASTSQHDGT-CWECSPDKAFDRDPASRWATSpeggWtdpGWIAVDLGARAEISRVVLQWdpAY---ARAYRIEVSDNGADWTTIHE 265 334433333.44478***************5443326788*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + et +++ t+r+vRl++t r ++++g+s++E++ WDT90482.1|CBM32|GH16_3 266 TTTGTGFK-ETLDVS--GTGRHVRLYATRR-SGEYGYSLWEFQ 304 87644322.344555..679*******665.5579******96 PP == domain 3 score: -1.5 bits; conditional E-value: 0.17 CBM32.hmm 83 nttd.gtte.titfdkpvtaryvRl 105 +++ + + t++f+++ t y+++ WDT90482.1|CBM32|GH16_3 553 DWPGpP--DaTTRFPQKMTIDYIKV 575 333222..22556666666677766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 72.61 // Query: XRK05042.1|CBM32|GH16_3 [L=582] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-56 176.6 16.2 3.2e-31 94.6 5.9 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.6 5.9 3.2e-31 3.2e-31 8 123 .. 47 159 .. 41 160 .. 0.83 2 ! 86.7 2.6 8.6e-29 8.6e-29 4 123 .. 195 315 .. 192 316 .. 0.80 Alignments for each domain: == domain 1 score: 94.6 bits; conditional E-value: 3.2e-31 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 +sss++ + ++a++avDg+++trWss+ qw++vdLg++ t+++vvl+w a + k +++++S D tWt ++++++ g+ XRK05042.1|CBM32|GH16_3 47 ASSSENVA-FPATAAVDGNAGTRWSSGFadpQWIQVDLGATATITQVVLNWeaA---YGKAFQIQTSADAATWTSIYTTTTGAGGN 128 33444555.*****************84469********************744...5******************9887655433 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEla 123 +t ++ ++ryvR+++t+r+t ++g+s++E++ XRK05042.1|CBM32|GH16_3 129 -QTLAVN--GSGRYVRMYGTQRST-QYGYSLWEFQ 159 .355666..578*******99877.79******96 PP == domain 2 score: 86.7 bits; conditional E-value: 8.6e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass++s + + ++++a+D dp +rW+++ + w++vdLg++ +++kv l+w a+ +k ++++vS D ++Wt +++ XRK05042.1|CBM32|GH16_3 195 ASSSQSDGNCYE-CTPARAFDRDPASRWATSsTtgwvdpGWIYVDLGATAQIHKVILQWdpAY---AKAFQIQVSPDATNWTSIYS 276 455554444444.88***************6413457889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + +t t++ t+ryvR+++t+r++ a+g+s++E++ XRK05042.1|CBM32|GH16_3 277 TTTGTGFK-QTLTVN--GTGRYVRMYGTQRSS-AYGYSLWEFQ 315 87644332.455666..578*******88875.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (582 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.29 // Query: UFR07001.1|CBM32|GH16_3 [L=576] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-58 182.2 11.6 3.7e-32 97.6 0.6 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 97.6 0.6 3.7e-32 3.7e-32 10 123 .. 45 155 .. 40 156 .. 0.84 2 ! 88.4 4.7 2.7e-29 2.7e-29 4 123 .. 183 303 .. 179 304 .. 0.79 Alignments for each domain: == domain 1 score: 97.6 bits; conditional E-value: 3.7e-32 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 ss++++ +ga avDg+p trWssa + qw+ vdLg+p ++++v+l+w a + k ++++vS+D +tW tv+e+++ t gt + UFR07001.1|CBM32|GH16_3 45 SSTEDP-FGAPGAVDGNPATRWSSAfSdpQWIRVDLGAPARISRVTLQWeaA---YGKAFRIQVSDDAETWSTVHETTDGTGGT-Q 125 455677.9****************85379********************744...5*******************998755444.4 PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEla 123 + t++ +t+ryvR+++t+r t +g+s++E++ UFR07001.1|CBM32|GH16_3 126 NLTLS--ATGRYVRMYGTQRGT-GYGFSLWEFQ 155 55776..579*******88766.599*****96 PP == domain 2 score: 88.4 bits; conditional E-value: 2.7e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass++ s+++ + ++++a+D dp +rW+++ + w+ vdLg++ +++kvvl+w a+ +k+++++vS++g++Wt+v++ UFR07001.1|CBM32|GH16_3 183 ASSSQ-SDQNCWECTPARAFDRDPASRWATSstTgwtdpGWISVDLGATAQISKVVLQWdpAY---AKSFQIQVSSNGTDWTPVYS 264 44554.445555599***************5331456889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + +t ++ t+ryvR+++t+rat +g+s++E++ UFR07001.1|CBM32|GH16_3 265 TTSGTGFK-QTLAVS--GTGRYVRMYGTERAT-PYGYSLWEFQ 303 87644322.355665..679*******88876.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (576 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.56 // Query: WRO08374.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-59 185.3 8.8 1.6e-32 98.8 1.9 2.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.8 1.9 1.6e-32 1.6e-32 7 123 .. 47 160 .. 41 161 .. 0.82 2 ! 89.5 0.9 1.2e-29 1.2e-29 5 123 .. 185 304 .. 181 305 .. 0.78 3 ? -3.4 0.0 0.68 0.68 83 105 .. 553 575 .. 548 576 .. 0.66 Alignments for each domain: == domain 1 score: 98.8 bits; conditional E-value: 1.6e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++++ ++a navDg+ +trWss+ + qw+ +dLg+ t v +vvl+w a ++k y+++ S Dg++Wtt++++++ t g WRO08374.1|CBM32|GH16_3 47 ATASSAEGP-FTAPNAVDGNRGTRWSSEfTddQWIRIDLGTSTAVGQVVLDWeaA---YAKGYRIQLSADGQQWTTIHSTTTGTGG 128 333444455.*****************85369********************744...5******************988764423 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ry+Rl +t+rat wg+s++E++ WRO08374.1|CBM32|GH16_3 129 V-ETLTVS--GTGRYIRLLGTQRAT-PWGYSLHEFQ 160 3.455666..579*******88876.8*******96 PP == domain 2 score: 89.5 bits; conditional E-value: 1.2e-29 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaek 81 s++++ + + + g+++a+D dp +rW+++ + w+ vdLg+ ++++vvl+w a+ ++ y++evS++g++W+t++++ WRO08374.1|CBM32|GH16_3 185 STSQHDGTCW-ECGPDKAFDRDPASRWATSpeggWtdpGWIAVDLGARAEIHRVVLQWdpAY---ARAYRIEVSDNGTDWRTIHQT 266 4444444444.488***************5443326788*******************6555...******************987 PP CBM32.hmm 82 gnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++ t +et +++ t+r+vRl++t+r+ +++g+s++E++ WRO08374.1|CBM32|GH16_3 267 TTGTGF-KETLNVT--GTGRHVRLYATQRS-GQYGYSLWEFQ 304 664433.2455666..679*******7765.47*******96 PP == domain 3 score: -3.4 bits; conditional E-value: 0.68 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRl 105 +++ ++ t++f+++ ++ y+++ WRO08374.1|CBM32|GH16_3 553 DWPGpPD-STTRFPQKLSVDYIKV 575 5554333.3669998888999997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.84 // Query: XKK47680.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-59 184.9 8.8 1.4e-32 99.0 2.0 2.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 99.0 2.0 1.4e-32 1.4e-32 7 123 .. 47 160 .. 41 161 .. 0.82 2 ! 88.9 0.9 1.8e-29 1.8e-29 5 123 .. 185 304 .. 181 305 .. 0.78 3 ? -3.4 0.0 0.68 0.68 83 105 .. 553 575 .. 548 576 .. 0.66 Alignments for each domain: == domain 1 score: 99.0 bits; conditional E-value: 1.4e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++++ ++a navDg+ +trWss+ + qw+ +dLg++t v +vvl+w a ++k y+++ S Dg++Wtt++++++ t g XKK47680.1|CBM32|GH16_3 47 ATASSAEGP-FTAPNAVDGNRGTRWSSEfTddQWIRIDLGTNTAVGQVVLDWeaA---YAKGYRIQLSADGQQWTTIHSTTTGTGG 128 333444455.*****************85369********************744...5******************988764423 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ry+Rl +t+rat wg+s++E++ XKK47680.1|CBM32|GH16_3 129 V-ETLTVS--GTGRYIRLLGTQRAT-PWGYSLHEFQ 160 3.455666..579*******88876.8*******96 PP == domain 2 score: 88.9 bits; conditional E-value: 1.8e-29 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaek 81 s++++ + + + g+++a+D dp +rW+++ + w+ vdLg+ ++++vvl+w a+ ++ y++evS++g++W+t++++ XKK47680.1|CBM32|GH16_3 185 STSQHDGTCW-ECGPDKAFDRDPASRWATSpeggWtdpGWIAVDLGARAEIHRVVLQWdpAY---ARAYRIEVSDNGTDWRTIHQT 266 4444444444.488***************5443326788*******************6555...******************987 PP CBM32.hmm 82 gnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++ t +et +++ t+r+vRl++t+r+ +++g+s++E++ XKK47680.1|CBM32|GH16_3 267 TTGTGF-KETLNVT--GTGRHVRLYATQRS-GEYGYSLWEFQ 304 664433.2455666..679*******7765.479******96 PP == domain 3 score: -3.4 bits; conditional E-value: 0.68 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRl 105 +++ ++ t++f+++ ++ y+++ XKK47680.1|CBM32|GH16_3 553 DWPGpPD-STTRFPQKLSVDYIKV 575 5554333.3669998888999997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.21 // Query: XDS63112.1|CBM32|GH16_3 [L=560] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-53 166.8 16.2 2.2e-29 88.6 8.3 3.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.6 8.3 2.2e-29 2.2e-29 8 123 .. 43 156 .. 37 157 .. 0.82 2 ! 81.0 0.6 5e-27 5e-27 4 123 .. 179 299 .. 173 300 .. 0.78 3 ? -0.4 0.0 0.082 0.082 41 107 .. 333 406 .. 306 422 .. 0.52 Alignments for each domain: == domain 1 score: 88.6 bits; conditional E-value: 2.2e-29 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 ++ss++ +++ +navDgdp+trWss+ qw+ vdLg+++ +d+vvl+w a +++ +++e+S Dg W t++++++ t g+ XDS63112.1|CBM32|GH16_3 43 TTSSTEFDWSTGANAVDGDPGTRWSSTAadnQWIRVDLGSVQAIDRVVLDWeaA---YASGFRIETSADGAAWSTIYSTTTGTGGD 125 345555566899**************84579********************744...5******************9887654343 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++d + ++ry+Rl vt+rat +wg+s++El+ XDS63112.1|CBM32|GH16_3 126 ---QNLDVDGSGRYLRLWVTQRAT-QWGVSLWELQ 156 ...355544679*******99887.8*******96 PP == domain 2 score: 81.0 bits; conditional E-value: 5e-27 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass+++ + + +a++a+D dp +rW+ + + w+ vdLg++ +++vvl+w a ++ +++evS+Dg+tW+tv++ XDS63112.1|CBM32|GH16_3 179 ASSSQHDGTCWL-CAADKALDLDPASRWAVSpdTgwvdeGWIAVDLGAAAHISSVVLQWdpAF---ATAFDIEVSDDGTTWRTVHT 260 333333333333.45*************995441347788*******************6555...******************99 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkra.tnawgasiaEla 123 +++ t ++ti++d +++r+vR+ + r ++ +g+s++E++ XDS63112.1|CBM32|GH16_3 261 TTGGTGF-KQTIPLD--ADGRHVRVHM--RDrSGPYGYSLWEFQ 299 8865433.3699**9..568*******..665668*******96 PP == domain 3 score: -0.4 bits; conditional E-value: 0.082 CBM32.hmm 41 dLgkpttvdkvvltwaengrikdykvevSt.......Dgk.tWttvaekg.nttdgt....te..ti.tfdkpvtaryvRltv 107 g+p + +k+++++ g + + ++ev t Dg+ +++ a ++ n+ g ++ t tf +++y R+++ XDS63112.1|CBM32|GH16_3 333 AAGTPANASKWTIDP---GLPANNELEVYTpsgngfhDGQgNFVLEARREdNQ--GRqytsHRmnTSgTF----NTQYGRFEA 406 456677777777775...22344444444333433444432444223333122..222222111122233....346666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (560 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 63.59 // Query: XDP77318.1|CBM32|GH16_3 [L=541] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-56 175.3 11.7 7.7e-31 93.4 2.8 2.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.4 2.8 7.7e-31 7.7e-31 9 123 .. 10 122 .. 4 123 .. 0.83 2 ! 86.0 1.7 1.4e-28 1.4e-28 4 123 .. 148 268 .. 144 269 .. 0.80 Alignments for each domain: == domain 1 score: 93.4 bits; conditional E-value: 7.7e-31 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 +ss++g ++a avDgd++trWss+ + qw++vdLg++ +v++v l+w a + k +++evS+D + Wt+v+e++ t g XDP77318.1|CBM32|GH16_3 10 VASSTEGVFSAGSAVDGDAGTRWSSEfTdpQWIQVDLGATAEVSRVALNWeaA---YGKAFRIEVSNDAERWTVVHETAAGT-GG- 90 34556777*****************85379********************744...5******************9877533.33. PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ + t+ryvRl++t+rat +g+s++E++ XDP77318.1|CBM32|GH16_3 91 --VqSLAVAGTGRYVRLYGTQRAT-PYGYSLWEFQ 122 ..3366656789*******88876.79******96 PP == domain 2 score: 86.0 bits; conditional E-value: 1.4e-28 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass++ s+++ + ++++a+D dp +rW+++ + w+ vdLg+ +++kvvl+w a+ +k+++++vS +g +Wt++++ XDP77318.1|CBM32|GH16_3 148 ASSSQ-SDQNCWECTPARAFDRDPASRWATSsTtgwadpGWISVDLGAMAQINKVVLQWdpAY---AKSFQIQVSPNGVDWTPLYS 229 45554.444555599***************5313457888*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ + + +t t++ ++ryvR+++t+rat +g+s++E++ XDP77318.1|CBM32|GH16_3 230 TTTGQGFK-QTLTVS--GQGRYVRMYGTERAT-PYGYSLWEFQ 268 77644333.466777..458*******88876.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (541 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.42 // Query: USX52610.1|CBM32|GH16_3 [L=568] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-57 179.2 12.2 1.1e-31 96.1 1.7 2.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.1 1.7 1.1e-31 1.1e-31 8 123 .. 43 155 .. 37 156 .. 0.82 2 ! 87.9 2.0 3.7e-29 3.7e-29 9 123 .. 180 296 .. 172 297 .. 0.79 3 ? -1.1 0.0 0.13 0.13 67 83 .. 504 521 .. 481 539 .. 0.65 Alignments for each domain: == domain 1 score: 96.1 bits; conditional E-value: 1.1e-31 CBM32.hmm 8 essssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 +sss++a+ +ga+ avDgd +trWss+ + qw+++dLg+ +vd+vvl w a ++ y++++S Dg++W+++ +++ + gt USX52610.1|CBM32|GH16_3 43 ASSSENAA-FGAASAVDGDLGTRWSSGfSdpQWIQIDLGSSARVDQVVLAWetA---SARAYTLSISADGTSWQELRRTTTGPGGT 124 34566677.*****************85379********************644...5******************7655543244 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEla 123 et ++ t+ryvRl t+rat ++g+s++E++ USX52610.1|CBM32|GH16_3 125 -ETLAVS--GTGRYVRLDLTQRAT-QYGYSLWEFQ 155 .444555..679*******99887.79******96 PP == domain 2 score: 87.9 bits; conditional E-value: 3.7e-29 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgntt 85 + +++ gg ++++a+D dp trW+++ + w+ vdLg++ +++kvvl+w a ++ y++evS+D+ +W+++++++ USX52610.1|CBM32|GH16_3 180 QDDANCGGCTPAKAFDRDPATRWATSatNgwvdpGWISVDLGATAQISKVVLQWdpAF---ATAYRLEVSDDNANWRQIYSTTAGR 262 4445556688***************5431457889*******************6555...******************9876532 PP CBM32.hmm 86 dgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 g +et t++ t+ryvR+++t+r +n +g+s++E++ USX52610.1|CBM32|GH16_3 263 -GLKETLTVS--GTGRYVRMYGTAR-SNGYGYSLWEFQ 296 .333455666..579*******665.55799*****96 PP == domain 3 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 67 evStDgktWttvaekg.n 83 S Dg+ + tv+ ++ + USX52610.1|CBM32|GH16_3 504 TFSVDGNRFFTVDREQlE 521 368899999999866533 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (568 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.87 // Query: UWP79415.1|CBM32|GH16_3 [L=734] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-84 264.8 40.2 2.5e-32 98.2 8.3 3.8 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.2 8.4 4.2e-31 4.2e-31 7 123 .. 60 173 .. 54 174 .. 0.81 2 ! 98.2 8.3 2.5e-32 2.5e-32 6 123 .. 195 310 .. 189 311 .. 0.82 3 ! 87.1 4.1 6.6e-29 6.6e-29 13 123 .. 365 477 .. 354 478 .. 0.79 4 ? -2.4 0.1 0.35 0.35 61 79 .. 528 545 .. 513 596 .. 0.50 Alignments for each domain: == domain 1 score: 94.2 bits; conditional E-value: 4.2e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++ss+++a+ ga+ a+Dgd++trWssa + qw++vdLg+++++++v l+w a +++ ++++vS++g++Wt v+++++ t g UWP79415.1|CBM32|GH16_3 60 TASSAENAA-TGASSATDGDTGTRWSSAfSvpQWIQVDLGSAQSISRVALNWeaA---YATAFQIQVSNNGTSWTNVYTTTTGTGG 141 333344555.89***************85379********************744...5******************998776553 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + ++ t++ ++ryvRl++t++at ++g s++E++ UWP79415.1|CBM32|GH16_3 142 N-QSLTVS--GSGRYVRLNATAKAT-QYGISLWEFQ 173 3.455766..568*******66554.8*******96 PP == domain 2 score: 98.2 bits; conditional E-value: 2.5e-32 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 +a++ss++++g +a+ avD++ +trWssa qw++vdLg++ ++ +v+l+w a +++ ++++vS++g++Wt v+++++ t UWP79415.1|CBM32|GH16_3 195 TATASSAENAGTPASSAVDNNLGTRWSSAAsdpQWIQVDLGSTAQICGVTLNWeaA---YATAFQIQVSNNGTSWTNVYSTTTGTG 277 344455555559****************84479********************744...5******************98876543 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 gt +t t++ ++ryvR+++t+rat +wg+s++E++ UWP79415.1|CBM32|GH16_3 278 GT-QTLTVN--GSGRYVRMNGTARAT-QWGYSLWEFQ 310 44.455666..568*******77766.8*******96 PP == domain 3 score: 87.1 bits; conditional E-value: 6.6e-29 CBM32.hmm 13 aaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 + + ++++a+D+dp +rW+++ + w++vdLg++ ++++vvl+w a+ + +y++++S+D ++Wt+++++++ + + UWP79415.1|CBM32|GH16_3 365 NCNPCSPDKAFDNDPASRWATSsTngwvdpGWIYVDLGAVAQIRQVVLQWdpAY---AVSYQIQTSNDATNWTPIYTTTTGKGF-K 446 334467***************6413457889*******************6555...******************988764333.2 PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 et +++ ++ryvR+++t+r++ +g+s++E++ UWP79415.1|CBM32|GH16_3 447 ETLNVN--GSGRYVRMYGTQRSN-GYGYSLWEFK 477 455766..678*******77754.799*****96 PP == domain 4 score: -2.4 bits; conditional E-value: 0.35 CBM32.hmm 61 ikdykvevStDgktWttva 79 ++ ++++ t++++ +t+ UWP79415.1|CBM32|GH16_3 528 GQNNEIQYYTNNEN-VTIE 545 55556666666655.4443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (734 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.20 // Query: WAE64458.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-60 189.5 11.5 3.2e-33 101.1 2.2 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 101.1 2.2 3.2e-33 3.2e-33 7 123 .. 47 160 .. 41 161 .. 0.83 2 ! 92.5 2.0 1.4e-30 1.4e-30 4 123 .. 184 304 .. 181 305 .. 0.80 3 ? -2.8 0.0 0.46 0.46 83 105 .. 553 575 .. 548 576 .. 0.67 Alignments for each domain: == domain 1 score: 101.1 bits; conditional E-value: 3.2e-33 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++++ ++a navDgdp+trWssa + qw+ +dLg+ t v +vvl+w a ++k y++e S Dg++Wtt++++++ t g WAE64458.1|CBM32|GH16_3 47 ATASSAEGP-FTAPNAVDGDPGTRWSSAfSddQWIRIDLGTSTAVGQVVLNWeaA---YAKGYRIELSADGQQWTTIHSTTTGTGG 128 333444455.*****************85369********************744...5******************988765434 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t et t++ t+r++R+++t+rat wg+s++E++ WAE64458.1|CBM32|GH16_3 129 T-ETLTVS--GTGRHIRFVGTERAT-PWGYSLYEFQ 160 4.455666..579*******88876.8*******96 PP == domain 2 score: 92.5 bits; conditional E-value: 1.4e-30 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekg 82 as++++ s+ ++ ++++a+D dp++rW+++ + w+ vdLg+p t+++vvl+w+ +++ y++evS++g++W+t++ ++ WAE64458.1|CBM32|GH16_3 184 ASTSQHDSTCWQ-CTPDKAFDRDPSSRWATSpeggWtdpGWIAVDLGAPATINRVVLQWDP-AHARAYRIEVSDNGTDWRTIHRTT 267 455555566555.89***************5443326788*******************54.56******************9776 PP CBM32.hmm 83 nttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + t +et +++ t+r+vRl++t+r+ +++g+s++E++ WAE64458.1|CBM32|GH16_3 268 TGTGF-KETLNVS--GTGRHVRLYATQRS-GEYGYSLWEFQ 304 64433.2456776..679*******7765.479******96 PP == domain 3 score: -2.8 bits; conditional E-value: 0.46 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRl 105 +++ ++ +t++f+++ ++ y+++ WAE64458.1|CBM32|GH16_3 553 DWPGpPD-TTTRFPQKLSVDYIKV 575 5554343.3669998888999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.21 // Query: UWZ48000.1|CBM32 [L=516] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-30 90.8 4.4 4.7e-30 90.8 4.4 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.8 4.4 4.7e-30 4.7e-30 9 123 .. 43 156 .. 36 157 .. 0.82 2 ? -2.9 0.0 0.49 0.49 37 49 .. 268 280 .. 229 292 .. 0.64 Alignments for each domain: == domain 1 score: 90.8 bits; conditional E-value: 4.7e-30 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttetitfdkp 97 +ss++++g +a++ vDg+++trWssa qw++vdLg++ tv+++ + w + ++k ++++ S+Dg+ +t+v+++++ + g ++it + UWZ48000.1|CBM32 43 ASSQESAGTPAAAGVDGNTGTRWSSAFaptQWFQVDLGTAATVSRIDIAWeN--AYAKAFSIQFSSDGSAYTQVYATTTGPGGR-QSITAN-- 130 334444449****************84478********************52..56******************9876654343.466666.. PP CBM32.hmm 98 vtaryvRltvtkratnawgasiaEla 123 taryvR++ t+ra a+g+s +E++ UWZ48000.1|CBM32 131 GTARYVRINLTTRALAAYGYSFWEFQ 156 679*******9999668*******96 PP == domain 2 score: -2.9 bits; conditional E-value: 0.49 CBM32.hmm 37 wltvdLgkpttvd 49 + Lg+p+tv+ UWZ48000.1|CBM32 268 STGAQLGAPYTVH 280 3445566666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (516 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.87 // Query: XQV58269.1|CBM32|GH16_3 [L=731] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-86 273.4 27.0 3.5e-34 104.2 6.7 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 101.5 4.7 2.2e-33 2.2e-33 8 123 .. 56 169 .. 51 170 .. 0.85 2 ! 104.2 6.7 3.5e-34 3.5e-34 7 123 .. 191 304 .. 184 305 .. 0.82 3 ! 78.1 0.9 4e-26 4e-26 5 123 .. 351 470 .. 344 471 .. 0.76 Alignments for each domain: == domain 1 score: 101.5 bits; conditional E-value: 2.2e-33 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 ++ss +++ +a++avDg+++trWssa qwl+vdLg++t v++vvl w a +++ +++++St+g+tWttv++++n t g XQV58269.1|CBM32|GH16_3 56 TASSVQSAAMPASAAVDGNTGTRWSSAFadpQWLQVDLGTVTPVSRVVLSWeaA---YASAFTIQTSTNGSTWTTVHTTTNGTGGR 138 3455556669****************84469********************744...5*******************998865443 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++it++ ++ryvR+ +t+rat +g+s++E++ XQV58269.1|CBM32|GH16_3 139 -QEITVT--GSGRYVRMHATQRAT-GYGVSLWEFQ 169 .588888..468*******99887.699*****96 PP == domain 2 score: 104.2 bits; conditional E-value: 3.5e-34 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++ss+++a+ ++a++avDg+++trW+sa qwl vdLg+++++ +v+ltw a +++ +++++StDg+tWttv+++gn t g XQV58269.1|CBM32|GH16_3 191 TASSTESAA-YPASAAVDGNTGTRWASAAadpQWLRVDLGSNQSICGVTLTWeaA---YASAFQIQTSTDGTTWTTVHTTGNGTGG 272 223334555.9****************84579********************744...5*******************99986544 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ + ++ryvR+++t+rat +wg+s++E+a XQV58269.1|CBM32|GH16_3 273 T---QNLTVTGSGRYVRMYGTARAT-SWGYSLWEFA 304 4...345433568*******77765.7*******96 PP == domain 3 score: 78.1 bits; conditional E-value: 4e-26 CBM32.hmm 5 ssaessssaagggg.....aenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWt 76 ss++ ++g+ +++a+D+dp +rW+++ + w++vdLg++ +++vvl+w a+ +++y+++vS + + Wt XQV58269.1|CBM32|GH16_3 351 SSNQ------NDGTcfecvPARAFDNDPASRWATSatSgwvdpGWIYVDLGATAAITQVVLQWdpAY---ATSYQIQVSPNASAWT 427 3332......212223355***************5431457889*******************6555...**************** PP CBM32.hmm 77 tvaekgnttdgttetitfdkpvtaryvRltvtkra.tnawgasiaEla 123 +++++++ +et +++ t+ryvR+++ +a + +g+s++E++ XQV58269.1|CBM32|GH16_3 428 PIYSTTSGRGF-KETLNVT--GTGRYVRMYG--TArIGPYGYSLYEFK 470 **987753322.3455666..679*******..555668*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (731 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.85 // Query: WLQ37338.1|CBM32|GH16_3 [L=703] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-87 275.0 31.6 1.2e-33 102.4 2.1 3.9 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.5 6.9 4.9e-33 4.9e-33 6 123 .. 42 157 .. 37 158 .. 0.84 2 ! 102.4 2.1 1.2e-33 1.2e-33 8 123 .. 181 294 .. 174 295 .. 0.83 3 ! 85.7 4.1 1.8e-28 1.8e-28 2 122 .. 324 445 .. 323 447 .. 0.80 4 ? -2.6 0.0 0.39 0.39 68 82 .. 640 654 .. 613 675 .. 0.66 Alignments for each domain: == domain 1 score: 100.5 bits; conditional E-value: 4.9e-33 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 +a+sss +++g +a++avDgd++trWssa qw++vdLg++ ++++++l+w a ++k +++++S +g++Wt v+++++ t WLQ37338.1|CBM32|GH16_3 42 TATSSSVENAGTPASAAVDGDAGTRWSSAAadpQWIQVDLGAASSISRITLNWeaA---YAKAFRIQTSANGTDWTSVYSTTTATG 124 456677777779****************84579********************744...5******************98876543 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 g+ +t +++ ++ryvRlt+t+rat a+g+s++E++ WLQ37338.1|CBM32|GH16_3 125 GK-QTLDVT--GSGRYVRLTGTQRAT-AYGYSLWEFQ 157 44.344554..678*******99876.79******96 PP == domain 2 score: 102.4 bits; conditional E-value: 1.2e-33 CBM32.hmm 8 essssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 ++ss++++g +a++avDgd++trWssa g qwl +dLg+ +t+ +v+l w a ++k y++++StDg++Wtt++++++ + g WLQ37338.1|CBM32|GH16_3 181 SASSTENAGTPASAAVDGDAGTRWSSApGdpQWLRIDLGSRQTICGVQLSWeaA---YAKAYQIQTSTDGTDWTTLHSTTTGP-GA 262 3344444559****************85379********************744...5******************9887654.44 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEla 123 te it++ t+ryvR++ t+rat ++g s++E++ WLQ37338.1|CBM32|GH16_3 263 TELITLT--GTGRYVRVYSTARAT-EYGISLWEFQ 294 4688999..568*******77766.799*****96 PP == domain 3 score: 85.7 bits; conditional E-value: 1.8e-28 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttv 78 atas++++++s g ++++a+D dp trW+++ + w+ vdLg++ +++vvl+w a+ ++ y++++S Dg++Wt v WLQ37338.1|CBM32|GH16_3 324 ATASTYQNANSCVG-CTPAKAFDHDPATRWATSdSdgwvdpGWISVDLGATAHITQVVLQWdpAY---ATAYQIQTSPDGTNWTSV 405 56777776666555.89***************6413457888*******************6555...****************** PP CBM32.hmm 79 aekgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEl 122 +++++ + +et ++d ++ryvR+++t+r +n +g+s++ + WLQ37338.1|CBM32|GH16_3 406 YSTTTGKGF-KETLNVD--GDGRYVRMYGTAR-SNGYGYSLWGF 445 987764333.3566887..568*******665.55799**9977 PP == domain 4 score: -2.6 bits; conditional E-value: 0.39 CBM32.hmm 68 vStDgktWttvaekg 82 S Dg+ + t+++ + WLQ37338.1|CBM32|GH16_3 640 FSVDGNAFFTADKAT 654 567888888876544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (703 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.03 // Query: XVQ95937.1|CBM32|GH3 [L=1158] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-88 279.6 37.2 1e-33 102.7 7.9 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 99.3 8.8 1.1e-32 1.1e-32 7 123 .. 43 157 .. 38 158 .. 0.82 2 ! 102.7 7.9 1e-33 1e-33 6 123 .. 178 293 .. 173 294 .. 0.82 3 ! 89.2 4.6 1.5e-29 1.5e-29 9 123 .. 318 430 .. 311 431 .. 0.82 Alignments for each domain: == domain 1 score: 99.3 bits; conditional E-value: 1.1e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 a++ss++++g +a++avDgd++trWssa g qwl+vdLg++ t+++vvl+w a +++ +k++vS++ +tWt+++++++ t gt + XVQ95937.1|CBM32|GH3 43 ATASSTENAGTPASAAVDGDTGTRWSSAfGdpQWLQVDLGTTATLSQVVLNWeaA---YATAFKIQVSDNATTWTDLYSTTTGTGGT-Q 127 33444455559****************85379********************744...5******************9887654344.4 PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEla 123 t t++ t+ryvR+++t+rat +g+s++E++ XVQ95937.1|CBM32|GH3 128 TLTVN--GTGRYVRVYGTARAT-GYGYSLWEFQ 157 55666..679*******88776.699*****96 PP == domain 2 score: 102.7 bits; conditional E-value: 1e-33 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 +a++ss++++g +a++avDgd++trWssa qwl+vdLg++tt+ kvvltw a +++ +k++vS++ +tWt+++++++ t gt XVQ95937.1|CBM32|GH3 178 TATASSTENAGTPASAAVDGDAGTRWSSAAadpQWLQVDLGSATTICKVVLTWeaA---YATAFKIQVSDNATTWTDLYSTTTGTGGT- 262 344455555559****************84579********************744...5******************9887654344. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 +t t++ t+ryvRl++t+rat wg+s++E+a XVQ95937.1|CBM32|GH3 263 QTLTVN--GTGRYVRLYGTARAT-GWGYSLWEFA 293 455666..679*******88776.699*****96 PP == domain 3 score: 89.2 bits; conditional E-value: 1.5e-29 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtteti 92 ++ss++gg+++++a+Dg ++trWss++ qwl vdLg++ +++v+l+w a +++ y++evS +g++Wt+++++++ + g XVQ95937.1|CBM32|GH3 318 TASSWEGGNAPAAALDGRTTTRWSSQYsddQWLRVDLGGAGHITGVTLNWesA---YATGYRIEVSANGTSWTPIHTTTSGK-GG--VE 400 356667779*********9******86689********************644...5******************9887643.33..23 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ + ++ryvR+++t+rat +g+s++E++ XVQ95937.1|CBM32|GH3 401 NLSVTGDGRYVRFVGTARAT-GYGYSLWEFQ 430 55544568*******88776.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1158 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 104.04 // Query: UPT40159.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-57 178.5 9.9 7.2e-32 96.7 1.3 3.1 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.7 1.3 7.2e-32 7.2e-32 7 123 .. 47 160 .. 41 161 .. 0.82 2 ! 85.5 0.8 2.1e-28 2.1e-28 4 123 .. 184 304 .. 180 305 .. 0.77 3 ? -0.3 0.0 0.078 0.078 83 105 .. 553 575 .. 499 577 .] 0.78 Alignments for each domain: == domain 1 score: 96.7 bits; conditional E-value: 7.2e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++++ +ga++avDgd+ trWssa g +wl +dLg+ t++ +v l+w a ++k y++evS Dg+ Wtt++++++ g UPT40159.1|CBM32|GH16_3 47 ATASSTEGP-FGAAAAVDGDTATRWSSAfGddEWLRIDLGASTSIGQVLLDWeaA---YAKGYRLEVSGDGQRWTTIHSTTTGAGG 128 344455555.*****************853699*******************744...5******************987664323 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ry+R+ +t+rat awg+s++E++ UPT40159.1|CBM32|GH16_3 129 V-ETLTVS--GTGRYIRMHGTERAT-AWGYSLHEFQ 160 3.455666..579*******88876.7*******96 PP == domain 2 score: 85.5 bits; conditional E-value: 2.1e-28 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekg 82 as+++++++ + ++++a+D dp +rW+++ + w+ vdLg+ ++d+vvl+w+ +++ y++evS++g++W+t++e++ UPT40159.1|CBM32|GH16_3 184 ASTSQHEAT-CWECSPDKAFDRDPASRWATSpeggWtdpGWIAVDLGARAEIDRVVLQWDP-AHARAYRIEVSDNGTDWRTIHETA 267 344443344.44488***************5443326788*******************54.56******************9876 PP CBM32.hmm 83 nttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + + et +++ t+r+vRl++t+r+ +++g+s++E++ UPT40159.1|CBM32|GH16_3 268 SGAGFK-ETLDVS--GTGRHVRLYATQRS-GEYGYSLWEFQ 304 643222.344555..679*******7765.479******96 PP == domain 3 score: -0.3 bits; conditional E-value: 0.078 CBM32.hmm 83 nttd.gtte.titfdkpvtaryvRl 105 +++ + + t++f++++++ y+++ UPT40159.1|CBM32|GH16_3 553 DWPGpP--DaTTRFPQKTSVDYIKV 575 444323..33779998888999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.16 // Query: WGP08351.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-57 180.1 11.8 5.8e-32 97.0 2.5 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 97.0 2.5 5.8e-32 5.8e-32 7 123 .. 47 160 .. 41 161 .. 0.83 2 ! 87.1 2.0 6.6e-29 6.6e-29 4 123 .. 184 304 .. 180 305 .. 0.78 3 ? -3.2 0.0 0.6 0.6 83 105 .. 553 575 .. 547 576 .. 0.65 Alignments for each domain: == domain 1 score: 97.0 bits; conditional E-value: 5.8e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++a ++a avDgd++trWssa + +w+ vdLg+ t++ +vvl+w a ++k y++evS++g++W+t++++++ + g WGP08351.1|CBM32|GH16_3 47 ATASSTEAL-FTAPSAVDGDTSTRWSSAfTddEWIRVDLGASTSIGQVVLNWeaA---YAKGYRLEVSDNGTDWRTIHSTTTGPGG 128 445666677.*****************853699*******************744...5******************988764424 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ryvR+ +t+rat wg+s++E++ WGP08351.1|CBM32|GH16_3 129 V-ETLTVS--GTGRYVRMHGTERAT-PWGYSLHEFQ 160 3.455666..579*******88876.8*******96 PP == domain 2 score: 87.1 bits; conditional E-value: 6.6e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as++++ + + ++++a+D dp +rW+++ + w+ vdLg+ ++d+vvl+w a+ ++ y++evS++g++Wt ++e WGP08351.1|CBM32|GH16_3 184 ASTSQHDGT-CWECSPDKAFDRDPASRWATSpeggWtdpGWIAVDLGARAEIDRVVLQWdpAY---ARAYRIEVSDNGTDWTAIHE 265 334433333.44478***************5443326788*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t +et +++ t+r+vRl++t+r+ +++g+s++E++ WGP08351.1|CBM32|GH16_3 266 TTTGTGF-KETLNVS--GTGRHVRLYATQRS-GEYGYSLWEFQ 304 8764433.2456776..679*******7765.479******96 PP == domain 3 score: -3.2 bits; conditional E-value: 0.6 CBM32.hmm 83 nttd.gtte.titfdkpvtaryvRl 105 +++ + + t++f+++ + yv++ WGP08351.1|CBM32|GH16_3 553 DWPGpP--DaTTRFPQKMSIDYVKV 575 454333..33778998888899987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.21 // Query: BGB01725.1|CBM32|GH16_3 [L=555] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-57 177.1 16.7 3.8e-32 97.6 5.6 2.4 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 97.6 5.6 3.8e-32 3.8e-32 8 123 .. 26 139 .. 21 140 .. 0.83 2 ! 84.8 3.3 3.5e-28 3.5e-28 5 123 .. 163 282 .. 159 283 .. 0.79 Alignments for each domain: == domain 1 score: 97.6 bits; conditional E-value: 3.8e-32 CBM32.hmm 8 essssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 ++ss+++ ++a++avDg+++trWssa + qw++vdLg++ ++++v+ltw a +++ ++v+vS +g++W t++++++ t g+ BGB01725.1|CBM32|GH16_3 26 TASSAENVAFPASAAVDGNAGTRWSSAfSdpQWIQVDLGATASISQVQLTWeaA---YATAFQVQVSANGTSWMTIHSTTTGTGGD 108 334445566*****************85379********************744...5******************9887655444 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEla 123 +t +++ ++ryvR+++t+rat ++g+s++E++ BGB01725.1|CBM32|GH16_3 109 -QTLNVS--GSGRYVRVNGTQRAT-QYGYSLWEFK 139 .355777..568*******99887.79******96 PP == domain 2 score: 84.8 bits; conditional E-value: 3.5e-28 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaek 81 s+++s + + ++++a+D dp +rW+++ + w++vdLg++ +++kvvl+w a+ +++y+++vS D +tWttv+++ BGB01725.1|CBM32|GH16_3 163 STSQSDGN-CWECTPARAFDLDPASRWATSsTtgwvdpGWIYVDLGATAQLSKVVLQWdpAY---ATSYQIQVSPDANTWTTVYST 244 44444444.44489***************6413457889*******************6555...******************987 PP CBM32.hmm 82 gnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++t +++ ++ryvR+++t+rat +g+s++E++ BGB01725.1|CBM32|GH16_3 245 TTGGGF-KQTLNVT--GSGRYVRMYGTQRAT-PYGYSLWEFQ 282 653322.3455666..578*******88876.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (555 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.48 // Query: UAC02172.1|CBM32|GH16_3 [L=694] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-83 261.9 38.1 2.2e-32 98.3 5.1 4.1 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.7 7.6 2.4e-30 2.4e-30 7 123 .. 27 141 .. 21 142 .. 0.82 2 ! 98.3 5.1 2.2e-32 2.2e-32 9 123 .. 167 278 .. 159 279 .. 0.82 3 ! 87.1 4.7 6.7e-29 6.7e-29 4 123 .. 319 439 .. 315 440 .. 0.78 4 ? -1.5 0.2 0.18 0.18 54 54 .. 510 510 .. 466 560 .. 0.44 Alignments for each domain: == domain 1 score: 91.7 bits; conditional E-value: 2.4e-30 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++ss+++a+ +a+ a+Dg+++trWssa + qw++vdLg+++++++v l+w a +++ +++++S+D +Wt+++++++ t g UAC02172.1|CBM32|GH16_3 27 TASSAESAA-TPASSATDGNAGTRWSSAfTvpQWIQVDLGSQQSITRVALNWeaA---YATAFTIQTSNDAANWTQIYSTTTGTGG 108 333344555.89***************85479********************744...5******************988765545 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + +++++ + ++ryvRl++t+++t ++g s++El+ UAC02172.1|CBM32|GH16_3 109 S--DVSLAVTGSGRYVRLNATAKST-QYGISLWELQ 141 5..6788766789*******66544.7*******86 PP == domain 2 score: 98.3 bits; conditional E-value: 2.2e-32 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 ss+++ag +a+ a+Dg+++trWssa qwl vdLg+++ v +v+l+w a +++ +++++S+Dg+tWt ++++++ t g UAC02172.1|CBM32|GH16_3 167 SSTENAG-TPAASAFDGNTGTRWSSAAsdpQWLRVDLGSVQAVCGVTLNWeaA---YATAFQIQTSNDGNTWTSIYTTTTGT-GG- 246 3344555.9****************84479********************744...5******************9887644.33. PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ + ++ryvR+++t+rat ++g+s++E++ UAC02172.1|CBM32|GH16_3 247 --VqNLNVTGSGRYVRVNGTARAT-QYGYSLWEFQ 278 ..3356544679*******77766.89******96 PP == domain 3 score: 87.1 bits; conditional E-value: 6.7e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa...g....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as+++ ++++ + ++++a+D+dp +rW+++ g w++vdLg++ +++vvl+w a+ + +y++++StD +Wt +++ UAC02172.1|CBM32|GH16_3 319 ASTSQ-NDTNCNPCTPDKAFDNDPASRWATSpdnGwvdpGWIYVDLGATAHITQVVLQWdpAY---AVSYQIQTSTDAVNWTSIYT 400 44444.444444478***************5443147788*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ + +et t++ ++ryvR+++t+r++ +g+s++E++ UAC02172.1|CBM32|GH16_3 401 TTTGKGF-KETLTVN--GNGRYVRMYGTQRSN-GYGYSLWEFK 439 8764333.3455666..568*******77754.799*****96 PP == domain 4 score: -1.5 bits; conditional E-value: 0.18 CBM32.hmm 54 t 54 UAC02172.1|CBM32|GH16_3 510 V 510 0 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (694 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 77.11 // Query: WIV54520.1|CBM32|GH16_3 [L=568] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-59 184.1 14.2 3.4e-33 101.0 3.1 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 101.0 3.1 3.4e-33 3.4e-33 9 123 .. 42 154 .. 37 155 .. 0.83 2 ! 89.5 1.4 1.2e-29 1.2e-29 3 122 .. 176 296 .. 174 298 .. 0.79 3 ? -1.7 0.0 0.2 0.2 68 82 .. 505 519 .. 491 534 .. 0.76 Alignments for each domain: == domain 1 score: 101.0 bits; conditional E-value: 3.4e-33 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 +ss+++ ++a++avDgdp+trWssa qwl+vdLg+++++++vvl w a ++k +++++S Dg tWt ++++++ t gt WIV54520.1|CBM32|GH16_3 42 ASSTESVAFPASAAVDGDPGTRWSSAFadpQWLQVDLGATQQLSQVVLSWeaA---YAKAFTLQASADGATWTSLYSTTTGTGGT- 123 33444555*****************84469********************744...5******************9887654344. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 +t t++ ++ryvRlt+t+rat ++g+s++El+ WIV54520.1|CBM32|GH16_3 124 QTLTVT--GSGRYVRLTGTQRAT-QYGYSLWELQ 154 455666..568*******99887.79******86 PP == domain 2 score: 89.5 bits; conditional E-value: 1.2e-29 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttva 79 tass++ + +g +++a+D dp trW+++ + w+tvdLg+p v++vvl+w a+ + y+++vS+D+ +Wt ++ WIV54520.1|CBM32|GH16_3 176 TASSYQDDGACPG-CVPAKAFDHDPATRWATSsTtgwvdpGWITVDLGAPAAVHQVVLQWdpAY---AVAYQIQVSNDNANWTSLY 257 4666654444444.88***************6413457889*******************6555...******************9 PP CBM32.hmm 80 ekgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEl 122 ++++ + +et t++ ++ryvR+++t+r +n +g+s++ + WIV54520.1|CBM32|GH16_3 258 STTSGKGF-KETLTVN--GSGRYVRMYGTAR-SNGYGYSLWGF 296 88764333.2455666..568*******665.55799**9977 PP == domain 3 score: -1.7 bits; conditional E-value: 0.2 CBM32.hmm 68 vStDgktWttvaekg 82 S Dg+ ++t+ ++ WIV54520.1|CBM32|GH16_3 505 FSVDGTAFQTINRST 519 488999999996554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (568 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.18 // Query: XKK54367.1|CBM32|GH16_3 [L=559] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-51 158.5 9.4 6.4e-33 100.1 1.9 3.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.1 1.9 6.4e-33 6.4e-33 7 123 .. 47 160 .. 41 161 .. 0.82 2 ! 61.3 1.0 6.3e-21 6.3e-21 4 123 .. 184 286 .. 180 287 .. 0.77 3 ? -2.1 0.0 0.28 0.28 83 106 .. 535 558 .. 529 559 .] 0.67 Alignments for each domain: == domain 1 score: 100.1 bits; conditional E-value: 6.4e-33 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++++ +ga++avDgd+ trWssa g +wl +dLg+ t++ +vvl+w a ++k y++evS Dg++Wtt++++++ g XKK54367.1|CBM32|GH16_3 47 ATASSTEGP-FGAAAAVDGDTATRWSSAfGddEWLRIDLGASTSIGQVVLDWeaA---YAKGYRLEVSGDGQQWTTIHSTTTGAGG 128 344455555.*****************853699*******************744...5******************987664323 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ry+R+ +t+rat awg+s++E++ XKK54367.1|CBM32|GH16_3 129 V-ETLTVS--GTGRYIRMHGTERAT-AWGYSLHEFQ 160 3.455666..579*******88876.7*******96 PP == domain 2 score: 61.3 bits; conditional E-value: 6.3e-21 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssagqwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekgnttdgtt 89 as++++ + + ++++a+D dp +rW+++ ++d+vvl+w+ +++ y++evS++g++Wtt++e+++ t + XKK54367.1|CBM32|GH16_3 184 ASTSQHDGT-CWECSPDKAFDRDPASRWATSP-----------EIDRVVLQWDP-AHARAYRIEVSDNGTDWTTIHETASGTGFK- 255 334443333.44478**************974...........9*******954.56******************9887644322. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 et +++ t+r+vRl++t+r+ +++g+s++E++ XKK54367.1|CBM32|GH16_3 256 ETLDVS--GTGRHVRLYATQRS-GEYGYSLWEFQ 286 344555..679*******7765.479******96 PP == domain 3 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 83 nttd.gtte.titfdkpvtaryvRlt 106 +++ + + t++f+++ ++ y+++ XKK54367.1|CBM32|GH16_3 535 DWPGpP--DaTTRFPQKMSVDYIKVW 558 554333..337799988999999985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (559 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.19 // Query: WYB29242.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-57 179.6 11.4 1.6e-31 95.5 2.3 2.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 95.5 2.3 1.6e-31 1.6e-31 7 123 .. 47 160 .. 41 161 .. 0.84 2 ! 87.8 2.4 4e-29 4e-29 4 123 .. 184 304 .. 180 305 .. 0.77 3 ? -3.8 0.0 0.93 0.93 83 105 .. 553 575 .. 548 576 .. 0.63 Alignments for each domain: == domain 1 score: 95.5 bits; conditional E-value: 1.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++a+ ++a avDgd+ trWss+ + +w+ +dLg+ t++ +vvl+w a ++k y++evS++g +W+t++++++ + g WYB29242.1|CBM32|GH16_3 47 ATASSTEAP-FTAPSAVDGDTATRWSSGfTddEWIRIDLGASTSIGQVVLNWeaA---YAKGYRLEVSDNGADWRTIHSTTTGSGG 128 455677788.*****************853699*******************744...5******************987664324 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ry+R+ +t+rat wg+s++E++ WYB29242.1|CBM32|GH16_3 129 V-ETLTVS--GTGRYIRMHGTERAT-PWGYSLHEFQ 160 3.455666..579*******88876.8*******96 PP == domain 2 score: 87.8 bits; conditional E-value: 4e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as++++ + + ++++a+D dp +rW+++ + w+ vdLg+ ++++vvl+w a+ ++ y++evS++g++Wtt+++ WYB29242.1|CBM32|GH16_3 184 ASTSQHDGT-CWECSPDKAFDRDPASRWATSpeggWtdpGWIAVDLGARAEISRVVLQWdpAY---ARAYRIEVSDNGSDWTTIHS 265 334433333.44478***************5443326788*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + et +++ t+r+vRl++t+r+ +++g+s++E++ WYB29242.1|CBM32|GH16_3 266 TTTSTGFK-ETLDVS--GTGRHVRLYATQRS-GEYGYSLWEFQ 304 87654332.344555..679*******7765.479******96 PP == domain 3 score: -3.8 bits; conditional E-value: 0.93 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRl 105 +++ ++ t++f+++ + y+++ WYB29242.1|CBM32|GH16_3 553 DWPGpPD-ATTRFPQKMSIDYIKV 575 4443232.3678887788888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.94 // Query: BGA04726.1|CBM32 [L=391] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-53 165.8 13.6 3.1e-30 91.4 7.2 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.4 7.2 3.1e-30 3.1e-30 9 123 .. 44 156 .. 39 157 .. 0.84 2 ! 78.3 0.4 3.5e-26 3.5e-26 4 123 .. 180 300 .. 174 301 .. 0.79 Alignments for each domain: == domain 1 score: 91.4 bits; conditional E-value: 3.1e-30 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitfdk 96 +ss++ ++++ +navDgdp+trWss+ qw+ vdLg+++ +d+vvl+w a +++ +++evS+D +tW t++++++ t g + ++d+ BGA04726.1|CBM32 44 TSSTEFAWSTGANAVDGDPGTRWSSTAadnQWIRVDLGSVQAIDRVVLDWeaA---YASGFRIEVSNDASTWSTIYSTTTGTGG---DQNLDA 130 34444555899**************84579********************744...5******************988765433...458887 PP CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEla 123 + ++ry+Rl vt+rat +wg+s++El+ BGA04726.1|CBM32 131 DGSGRYLRLWVTQRAT-QWGVSLWELQ 156 7899*******99887.8*******86 PP == domain 2 score: 78.3 bits; conditional E-value: 3.5e-26 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ass+++ + + g+++a+D dp +rW+ + + w+ vdLg++ +++vvl+w a ++ +++evS++g+tW+tv+++++ t BGA04726.1|CBM32 180 ASSSQNDGTCWL-CGPDKAFDLDPASRWAVNpdTgwvddGWIAVDLGAAAHISSVVLQWdpAF---ATVFDIEVSDNGSTWRTVHTTTGGTGF 268 333333333333.56**************95441347788*******************6555...******************998764433 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkra.tnawgasiaEla 123 ++ i+++ +++r+vR+ + r ++ +g+s++E++ BGA04726.1|CBM32 269 -KQAIPLN--ADGRHVRVHM--RDrSGPYGYSLWEFQ 300 .3578998..568*******..665668*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (391 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 58.82 // Query: XOU84345.1|CBM32|GH3 [L=1578] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-95 301.0 43.4 2.4e-28 85.3 1.9 5.2 6 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.5 1.7 8.5e-28 8.5e-28 11 122 .. 53 162 .. 48 164 .. 0.83 2 ! 74.9 5.3 4e-25 4e-25 14 122 .. 191 297 .. 182 299 .. 0.82 3 ! 81.9 2.5 2.7e-27 2.7e-27 11 122 .. 423 534 .. 416 536 .. 0.81 4 ? -3.8 0.1 0.94 0.94 17 47 .. 630 653 .. 619 665 .. 0.61 5 ? -2.4 0.2 0.33 0.33 31 54 .. 1339 1365 .. 1287 1396 .. 0.53 6 ! 85.3 1.9 2.4e-28 2.4e-28 13 123 .. 1431 1539 .. 1421 1540 .. 0.82 Alignments for each domain: == domain 1 score: 83.5 bits; conditional E-value: 8.5e-28 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitf 94 ss++ g + ++a+Dg+ +trW s++ qw++vdLg+p t+ +v++ w a + +dy+++ S+Dg++W tva+++n t gt ++t XOU84345.1|CBM32|GH3 53 SSTQVGLEVTAANDGNLGTRWGSDWedpQWIYVDLGQPSTIYEVEVVWegA---YGSDYDIQFSNDGSNWATVASVTNGTGGT--ERTA 136 3445558899*************86789********************644...5********************99866454..3444 PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEl 122 + +a+yvRl +r t wg+s++E+ XOU84345.1|CBM32|GH3 137 A-GGSAQYVRLHLLARGT-GWGYSLFEF 162 4.4679*******55444.5*******9 PP == domain 2 score: 74.9 bits; conditional E-value: 4e-25 CBM32.hmm 14 aggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd.gttetitfdk 96 +gg++a++a+Dg+++trW s+ w++vdL+++ +++++l w a + k+yk+++S+D ++Wt+++ + + d g+ + i ++ XOU84345.1|CBM32|GH3 191 EGGNTASAATDGNESTRWGSDFvddAWIYVDLEQVSVISSIELSWeaA---YGKEYKIQTSNDANNWTDIYYT-DSGDgGS-DIIAVN- 273 56799***************844689*******************744...5******************744.3334355.455988. PP CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEl 122 ++a++vR+++++r t wg+s++ + XOU84345.1|CBM32|GH3 274 -TSAQFVRMQGISRGT-GWGYSLWSF 297 .689*******87765.599***988 PP == domain 3 score: 81.9 bits; conditional E-value: 2.7e-27 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitf 94 s++ gg+ a++++Dgd+ trW+s+ qw+++dL++++t+++vvl+w a+ +y++++S+D ++W++v + + g++++i+f XOU84345.1|CBM32|GH3 423 STEVGGNYAQAVTDGDDETRWESEAadpQWIYIDLDAAQTFQRVVLNWevAY---GANYTIQISNDATNWQDVEIILGGN-GEEDNINF 507 33445588***************84579********************7666...9*****************6533322.434589** PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEl 122 ++pvtaryvR+ +++r t +g+s++ + XOU84345.1|CBM32|GH3 508 ANPVTARYVRMLGSARGT-GYGFSLWSF 534 *************55444.599999987 PP == domain 4 score: -3.8 bits; conditional E-value: 0.94 CBM32.hmm 17 ggaenavDgdpntrWssagqwltvdLgkptt 47 ++a n+ D W + w++v g+++t XOU84345.1|CBM32|GH3 630 FTAPNLSDR-----WTYK--WFVVAVGGAQT 653 444444443.....6554..67777776665 PP == domain 5 score: -2.4 bits; conditional E-value: 0.33 CBM32.hmm 31 Wssag...qwltvdLgkpttvdkvvlt 54 W+ + ++ +dL+ + +++++ XOU84345.1|CBM32|GH3 1339 WAGGKtrsPTFGFDLNDTSAPPAFNVY 1365 222112333455555555555555555 PP == domain 6 score: 85.3 bits; conditional E-value: 2.4e-28 CBM32.hmm 13 aaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd.gtteti. 92 +++ + ++a+Dgdp trW+s++ q ++vdLg+++ v++vvl+w a + + y++ +StDg++W++++ + n d g +ti XOU84345.1|CBM32|GH3 1431 SSA-SIVDAATDGDPATRWQSKYsdaQHIIVDLGETYLVNRVVLNWesA---YGRAYRLHASTDGENWQEIYYT-NSGDgG-IDTIn 1511 233.6799*************9668999******************644...5******************844.433434.47898 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +v aryv++++++ra+ a+g+s++E++ XOU84345.1|CBM32|GH3 1512 NLS-AV-ARYVKMEGIERAS-AYGYSLWEFE 1539 998.45.9*******88875.69******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1578 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 122.68 // Query: XAN41283.1|CBM32|GH3 [L=1029] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-55 171.1 14.7 8.7e-30 90.0 2.5 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 85.8 4.5 1.6e-28 1.6e-28 7 123 .. 53 167 .. 48 168 .. 0.80 2 ! 90.0 2.5 8.7e-30 8.7e-30 10 123 .. 191 303 .. 185 304 .. 0.82 Alignments for each domain: == domain 1 score: 85.8 bits; conditional E-value: 1.6e-28 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStD.gktWttvaekgnttdgtt 89 ++sss+ a+ +a++a+Dgd++trWss+ qwl+vdLg++ t+d+v+l w a+ ++ ++++v Wttv++++ t gt XAN41283.1|CBM32|GH3 53 TASSSEGAA-TPAAAATDGDAGTRWSSTFadpQWLQVDLGATATIDQVQLVWeaAY---ATAFQIQVAAApSGPWTTVHTTTAGTGGT- 136 344555555.9****************84469********************7445...*******99653559****9988644344. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 +t ++ t+ryvR+++t+rat +g+s++E++ XAN41283.1|CBM32|GH3 137 QTLAVT--GTGRYVRMYGTSRAT-GYGYSLWEFK 167 344555..679*******88876.699*****96 PP == domain 2 score: 90.0 bits; conditional E-value: 8.7e-30 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtteti 92 +ss++gg+++++a+Dg +trWss+ g qwl +d+g+ t+++vvl w a +++ y++e+S Dg tWtt++++++ gt e+ XAN41283.1|CBM32|GH3 191 ASSWEGGNAPAAALDGRSTTRWSSQfGsdpQWLSIDFGGLATINRVVLVWeaA---YATGYRLETSADGATWTTIYATTTGRGGT-EQL 275 45567779********999*****752579********************744...5******************8776533244.455 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 t++ ++ry+Rl++t+rat +g+s++E++ XAN41283.1|CBM32|GH3 276 TVT--GSGRYLRLYGTARAT-GYGYSLWEVQ 303 555..568*******88776.699*****86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1029 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 127.33 // Query: WIY00277.1|CBM32|GH16_3 [L=564] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-59 186.1 17.0 7.3e-34 103.1 4.6 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 103.1 4.6 7.3e-34 7.3e-34 4 123 .. 38 150 .. 34 151 .. 0.83 2 ! 89.5 2.3 1.2e-29 1.2e-29 3 122 .. 172 292 .. 169 294 .. 0.78 3 ? -1.5 0.0 0.18 0.18 68 82 .. 501 515 .. 488 532 .. 0.77 Alignments for each domain: == domain 1 score: 103.1 bits; conditional E-value: 7.3e-34 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnt 84 assa ++a+ ++a++avDgd++trWssa + qwl+vdLg+++++++vvl+w a ++k +++++StDg tWt ++++++ WIY00277.1|CBM32|GH16_3 38 ASSA----ESAA-FPASAAVDGDAGTRWSSAfSdpQWLQVDLGSTQQLSQVVLNWeaA---YAKAFTIQASTDGATWTSLYSTTTA 115 3333....4556.*****************85379********************744...5******************988765 PP CBM32.hmm 85 tdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t gt +t t++ ++ryvRlt+t+rat +g+s++E++ WIY00277.1|CBM32|GH16_3 116 TGGT-QTLTVT--GSGRYVRLTGTQRAT-PYGYSLWEFQ 150 4354.455666..568*******88876.79******96 PP == domain 2 score: 89.5 bits; conditional E-value: 1.2e-29 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttva 79 tass++ + +g +++a+D dp trW+++ + w++vdLg++ v++vvl+w a+ + y+++vS+Dg +Wt ++ WIY00277.1|CBM32|GH16_3 172 TASSYQDDGACPG-CVPAKAFDHDPATRWATSatTgwvdpGWIQVDLGAVAAVHQVVLQWdpAY---AVAYQIQVSNDGANWTSIY 253 4566654444444.78***************5431457889*******************6555...******************9 PP CBM32.hmm 80 ekgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEl 122 ++++ + + et t++ ++ryvR+++t+r +n +g+s++ + WIY00277.1|CBM32|GH16_3 254 STTTGKGFK-ETLTVN--GSGRYVRMYGTAR-SNGYGYSLWGF 292 877643333.455666..568*******665.55799**9977 PP == domain 3 score: -1.5 bits; conditional E-value: 0.18 CBM32.hmm 68 vStDgktWttvaekg 82 S Dg+ ++t++ + WIY00277.1|CBM32|GH16_3 501 FSVDGNAFETIDRDT 515 588999999998554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (564 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.56 // Query: XSC38646.1|CBM32|GH16_3 [L=590] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-62 196.3 29.5 6.4e-34 103.3 10.1 3.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.0 0.17 0.17 39 39 .. 279 279 .. 238 337 .. 0.60 2 ! 100.1 8.7 6.2e-33 6.2e-33 6 122 .. 337 450 .. 330 452 .. 0.84 3 ! 103.3 10.1 6.4e-34 6.4e-34 6 123 .. 472 586 .. 467 587 .. 0.81 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.17 CBM32.hmm 39 t 39 + XSC38646.1|CBM32|GH16_3 279 I 279 1 PP == domain 2 score: 100.1 bits; conditional E-value: 6.2e-33 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 +++sss++ag +a++a+Dg+++trWssa + qwl+vdLg+ +++++v+l+w a ++k ++v++S+Dg++Wt ++++++ t XSC38646.1|CBM32|GH16_3 337 TTASSSENAG-TPASAATDGNAGTRWSSAfSdpQWLQVDLGQSYNLTSVNLNWeaA---YAKAFQVQTSNDGTNWTSIYSTTTGTG 418 3445566666.9****************85379********************744...5******************98877555 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEl 122 g+ +t +++ ++ryvR+++t+rat a+g+s++E+ XSC38646.1|CBM32|GH16_3 419 GN-QTLNVS--GSGRYVRVYGTQRAT-AYGYSLYEF 450 33.466777..568*******99876.79******9 PP == domain 3 score: 103.3 bits; conditional E-value: 6.4e-34 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 +++ss+++a+ ++a+na+Dg+++trWssa + qwl vdLg+++t++kv+l+w a ++k +++++S+Dg+tWt+v+++++ t XSC38646.1|CBM32|GH16_3 472 TTASSTENAA-SAAANATDGNTGTRWSSAfSdpQWLRVDLGATHTISKVNLNWeaA---YAKAFQIQTSNDGTTWTDVYSTTTGTG 553 3333444455.89***************85379********************744...5******************98877555 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 g+ ++ +++ + +ryvR+++t+rat a+g+s++E++ XSC38646.1|CBM32|GH16_3 554 GN-QSLNVSGA--GRYVRMNGTQRAT-AYGYSLWEFQ 586 33.46688744..6*******99876.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (590 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 29.74 // Query: XVU23794.1|CBM32|GH16_3 [L=576] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-53 165.2 22.4 2.8e-29 88.3 8.8 2.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.3 8.8 2.8e-29 2.8e-29 7 123 .. 48 163 .. 43 164 .. 0.83 2 ! 83.9 3.2 6.6e-28 6.6e-28 4 123 .. 197 317 .. 192 318 .. 0.76 3 ? -2.5 0.0 0.35 0.35 65 76 .. 492 503 .. 469 525 .. 0.63 Alignments for each domain: == domain 1 score: 88.3 bits; conditional E-value: 2.8e-29 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++ss++aag ++a+ avDg+++trW+sa + qw +vdLg++t+v+++ ++w a ++k ++++ St+g+t+t+++++++ g XVU23794.1|CBM32|GH16_3 48 TASSTEAAGAYQAAEAVDGNNGTRWASAfTatQWWQVDLGATTSVSRIAINWeaA---YAKAFTIQFSTNGSTYTQAYATTTGA-G 129 3345567888*****************85368********************744...5******************8776643.3 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++i + +aryvR++ t+ra +a+g+s +E++ XVU23794.1|CBM32|GH16_3 130 GQQSIAAT--GSARYVRINLTERALSAYGYSFWEFQ 163 33456544..679*********99769*******96 PP == domain 2 score: 83.9 bits; conditional E-value: 6.6e-28 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as+ ++ ++ ++ ++++a+D+dp +rW+++ + w+ vdLg++ ++++vvl+w a+ + y++++S D+ +Wtt+++ XVU23794.1|CBM32|GH16_3 197 ASTWQNDANCNP-CSPDKAFDNDPASRWATSsTtgwvdpGWISVDLGATAQISQVVLQWdpAY---GRAYQLQTSGDNVNWTTFYS 278 444443333333.67***************6413457889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkra.tnawgasiaEla 123 +++ + g ++ i+ + + +ryvRl++ +a + +g+s++E++ XVU23794.1|CBM32|GH16_3 279 TTTGD-GLKDVINATGA--GRYVRLYG--TArGGPYGYSLWEFS 317 76633.33345676643..6*******..553446*******96 PP == domain 3 score: -2.5 bits; conditional E-value: 0.35 CBM32.hmm 65 kvevStDgktWt 76 +v S+D +tW XVU23794.1|CBM32|GH16_3 492 TVDLSQDFHTWA 503 444555555553 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (576 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 71.08 // Query: BFZ66048.1|CBM32|GH16_3 [L=844] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-64 201.2 27.6 2.5e-26 78.8 3.2 4.1 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.3 3.2 5.1e-24 5.1e-24 6 121 .. 47 163 .. 42 167 .. 0.78 2 ! 78.8 3.2 2.5e-26 2.5e-26 6 123 .. 207 324 .. 202 325 .. 0.80 3 ! 64.1 2.7 9e-22 9e-22 4 123 .. 355 481 .. 349 482 .. 0.73 4 ? -1.8 0.1 0.22 0.22 70 104 .. 520 552 .. 501 593 .. 0.66 5 ? -4.0 0.0 1 1 83 106 .. 725 748 .. 720 757 .. 0.61 Alignments for each domain: == domain 1 score: 71.3 bits; conditional E-value: 5.1e-24 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 ++++++s +g+++a+n++Dgd +trWss++ +++++dL +++ +d+v l+w a +++y+v++StD+ktW+t+a+ + t BFZ66048.1|CBM32|GH16_3 47 KTAKATSIEGDNPASNVTDGDSTTRWSSEYrdgESVQIDLAATCVIDRVDLNWegA---FASEYTVSGSTDDKTWQTLATGTATGA 129 444555667889****************8667899******************644...5******************98775433 PP CBM32.hmm 87 gtteti.tfdkpvta.ryvRltvtkratnawgasiaE 121 g ++ ++++ a r++++t+ kr + ++g s++ BFZ66048.1|CBM32|GH16_3 130 GP-QSLnNLAEIG-AiRHLKVTGDKRGS-DFGISLYT 163 32.4555888433.44*******55443.57777765 PP == domain 2 score: 78.8 bits; conditional E-value: 2.5e-26 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekgnttd.g 87 +a++s++++g+ +++na+Dg+p+trWss+ qw+tvdLg+++ +d+v+l+w++ ++++ y +e+S +g tW + ++++ d g BFZ66048.1|CBM32|GH16_3 207 KASASTTENGDLAPKNATDGNPKTRWSSQAadgQWITVDLGATYLLDAVELDWET-SYARGYVLETSLNGWTWFPYESVTGS-DgG 290 3444556667789***************84469********************44.56****************99887654.435 PP CBM32.hmm 88 ttetitfd.kpvtaryvRltvtkratnawgasiaEla 123 + it d p ++r+vR+t t+r++ ++g+s++ ++ BFZ66048.1|CBM32|GH16_3 291 R-DVITSDmHP-RTRFVRMTSTERSS-QFGVSLWHFN 324 4.455767656.47*******88775.7999999985 PP == domain 3 score: 64.1 bits; conditional E-value: 9e-22 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa...g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgk.tWttvae 80 ass++ ++ + + ++++++D d trW+ a + w++vdL + +++++vl w a +k+y++ev + + Wttv++ BFZ66048.1|CBM32|GH16_3 355 ASSSQ-NDPQCVDCTPDKLFDQDLATRWAVAekdWsdnAWVQVDLAARAEISQIVLRWdpAF---AKSYSIEVADSPTgPWTTVYK 436 33333.333344466**************9644326899*******************6555...*********764327****75 PP CBM32.hmm 81 .kgnttdgttetitfdkpvtaryvRltvtkra....tnawgasiaEla 123 +g+ t g+ e i++d+ + +ryv +++t+r+ n++g+s++E+ BFZ66048.1|CBM32|GH16_3 437 tVGG-TGGK-EVINIDT-TAGRYVQVNMTERTvgwgGNKYGFSLYEFR 481 1444.3354.5679993.346*******9977544344699*****95 PP == domain 4 score: -1.8 bits; conditional E-value: 0.22 CBM32.hmm 70 tDgktWttvaekgnttd.gttetitfdkpvtaryvR 104 D+ +Wt ++ ++n d ++ + ++ ++++ vR BFZ66048.1|CBM32|GH16_3 520 ADDRKWT-LDHTANPGDnNN-AELQLY-TADTNNVR 552 5777898.765555544232.222222.12234444 PP == domain 5 score: -4.0 bits; conditional E-value: 1 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRlt 106 +++ ++ ++++f++ + yvR+ BFZ66048.1|CBM32|GH16_3 725 DWPGsPD-KDTRFPAEMLVDYVRVF 748 5553222.35678755567899885 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (844 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.86 // Query: XOU76161.1|CBM32|GH3 [L=1578] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-95 301.0 43.4 2.4e-28 85.3 1.9 5.2 6 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.5 1.7 8.5e-28 8.5e-28 11 122 .. 53 162 .. 48 164 .. 0.83 2 ! 74.9 5.3 4e-25 4e-25 14 122 .. 191 297 .. 182 299 .. 0.82 3 ! 81.9 2.5 2.7e-27 2.7e-27 11 122 .. 423 534 .. 416 536 .. 0.81 4 ? -3.8 0.1 0.94 0.94 17 47 .. 630 653 .. 619 665 .. 0.61 5 ? -2.4 0.2 0.33 0.33 31 54 .. 1339 1365 .. 1287 1396 .. 0.53 6 ! 85.3 1.9 2.4e-28 2.4e-28 13 123 .. 1431 1539 .. 1421 1540 .. 0.82 Alignments for each domain: == domain 1 score: 83.5 bits; conditional E-value: 8.5e-28 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitf 94 ss++ g + ++a+Dg+ +trW s++ qw++vdLg+p t+ +v++ w a + +dy+++ S+Dg++W tva+++n t gt ++t XOU76161.1|CBM32|GH3 53 SSTQVGLEVTAANDGNLGTRWGSDWedpQWIYVDLGQPSTIYEVEVVWegA---YGSDYDIQFSNDGSNWATVASVTNGTGGT--ERTA 136 3445558899*************86789********************644...5********************99866454..3444 PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEl 122 + +a+yvRl +r t wg+s++E+ XOU76161.1|CBM32|GH3 137 A-GGSAQYVRLHLLARGT-GWGYSLFEF 162 4.4679*******55444.5*******9 PP == domain 2 score: 74.9 bits; conditional E-value: 4e-25 CBM32.hmm 14 aggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd.gttetitfdk 96 +gg++a++a+Dg+++trW s+ w++vdL+++ +++++l w a + k+yk+++S+D ++Wt+++ + + d g+ + i ++ XOU76161.1|CBM32|GH3 191 EGGNTASAATDGNESTRWGSDFvddAWIYVDLEQVSVISSIELSWeaA---YGKEYKIQTSNDANNWTDIYYT-DSGDgGS-DIIAVN- 273 56799***************844689*******************744...5******************744.3334355.455988. PP CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEl 122 ++a++vR+++++r t wg+s++ + XOU76161.1|CBM32|GH3 274 -TSAQFVRMQGISRGT-GWGYSLWSF 297 .689*******87765.599***988 PP == domain 3 score: 81.9 bits; conditional E-value: 2.7e-27 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitf 94 s++ gg+ a++++Dgd+ trW+s+ qw+++dL++++t+++vvl+w a+ +y++++S+D ++W++v + + g++++i+f XOU76161.1|CBM32|GH3 423 STEVGGNYAQAVTDGDDETRWESEAadpQWIYIDLDAAQTFQRVVLNWevAY---GANYTIQISNDATNWQDVEIILGGN-GEEDNINF 507 33445588***************84579********************7666...9*****************6533322.434589** PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEl 122 ++pvtaryvR+ +++r t +g+s++ + XOU76161.1|CBM32|GH3 508 ANPVTARYVRMLGSARGT-GYGFSLWSF 534 *************55444.599999987 PP == domain 4 score: -3.8 bits; conditional E-value: 0.94 CBM32.hmm 17 ggaenavDgdpntrWssagqwltvdLgkptt 47 ++a n+ D W + w++v g+++t XOU76161.1|CBM32|GH3 630 FTAPNLSDR-----WTYK--WFVVAVGGAQT 653 444444443.....6554..67777776665 PP == domain 5 score: -2.4 bits; conditional E-value: 0.33 CBM32.hmm 31 Wssag...qwltvdLgkpttvdkvvlt 54 W+ + ++ +dL+ + +++++ XOU76161.1|CBM32|GH3 1339 WAGGKtrsPTFGFDLNDTSAPPAFNVY 1365 222112333455555555555555555 PP == domain 6 score: 85.3 bits; conditional E-value: 2.4e-28 CBM32.hmm 13 aaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd.gtteti. 92 +++ + ++a+Dgdp trW+s++ q ++vdLg+++ v++vvl+w a + + y++ +StDg++W++++ + n d g +ti XOU76161.1|CBM32|GH3 1431 SSA-SIVDAATDGDPATRWQSKYsdaQHIIVDLGETYLVNRVVLNWesA---YGRAYRLHASTDGENWQEIYYT-NSGDgG-IDTIn 1511 233.6799*************9668999******************644...5******************844.433434.47898 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +v aryv++++++ra+ a+g+s++E++ XOU76161.1|CBM32|GH3 1512 NLS-AV-ARYVKMEGIERAS-AYGYSLWEFE 1539 998.45.9*******88875.69******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1578 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 119.97 // Query: WTL24211.1|CBM32|GH16_3 [L=574] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-57 177.2 15.3 5.4e-32 97.1 2.4 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 97.1 2.4 5.4e-32 5.4e-32 8 123 .. 43 155 .. 37 156 .. 0.82 2 ! 86.7 3.0 9.1e-29 9.1e-29 4 123 .. 181 301 .. 179 302 .. 0.80 3 ? -2.1 0.0 0.27 0.27 68 80 .. 511 523 .. 493 573 .. 0.52 Alignments for each domain: == domain 1 score: 97.1 bits; conditional E-value: 5.4e-32 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 + +ssa+g ++a navDgdp+trWssa qw+++dLg+ t+++++vl+w a + + +++evS+D + Wt v+++++ t gt WTL24211.1|CBM32|GH16_3 43 T-ASSAEGAFAARNAVDGDPGTRWSSAFadpQWIQIDLGASTEISRIVLNWeaA---YGTAFRIEVSSDAQRWTAVHQTATGTGGT 124 3.3444566*****************84469********************744...5******************9766644344 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t+ryvR+++t+rat a+g+s++E++ WTL24211.1|CBM32|GH16_3 125 ---QNLTVSGTGRYVRMYGTQRAT-AYGFSLWEFQ 155 ...344433679*******99886.799*****96 PP == domain 2 score: 86.7 bits; conditional E-value: 9.1e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass+++ + ++ ++++a+D dp +rW+++ + w+ vdLg++ ++dkvvl+w a+ +k+++++vS +g++Wt++++ WTL24211.1|CBM32|GH16_3 181 ASSSQADGNCWE-CTPARAFDRDPASRWATStTtgwtdpGWISVDLGATAQIDKVVLQWdpAY---AKSFQIQVSPNGTDWTPIYS 262 455555555555.89***************5313456889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + +t ++ t+ryvR+++t+rat +g+s++E++ WTL24211.1|CBM32|GH16_3 263 TTSGTGFK-QTLAVS--GTGRYVRMYGTQRAT-PYGYSLWEFQ 301 87644322.355665..679*******88876.79******96 PP == domain 3 score: -2.1 bits; conditional E-value: 0.27 CBM32.hmm 68 vStDgktWttvae 80 +S Dg t t+++ WTL24211.1|CBM32|GH16_3 511 YSLDGRTVFTLDK 523 4555544444432 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (574 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 63.49 // Query: BGB14531.1|CBM32|GH16_3 [L=392] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-29 88.8 1.8 5.8e-29 87.3 1.8 1.8 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.3 1.8 5.8e-29 5.8e-29 5 123 .. 12 131 .. 6 132 .. 0.76 Alignments for each domain: == domain 1 score: 87.3 bits; conditional E-value: 5.8e-29 CBM32.hmm 5 ssaessssaagggg.....aenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWt 76 ss++ +++ + +++a+D+dp trW+++ + w++vdLg++ t+++vvl+w a+ +++y+++vS + +tWt BGB14531.1|CBM32|GH16_3 12 SSNQ-NDG-----TcfecvPARAFDNDPATRWATSgTtgwvdpGWIYVDLGATATISQVVLQWdpAY---ATSYQIQVSPNATTWT 88 3332.222.....223355***************6413457889*******************6555...**************** PP CBM32.hmm 77 tvaekgnttdgttetitfdkpvtaryvRltvtkra.tnawgasiaEla 123 +++++++ +eti+ + t+ryvR+++ +a + +g+s++E+ BGB14531.1|CBM32|GH16_3 89 PIYSTTTGRGF-KETINAT--GTGRYVRMYG--TArVGPYGYSLYEFR 131 **987653322.3566665..679*******..665778*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (392 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.66 // Query: XRK05035.1|CBM32|GH16_3 [L=717] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-81 257.1 27.6 1.4e-31 95.7 3.8 3.7 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 95.7 3.8 1.4e-31 1.4e-31 7 123 .. 46 159 .. 40 160 .. 0.83 2 ! 89.5 1.5 1.2e-29 1.2e-29 8 122 .. 182 294 .. 175 296 .. 0.81 3 ! 85.4 4.1 2.2e-28 2.2e-28 6 123 .. 332 451 .. 329 452 .. 0.82 4 ? -2.7 0.0 0.42 0.42 31 52 .. 647 668 .. 638 677 .. 0.62 Alignments for each domain: == domain 1 score: 95.7 bits; conditional E-value: 1.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++sss++a+ ++a+ avDg+++trW+sa + qwl+vdLg++ ++++vvl+w a + k +++++S D tWt ++++++ t g XRK05035.1|CBM32|GH16_3 46 TASSSESAA-FPAAGAVDGNAGTRWASAfSdpQWLQVDLGATASISRVVLNWeaA---YGKAFQIQTSADAATWTSIYSTTTGTGG 127 334556666.*****************85379********************744...5******************988765434 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t ++ t++ t+ryvR+++t+rat a+g+s++E++ XRK05035.1|CBM32|GH16_3 128 T-QDLTVT--GTGRYVRMYGTQRAT-AYGYSLFEFQ 159 4.445555..568*******99876.799*****96 PP == domain 2 score: 89.5 bits; conditional E-value: 1.2e-29 CBM32.hmm 8 essssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 ++ss++++ ++a navDg+++trW+sa + qwl++dLg++++v +v+l w a +++ ++++ S D + Wttv+++++ t gt XRK05035.1|CBM32|GH16_3 182 TASSTENAAFPAGNAVDGNAGTRWASAfSdpQWLQIDLGSAKQVCGVTLVWeaA---YATAFQLQLSADANAWTTVYSTTTGTGGT 264 333444455*****************85379********************744...5******************9887654344 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEl 122 +++ + t+ry+R++ t+rat +g s++E+ XRK05035.1|CBM32|GH16_3 265 ---QNLTVTGTGRYLRIYLTQRAT-PYGDSLFEV 294 ...355544679*******88876.799999987 PP == domain 3 score: 85.4 bits; conditional E-value: 2.2e-28 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekg 82 s+++ + + gg +a++a+D dp trW+++ + w++vdLg++ +++kv l+w a+ +k +++++S D tWt++++++ XRK05035.1|CBM32|GH16_3 332 STTQDDVNCGGCTAAKAFDRDPATRWATSsTtgwvdpGWIYVDLGATAQIHKVILQWdpAY---AKAFQIQTSPDAATWTPIYSTT 414 4445666777799***************6413457889*******************6555...******************9887 PP CBM32.hmm 83 nttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + t ++t t+d t+ryvR+++t+rat a+g+s++E++ XRK05035.1|CBM32|GH16_3 415 TGTGF-KQTLTVD--GTGRYVRMYGTQRAT-AYGYSLWEFQ 451 64433.3466887..578*******99876.79******96 PP == domain 4 score: -2.7 bits; conditional E-value: 0.42 CBM32.hmm 31 WssagqwltvdLgkpttvdkvv 52 W s+g +tvd ++ +tvd+ + XRK05035.1|CBM32|GH16_3 647 WNSQGMKFTVDGNTIHTVDRAT 668 4443233566666666666555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (717 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 90.88 // Query: BFZ97701.1|CBM32|GH3 [L=1158] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-87 275.2 31.5 1.4e-33 102.2 3.7 3.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.7 8.0 3.1e-31 3.1e-31 7 123 .. 43 157 .. 38 158 .. 0.82 2 ! 102.2 3.7 1.4e-33 1.4e-33 7 123 .. 180 293 .. 174 294 .. 0.82 3 ! 89.8 4.0 9.6e-30 9.6e-30 9 123 .. 318 430 .. 311 431 .. 0.82 Alignments for each domain: == domain 1 score: 94.7 bits; conditional E-value: 3.1e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 a++ss++++g +a++avDgd++trWssa g qwl+vdLg++ t+++v l+w a +++++k+++S++ + Wt+++++++ t gt + BFZ97701.1|CBM32|GH3 43 ATASSTENAGTPASAAVDGDTGTRWSSAfGdpQWLQVDLGTTATLSQVILNWetA---YATSFKIQISDNASAWTDLYSTTTATGGT-Q 127 33444455559****************85379********************644...5******************9887654354.4 PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEla 123 t t++ t+ryvRl++t+rat +g+s++E++ BFZ97701.1|CBM32|GH3 128 TLTVT--GTGRYVRLYGTARAT-GYGYSLWEFQ 157 55666..578*******88776.699*****96 PP == domain 2 score: 102.2 bits; conditional E-value: 1.4e-33 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 ++ss+++ag +a++avDgdp+trWssa qwl+vdLg+++t+ kvvltw a +++ +k+++S++ +tWt+++++++ t gt + BFZ97701.1|CBM32|GH3 180 TASSTENAG-TPASAAVDGDPGTRWSSAAadpQWLQVDLGSARTICKVVLTWetA---YATAFKIQISDNASTWTDLYSTTSGTGGT-Q 263 333344555.9****************84579********************644...5******************9887654344.4 PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEla 123 t t++ t+ryvRl++t+rat +g+s++E+a BFZ97701.1|CBM32|GH3 264 TLTVS--GTGRYVRLYGTARAT-GYGYSLWEFA 293 55776..578*******88776.699*****96 PP == domain 3 score: 89.8 bits; conditional E-value: 9.6e-30 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtteti 92 ++ss++gg+++++a+Dg ++trWss++ qwl vdLg++ +++v+l+w a +++ y++evS +g++Wt+++++++ g BFZ97701.1|CBM32|GH3 318 TASSWEGGNAPAAALDGRTTTRWSSQYsddQWLRVDLGGAGHITGVTLNWesA---YATGYRIEVSANGTSWTPIHTTTGGR-GG--VE 400 356667779*********9******86689********************644...5******************9877532.33..23 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ + ++ryvR+++t+rat +g+s++E++ BFZ97701.1|CBM32|GH3 401 NLNVTGDGRYVRFVGTARAT-GYGYSLWEFQ 430 55544678*******88776.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1158 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 129.65 // Query: XUQ34642.1|CBM32|GH16_3 [L=585] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-60 187.6 18.4 2.9e-33 101.2 5.6 2.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 101.2 5.6 2.9e-33 2.9e-33 7 123 .. 56 169 .. 50 170 .. 0.81 2 ! 93.2 2.4 8.5e-31 8.5e-31 4 123 .. 193 311 .. 189 312 .. 0.82 3 ? -1.2 0.0 0.15 0.15 67 84 .. 523 539 .. 493 584 .. 0.56 Alignments for each domain: == domain 1 score: 101.2 bits; conditional E-value: 2.9e-33 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a ss++++ ++a++avDg+++trWssa g qwl+vdLg++ tv++vvl+w a +++ +k+++S Dg+ Wt+v++++ t g XUQ34642.1|CBM32|GH16_3 56 A-SSTENGVAFPASAAVDGNAGTRWSSAfGdpQWLQVDLGATATVSRVVLQWeaA---YATGFKLQTSADGTAWTDVYSTAAGTGG 137 2.3344556699***************85379********************744...5******************987754434 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ + t+ryvR+++t+rat ++g+s++E++ XUQ34642.1|CBM32|GH16_3 138 T---QNLTVNGTGRYVRMYGTARAT-QYGYSLWEFQ 169 3...345544679*******77766.89******96 PP == domain 2 score: 93.2 bits; conditional E-value: 8.5e-31 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgn 83 ass++ +++ g+ ++ +avD dp trW++a + w+++dLg++ tv+kv l+w a+ ++ y+++vS D +Wt+++++++ XUQ34642.1|CBM32|GH16_3 193 ASSSQ-NDGGCGNCTPGKAVDQDPATRWATAaWsdpAWIYIDLGATATVHKVILQWdpAY---ATAYRLQVSGDAANWTDIYSTTT 274 45554.444455588***************7536899*******************6555...******************98876 PP CBM32.hmm 84 ttdgtteti.tfdkpvtaryvRltvtkra.tnawgasiaEla 123 + +eti +++ t+ryvR+++ +a +++g+s++E++ XUQ34642.1|CBM32|GH16_3 275 GKGF-KETItNLN--GTGRYVRMYG--TArVGQYGYSLWEFQ 311 4433.46888999..568*******..555778*******96 PP == domain 3 score: -1.2 bits; conditional E-value: 0.15 CBM32.hmm 67 evStDgktWttvaekg.nt 84 + Dg+ + tv+ ++ +t XUQ34642.1|CBM32|GH16_3 523 Y--VDGNAFFTVDRTAlET 539 3..4777788777554333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (585 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.18 // Query: XRK09617.1|CBM32|GH128 [L=450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-30 90.6 0.8 1.2e-29 89.5 0.8 1.5 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.5 0.8 1.2e-29 1.2e-29 10 123 .. 56 167 .. 51 168 .. 0.82 Alignments for each domain: == domain 1 score: 89.5 bits; conditional E-value: 1.2e-29 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttet 91 sss+ g+ ++++avDg +trWss+ + qwl+vdLg+ t ++k+vl+w a +++ +++++S g +Wtt+ +++ + g +t XRK09617.1|CBM32|GH128 56 SSSERGDLSPSAAVDGRSDTRWSSKfSdpQWLQVDLGRSTAIKKIVLNWerA---YATAFQIQTSPGGGDWTTILSTTAGK-GGLQT 138 444566699*******999*****85379********************544...5******************7665432.33235 PP CBM32.hmm 92 itfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +t+ryvRl++tkr++ ++g+s++E++ XRK09617.1|CBM32|GH128 139 LNVS--ATGRYVRLYATKRSS-QYGVSLWEFQ 167 5666..679*******88875.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (450 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 87.37 // Query: UED83700.1|CBM32|GH16_3 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-28 84.8 1.3 2.2e-27 82.2 0.8 2.3 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 82.2 0.8 2.2e-27 2.2e-27 6 123 .. 54 173 .. 48 174 .. 0.78 2 ? 0.3 0.0 0.05 0.05 83 106 .. 420 443 .. 357 444 .] 0.77 Alignments for each domain: == domain 1 score: 82.2 bits; conditional E-value: 2.2e-27 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekg 82 s+e+++ + + +e+a+D dp +rW+++ g w+ vdLg+p ++++vvl+w a+ ++ y+++vS+D+++W+ +++++ UED83700.1|CBM32|GH16_3 54 STEQNDPQCWECFPERAFDFDPASRWATSeeGgwvddGWISVDLGAPAEISHVVLQWdpAY---ATGYEIQVSDDNQSWQSIYSTT 136 3333444444466***************6431457888*******************6555...******************9887 PP CBM32.hmm 83 nttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + + +eti+ + ++ryvR+ +++r++ +g+s++E++ UED83700.1|CBM32|GH16_3 137 SGSGF-KETIEAE--GSGRYVRMLANQRSS-PYGYSLWEFQ 173 64333.3567766..578*******77654.79******96 PP == domain 2 score: 0.3 bits; conditional E-value: 0.05 CBM32.hmm 83 nttd.gtte.titfdkpvtaryvRlt 106 +++ + + ++ f+++ ++ yvR++ UED83700.1|CBM32|GH16_3 420 DWPGpP--DgSTVFPQQMKVDYVRVY 443 554333..336688888999999996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.62 // Query: WNV85942.1|CBM32 [L=520] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-32 97.8 4.3 8.6e-32 96.4 4.3 1.7 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.4 4.3 8.6e-32 8.6e-32 7 123 .. 46 160 .. 40 161 .. 0.83 Alignments for each domain: == domain 1 score: 96.4 bits; conditional E-value: 8.6e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitf 94 ++sss++ag +a +avDg+++trWssa qw++vdLg++t++++v ++w a ++k ++++ StDg ++t+v++++ t g ++i++ WNV85942.1|CBM32 46 TASSSESAG-TAAGAAVDGNDGTRWSSAFaaeQWFQVDLGSATRISQVAVNWesA---YAKAFTIQLSTDGGNYTQVYATTAGTGGR-QSIPV 133 344555666.99***************84469********************644...5******************9887544343.57788 PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 + taryvR+ t+ra ++g+s++E++ WNV85942.1|CBM32 134 T--GTARYVRVDLTQRALPSYGYSMWEFQ 160 7..679*******9999667*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (520 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 126.28 // Query: UCR89184.1|CBM32|GH16_3 [L=832] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-58 182.8 8.1 1.7e-21 63.2 3.5 3.9 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 57.9 0.0 7.1e-20 7.1e-20 10 122 .. 55 166 .. 48 168 .. 0.78 2 ! 63.2 3.5 1.7e-21 1.7e-21 9 123 .. 200 315 .. 193 316 .. 0.82 3 ! 61.0 0.1 7.7e-21 7.7e-21 16 123 .. 358 472 .. 344 473 .. 0.75 4 ? -1.5 0.0 0.17 0.17 83 110 .. 716 743 .. 710 761 .. 0.65 Alignments for each domain: == domain 1 score: 57.9 bits; conditional E-value: 7.1e-20 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 ss++a+ + ++n++Dgdp+trW+s++ w ++ Lg+++t+d+++ltw a ++++y+ve+ Dg tt++e++ t gt e UCR89184.1|CBM32|GH16_3 55 SSTQAP-HLPANLTDGDPQTRWASETgegAWAEISLGAACTLDRLELTWeaA---YARQYRVEGRVDGV-LTTLKEVTAGTGGT-E 134 455667.9****************855789*******************744...5************5.48888877544354.4 PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEl 122 ++ + ++ ++ vRlt ++ra +g s++E+ UCR89184.1|CBM32|GH16_3 135 SVtGLIDASNVSAVRLTSIERAL-PHGISLFEM 166 44344456678******988763.356777765 PP == domain 2 score: 63.2 bits; conditional E-value: 1.7e-21 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekgnttdgttet 91 +ss +++ +++ na+ +dp+ rWssa +w+ +dLg+ ++v++v ++w++ ++++dy++ +S +g +W t+ ++++ dg+t+ UCR89184.1|CBM32|GH16_3 200 ASSVENPAHAPGNATREDPTLRWSSAAtdnEWIMLDLGARYNVSAVAIDWET-SYATDYRIDTSRNGWDWDTLSTVTGS-DGKTDV 283 46667777*********9999****844799*******************44.56******************998764.355456 PP CBM32.hmm 92 itfd.kpvtaryvRltvtkratnawgasiaEla 123 i+ + +++++r++R+ + r+ +++g+s++E+ UCR89184.1|CBM32|GH16_3 284 IRAStAATDVRFIRMSALVRS-SQFGVSMWEFR 315 6666567789*******5554.4799*****96 PP == domain 3 score: 61.0 bits; conditional E-value: 7.7e-21 CBM32.hmm 16 gggaenavDgdpntrWssa...g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetit 93 + ++++++D d ++rW+ a + w+ vdLg+p v++v+l w a ++++ ++ Dg Wt+v+ + + t ++ + it UCR89184.1|CBM32|GH16_3 358 ECTPDKMFDQDMGSRWAVAeedWsddAWVMVDLGAPAVVSQVSLRWdpAF-ATAYRLDIASEVDG-PWTQVYGTIGGTGNK-DIIT 440 367**************9643326899*******************7644.45666666666899.*****7443433243.4569 PP CBM32.hmm 94 fdkpvtaryvRltvtkra...tnawgasiaEla 123 ++ p+ +r++Rlt+++ra n++g+siaE+ UCR89184.1|CBM32|GH16_3 441 LE-PTAGRFLRLTMQERAvvwGNKYGYSIAEFR 472 98.7778*******998887555799*****96 PP == domain 4 score: -1.5 bits; conditional E-value: 0.17 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRltvtkr 110 +++ ++ +++f+++ + yvR++ +++ UCR89184.1|CBM32|GH16_3 716 DWPGsPN-AETQFPAQMLVDYVRVYQSED 743 5553222.477888556689***998543 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (832 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.13 // Query: XQV60749.1|CBM32|GH3 [L=1036] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-55 172.3 21.2 2.1e-30 92.0 5.3 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.8 5.1 4e-29 4e-29 4 123 .. 62 174 .. 57 175 .. 0.81 2 ! 92.0 5.3 2.1e-30 2.1e-30 10 123 .. 198 309 .. 192 310 .. 0.82 3 ? -3.3 0.0 0.63 0.63 35 61 .. 411 431 .. 381 447 .. 0.59 Alignments for each domain: == domain 1 score: 87.8 bits; conditional E-value: 4e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a ss+++ag +a++avDgd++trWssa +w++vdLg+ +d+v l+w a +++ +++++S + ++W t++++++ t g XQV60749.1|CBM32|GH3 62 A----SSTESAG-TPASAAVDGDIGTRWSSAFrdaEWIYVDLGASAAIDQVILNWeaA---YATGFQIQTSANATSWSTIYSTTTGTGG 142 2....3334555.9****************844689*******************744...5******************988764423 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +t ++ t+ryvR+++t+rat +g+s++E++ XQV60749.1|CBM32|GH3 143 V-QTLAVN--GTGRYVRMNGTARAT-GYGYSLWEFQ 174 3.344555..679*******88776.699*****96 PP == domain 2 score: 92.0 bits; conditional E-value: 2.1e-30 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetit 93 +ss++gg+++++a+Dg ++trWss+ + qw++vdLg++ tv++vvl+w a +++ y++e+S++g+ Wtt+++++ t g +t XQV60749.1|CBM32|GH3 198 ASSWEGGNAPAAALDGRTTTRWSSQfSdpQWIQVDLGGTATVTRVVLNWesA---YATAYRIETSSNGTAWTTIYSTSAGTGGV-QTLA 282 45567779*********9******85379********************644...5******************9876533233.3445 PP CBM32.hmm 94 fdkpvtaryvRltvtkratnawgasiaEla 123 ++ t+r+vRlt+t+rat +g+s++E++ XQV60749.1|CBM32|GH3 283 VS--GTGRFVRLTGTARAT-GYGYSLWEFQ 309 55..679*******88776.699*****96 PP == domain 3 score: -3.3 bits; conditional E-value: 0.63 CBM32.hmm 35 g..qwltvdLgkpttvdkvvltwaengri 61 + +w++v g+ t+++ + i XQV60749.1|CBM32|GH3 411 WtyKWYVVAVGGSGTISTSN--------I 431 12334555555554444433........3 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1036 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 122.07 // Query: XMB28249.1|CBM32 [L=522] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-58 181.3 16.1 1e-25 76.8 0.9 3.2 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.9 0.6 3.5e-20 3.5e-20 23 123 .. 115 228 .. 100 229 .. 0.74 2 ! 54.8 1.8 6.9e-19 6.9e-19 10 121 .. 237 361 .. 230 364 .. 0.75 3 ! 76.8 0.9 1e-25 1e-25 7 123 .. 369 498 .. 363 499 .. 0.77 Alignments for each domain: == domain 1 score: 58.9 bits; conditional E-value: 3.5e-20 CBM32.hmm 23 vDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw.aen.grikdykvevStDgktWttv.aekg.nttdgt..tetitfdkpvtary 102 D +t Wss+ g +w +d g+ + + +++lt+ a + +kd+k++ S+Dg tWt++ +k n+ ++ +t++f + v ary XMB28249.1|CBM32 115 GDS-SGTAWSSEahGtentvEWAALDVGGHHIIGEISLTPrA-TlAFPKDFKIQSSNDGITWTDIpGQKYsNYV-NNgsVQTFKFGSSVMARY 204 444.459****644146789*******************862.3467******************444332443.333233668888899*** PP CBM32.hmm 103 vRltvtkratnawg...asiaEla 123 vR+++tk +++++g +++aE++ XMB28249.1|CBM32 205 VRVYATKLSKDDMGnyyFQLAEFN 228 *****9977543433339999996 PP == domain 2 score: 54.8 bits; conditional E-value: 6.9e-19 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag.......qwltvdLgkpttvdkvvltw.aen.grikdykvevStDgktWttvaekgnttd.gt.te. 90 ss+ +g +a ++ D++ +t Wss++ +w+t+ L++ v++++lt+ + + + +k+++++ S Dg Wt++ ++ t+ ++ + XMB28249.1|CBM32 237 SSNIKG-WEAVKLSDNNSTTVWSSEWhaseastEWITLYLDSIEFVSGISLTPrG-TlSFPKEFNIQSSVDGIIWTDIPGQAYTNYiNDgSVk 327 444455.7899*********99996445667899******************852.4577******************655544444443233 PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawg...asiaE 121 t++f +pv +ry+R+++tk ++++g +++a XMB28249.1|CBM32 328 TFSFGNPVITRYLRVYATKLGKDDMGgyyFQLAD 361 5577799999*******88665544433355555 PP == domain 3 score: 76.8 bits; conditional E-value: 1e-25 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa...g....qwltvdLgkpttvdkvvltw.aen.grikdykvevStDgktWttvaekgnttd.gt. 88 a++ss+ +g g +++D++p+t Wss+ + +w+ ++L++ +++++++lt+ a + + +kd+k++ S+Dg tWt++ e++ + ++ XMB28249.1|CBM32 369 AAASSALNG-WGVVKLTDNNPSTVWSSEpraNeattEWIALNLESIKSISGINLTPrA-TlSFPKDFKIQSSKDGLTWTDIPEQAYSSYvNNg 459 333444455.89***************5433156799******************863.4577******************877644444544 PP CBM32.hmm 89 .tetitfdkpvtaryvRltvtkratnawg...asiaEla 123 +t++f +pv aryvR+++tk ++++g +++aE++ XMB28249.1|CBM32 460 sVQTFNFGTPVMARYVRVYATKLGKDDMGgyyFQLAEFK 498 22366888************9966554444449999986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (522 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 20.18 // Query: XCX28363.1|CBM32|GH16_3 [L=571] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-55 172.2 15.5 1.8e-30 92.2 3.6 2.9 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.2 3.6 1.8e-30 1.8e-30 3 123 .. 42 156 .. 36 157 .. 0.83 2 ! 86.9 1.8 7.6e-29 7.6e-29 5 123 .. 181 300 .. 176 301 .. 0.78 3 ? -4.1 0.0 1 1 59 74 .. 348 363 .. 342 370 .. 0.70 4 ? -3.8 0.0 0.93 0.93 83 105 .. 547 569 .. 541 570 .. 0.63 Alignments for each domain: == domain 1 score: 92.2 bits; conditional E-value: 1.8e-30 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgn 83 tass ++++ ++a+ avDg+++trWssa + qwl vdLg+ +++ + +l+w a +++ ++++vS Dg Wttv+++++ XCX28363.1|CBM32|GH16_3 42 TASSV----ETGSPFTAASAVDGNAGTRWSSAfSdpQWLRVDLGASRELCGATLQWeaA---YATAFQLQVSADGAAWTTVHQTTT 120 33444....4555599***************85379********************744...5******************98776 PP CBM32.hmm 84 ttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t gt +++tf+ t+ry+R+ t+rat ++g+s++E+a XCX28363.1|CBM32|GH16_3 121 GTGGT-QNVTFT--GTGRYIRVHTTARAT-QYGVSLWEFA 156 54455.688999..568*******77766.8*******96 PP == domain 2 score: 86.9 bits; conditional E-value: 7.6e-29 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaek 81 ss + ++a + ++++a+D +p trW+++ + w+ vdLg++ +++kvvl+w a ++ +++++S +g++Wtt++++ XCX28363.1|CBM32|GH16_3 181 SSFQ-DDGACPACTPAKALDFNPATRWATNagTgwvdpGWISVDLGATAQISKVVLQWdpAF---ATGFQIQTSANGTSWTTIHTV 262 3333.333334477***************6441457889*******************6555...*******************99 PP CBM32.hmm 82 gnttd.gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +n t + +t+t++ t+ryvR++ tkr+ +++g+s++E++ XCX28363.1|CBM32|GH16_3 263 ANGTGfK--QTFTVS--GTGRYVRVNLTKRS-GQYGYSLWEFQ 300 8855422..355555..679*******7765.47*******96 PP == domain 3 score: -4.1 bits; conditional E-value: 1 CBM32.hmm 59 grikdykvevStDgkt 74 g+ ++ ++++ tD+ + XCX28363.1|CBM32|GH16_3 348 GTGQNAELQYYTDNRN 363 4567788888888754 PP == domain 4 score: -3.8 bits; conditional E-value: 0.93 CBM32.hmm 83 nttd.gtte.titfdkpvtaryvRl 105 +++ + + t++f++ + yvR+ XCX28363.1|CBM32|GH16_3 547 DWPGpP--DaTTSFPQRMLVDYVRV 569 444323..33678887666899998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (571 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 75.69 // Query: UWE09547.1|CBM32|GH16_3 [L=725] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-85 270.1 44.5 2.1e-33 101.6 6.3 4.1 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 97.4 11.2 4.4e-32 4.4e-32 6 123 .. 49 164 .. 44 165 .. 0.83 2 ! 101.6 6.3 2.1e-33 2.1e-33 5 123 .. 185 301 .. 180 302 .. 0.84 3 ! 87.6 4.8 4.6e-29 4.6e-29 2 122 .. 344 465 .. 343 467 .. 0.80 4 ? -2.7 0.1 0.41 0.41 64 81 .. 519 535 .. 507 587 .. 0.54 5 ? -1.5 0.0 0.18 0.18 68 83 .. 662 678 .. 632 723 .. 0.65 Alignments for each domain: == domain 1 score: 97.4 bits; conditional E-value: 4.4e-32 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 +a++ss++++g +a++avDg+++trWssa qwl+vdLg++ +v++v+l+w a ++k y+++vS +g++Wt v+++++ UWE09547.1|CBM32|GH16_3 49 TATASSTENAGTPASAAVDGNTGTRWSSAAadpQWLQVDLGATSDVTQVTLNWetA---YAKAYQIQVSANGTSWTNVYSTTTAAG 131 444555556669****************84579********************644...5******************98766544 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 g+ et +++ ++ryvR++ t+rat +wg+s++E++ UWE09547.1|CBM32|GH16_3 132 GN-ETLSVN--GSGRYVRIYTTQRAT-QWGVSLWEFQ 164 43.455666..568*******99887.8*******96 PP == domain 2 score: 101.6 bits; conditional E-value: 2.1e-33 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd 86 ++a++ss++++g +a+ avDgd++trWssa qwl+vdLg+ +++ +v+l w + ++k y+++vS++g++Wt ++++++ + UWE09547.1|CBM32|GH16_3 185 KTATASSTENAGTPASSAVDGDNGTRWSSAAadpQWLQVDLGSSQNICGVQLSWeN--AYAKAYQIQVSDNGTSWTNAYSTTTGP- 267 4555566666669****************84579********************52..56******************9877644. PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 g te it++ t+ryvR+++t+rat ++g+s++E++ UWE09547.1|CBM32|GH16_3 268 GATELITLT--GTGRYVRMYGTQRAT-QYGYSLWEFQ 301 444688999..568*******99887.79******96 PP == domain 3 score: 87.6 bits; conditional E-value: 4.6e-29 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttv 78 atas++++++s g ++++a+D+dp trW+++ + w+ vdLg++ ++kvvl+w a+ ++ y++++S Dg++Wt + UWE09547.1|CBM32|GH16_3 344 ATASTYQNANSCVG-CTPSKAFDEDPATRWATSdvNgwvdpGWIAVDLGATAHISKVVLQWdpAY---ATAYQIQTSADGTNWTSI 425 56777776666555.89***************6441347888*******************6555...****************** PP CBM32.hmm 79 aekgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEl 122 +++++ + +et +d ++ryvR+++t+r +n +g+s++ + UWE09547.1|CBM32|GH16_3 426 YSTTTGKGF-KETLAVD--GNGRYVRMYGTAR-SNGYGYSLWTF 465 987764333.3466777..568*******665.55799***988 PP == domain 4 score: -2.7 bits; conditional E-value: 0.41 CBM32.hmm 64 ykvevStDgktWttvaek 81 ++e+ t+g + tt + UWE09547.1|CBM32|GH16_3 519 GELEYYTNGDN-TTMDGN 535 44555555544.444322 PP == domain 5 score: -1.5 bits; conditional E-value: 0.18 CBM32.hmm 68 vStDgktWttvaekg.n 83 S Dg+ + t+++ + + UWE09547.1|CBM32|GH16_3 662 FSVDGHAFFTADKATvE 678 67888888888755422 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (725 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.36 // Query: XQE88871.1|CBM32|GH16_3 [L=549] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-43 133.4 16.2 6e-29 87.2 2.7 3.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.7 0.8 1e-07 1e-07 7 37 .. 42 74 .. 36 77 .. 0.75 2 ! 36.3 0.9 3.7e-13 3.7e-13 61 123 .. 74 132 .. 71 133 .. 0.79 3 ! 87.2 2.7 6e-29 6e-29 4 123 .. 156 276 .. 153 277 .. 0.80 Alignments for each domain: == domain 1 score: 18.7 bits; conditional E-value: 1e-07 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qw 37 a+ sss++g ++a avDgdp+trWssa qw XQE88871.1|CBM32|GH16_3 42 AT-SSSTEGPFSARSAVDGDPGTRWSSAFadpQW 74 44.4445555*****************7335777 PP == domain 2 score: 36.3 bits; conditional E-value: 3.7e-13 CBM32.hmm 61 ikdykvevStDgktWttvaekgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++ +k+evS+D + Wt+v+ ++ t gt ++ ++ t+ryvR+++t+rat a+g+s++E++ XQE88871.1|CBM32|GH16_3 74 WTAFKIEVSSDAERWTVVHRTAAGTGGT-QDLAVS--GTGRYVRMYGTQRAT-AYGYSLWEFQ 132 578**************99766544344.344555..579*******99876.79******96 PP == domain 3 score: 87.2 bits; conditional E-value: 6e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass++s ++ + ++++a+D dp +rWs++ + w+ vdLg++ ++dkvvl+w a+ +k+++++vS++g +Wt++++ XQE88871.1|CBM32|GH16_3 156 ASSSQSDQN-CWECTPDRAFDRDPASRWSTSstTgwtdpGWISVDLGATAQIDKVVLQWdpAY---AKSFQIQVSSNGADWTPIYS 237 455554444.45599***************5331456889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + t++ + t+r+vR+++t+rat +g+s++E++ XQE88871.1|CBM32|GH16_3 238 TTSGTGF---KQTLAVAGTGRFVRMYGTQRAT-PYGYSLWEFQ 276 8764432...2255555789*******88876.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (549 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 32.39 // Query: WIM99244.1|CBM32|GH16_3 [L=557] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-54 167.9 16.9 5.3e-29 87.4 5.2 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.4 5.2 5.3e-29 5.3e-29 8 123 .. 41 155 .. 35 156 .. 0.84 2 ! 85.4 3.8 2.2e-28 2.2e-28 4 123 .. 178 298 .. 174 299 .. 0.79 Alignments for each domain: == domain 1 score: 87.4 bits; conditional E-value: 5.3e-29 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgtt 89 ++ss +++g +a + +Dgd++trWssa qw++vdLg++t+++++ ++w + ++k ++++ StDg+ +t+++++++ t g + WIM99244.1|CBM32|GH16_3 41 TASSVEWAGTPAGAGNDGDNGTRWSSAFaagQWFQVDLGAATSISRIAINWeN--AYAKAFTIQFSTDGSAYTQAYATTTGTGG-Q 123 34555666699***************84468********************52..56******************887764433.3 PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 ++i+++ taryvR++ t+ra +a+g+s +E++ WIM99244.1|CBM32|GH16_3 124 QSIPVT--GTARYVRINLTQRALEAYGYSFWEFQ 155 588887..579*********99779*******96 PP == domain 2 score: 85.4 bits; conditional E-value: 2.2e-28 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass+ +++ + + +a++a+D+dp +rW+++ + w++vdLg++ +v++vvl+w a+ +k+y+++vS D +Wt +++ WIM99244.1|CBM32|GH16_3 178 ASSE-QNDVNCNPCTADKAFDNDPASRWATSsTtgwvdpGWIYVDLGATAQVSQVVLQWdpAY---AKSYQIQVSGDAANWTSIYS 259 4444.4555566689***************6413457889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ + g ++ it + t+ryvR+++t+r ++ +g+s++E++ WIM99244.1|CBM32|GH16_3 260 TTTGD-GLKDVITAT--GTGRYVRMYGTAR-SGPYGYSLWEFS 298 76633.333455665..579*******554.557*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (557 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 75.35 // Query: BFD51673.1|CBM32|GH16_3 [L=563] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-56 176.2 18.7 1.7e-31 95.5 7.3 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 95.5 7.3 1.7e-31 1.7e-31 8 123 .. 48 161 .. 41 162 .. 0.83 2 ! 85.9 3.5 1.6e-28 1.6e-28 4 123 .. 184 304 .. 180 305 .. 0.79 Alignments for each domain: == domain 1 score: 95.5 bits; conditional E-value: 1.7e-31 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgtt 89 +ss+++ag +a++avDgd++trWssa qw++vdLg++t+v+++ ++w + ++k ++++ StDg tWt+++++++ t g + BFD51673.1|CBM32|GH16_3 48 ASSAEWAG-TPATAAVDGDNGTRWSSAFaatQWFQVDLGAATSVSRIAINWeN--AYAKAFTLQFSTDGGTWTQAYTTTTGTGG-Q 129 23444555.9****************84468********************52..56******************988765433.3 PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 ++i+++ taryvR++ t+ra + +g+s +E++ BFD51673.1|CBM32|GH16_3 130 QSIPVT--GTARYVRVNLTQRALELYGYSFWEFQ 161 588887..579*******99996569******96 PP == domain 2 score: 85.9 bits; conditional E-value: 1.6e-28 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass+ +++ + + +a++a+D+dp +rW+++ + w++vdLg++ +v++vvl+w a+ k+y+++vS D +Wtt+++ BFD51673.1|CBM32|GH16_3 184 ASSE-QNDVNCNPCTADKAFDNDPASRWATSsTtgwvdpGWIYVDLGATAQVTQVVLQWdpAY---GKSYQIQVSGDAANWTTIYS 265 4444.4555566689***************6413457889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkra.tnawgasiaEla 123 +++ + g ++ i+ + t+ryvR+++ +a + +g+s++E++ BFD51673.1|CBM32|GH16_3 266 TTTGD-GLKDVINAT--GTGRYVRMYG--TArGGPYGYSLWEFS 304 76633.333455666..679*******..553446*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (563 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.36 // Query: BFE61229.1|CBM32|GH16_3 [L=586] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-62 194.2 29.7 6.7e-34 103.2 8.2 3.1 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 60 80 .. 295 315 .. 239 337 .. 0.59 2 ! 98.9 9.7 1.4e-32 1.4e-32 7 122 .. 337 449 .. 330 451 .. 0.82 3 ! 103.2 8.2 6.7e-34 6.7e-34 7 123 .. 470 583 .. 465 584 .. 0.83 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 60 rikdykvevStDgktWttvae 80 ++ +v++ + + +W+ v++ BFE61229.1|CBM32|GH16_3 295 GPNASTVSGAQMNIDWVAVYN 315 334444555555555655554 PP == domain 2 score: 98.9 bits; conditional E-value: 1.4e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++ss+++ag +a++a+Dg+++trWssa + qwl+vdLg+++++++v+l+w a ++k +++++S+Dg++Wt ++++++ g BFE61229.1|CBM32|GH16_3 337 TASSTENAG-TPASAATDGNATTRWSSAfSdpQWLQVDLGQTYNLTSVNLNWeaA---YAKAFQIQTSNDGTNWTSIYSTTTGAGG 418 333444555.9****************85379********************744...5******************988765543 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEl 122 + +t +++ ++ryvR+++t+rat a+g+s++E+ BFE61229.1|CBM32|GH16_3 419 N-QTLNVT--GSGRYVRVYGTQRAT-AYGYSLYEF 449 3.466776..568*******99876.79******9 PP == domain 3 score: 103.2 bits; conditional E-value: 6.7e-34 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++ss+++ag +a++a+Dg+++trWssa + qwl+vdLg+++ ++kv+l+w a ++k +++++S+Dg++Wt ++++++ g BFE61229.1|CBM32|GH16_3 470 TASSTENAG-TPASAATDGNTGTRWSSAfSdpQWLQVDLGATRAISKVNLNWeaA---YAKAFQIQTSNDGTNWTSIYSTTTGAGG 551 333444555.9****************85379********************744...5******************988765543 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + +t +++ ++ryvR+++t+rat ++g+s++E++ BFE61229.1|CBM32|GH16_3 552 N-QTLNVT--GSGRYVRVYGTQRAT-TYGYSLWEFQ 583 3.466776..568*******99886.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (586 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 28.77 // Query: BFE52703.1|CBM32|GH3 [L=1014] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-54 168.9 14.8 1.1e-30 92.9 3.8 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.9 3.8 1.1e-30 1.1e-30 8 123 .. 42 155 .. 36 156 .. 0.82 2 ! 81.0 3.2 5.2e-27 5.2e-27 9 123 .. 175 287 .. 168 288 .. 0.81 Alignments for each domain: == domain 1 score: 92.9 bits; conditional E-value: 1.1e-30 CBM32.hmm 8 essssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttet 91 ++ss +++g +a++a+Dg+++trWssa + qwl+vdLg+p +++v l+w a +++ +++e+S D tWttv+++++ t g+ ++ BFE52703.1|CBM32|GH3 42 TASSVENAGTPASAATDGNTGTRWSSAfSdpQWLQVDLGAPAVLSRVALQWesA---YASAFRIETSPDAATWTTVHTTTGGTGGS-QD 126 3455566669****************85379********************644...5******************9988655444.34 PP CBM32.hmm 92 itfdkpvtaryvRltvtkratnawgasiaEla 123 ++ t+ryvRl++t+rat wg+s++E+ BFE52703.1|CBM32|GH3 127 LAVS--GTGRYVRLVGTTRAT-GWGYSLWEFR 155 4555..578*******77776.699*****96 PP == domain 2 score: 81.0 bits; conditional E-value: 5.2e-27 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd.gttet 91 ++s+++gg+++++a+Dg ++trWss+ qwl vd+g++ tv++v l w a +++ y++e S Dg+tWtt++++++ gt e+ BFE52703.1|CBM32|GH3 175 TASTWEGGNAPAAALDGRTTTRWSSQFadnQWLRVDFGGVATVREVLLVWegA---YASAYRIELSGDGTTWTTAYSTTTA-RgGT-ER 258 356777889*********9******83468********************644...5******************977553.3344.33 PP CBM32.hmm 92 itfdkpvtaryvRltvtkratnawgasiaEla 123 t++ t+ry+Rl + +rat +g s++El+ BFE52703.1|CBM32|GH3 259 LTVQ--GTGRYLRLFGVTRAT-GYGISLWELQ 287 4555..679*******65555.699*****86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1014 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 129.87 // Query: UWZ52551.1|CBM32|GH16_3 [L=730] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-85 269.7 41.1 9.6e-33 99.5 7.6 4.0 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.8 10.0 2.7e-31 2.7e-31 7 123 .. 61 174 .. 55 175 .. 0.81 2 ! 99.5 7.6 9.6e-33 9.6e-33 7 123 .. 195 309 .. 189 310 .. 0.81 3 ! 90.1 3.2 7.6e-30 7.6e-30 4 123 .. 355 475 .. 352 476 .. 0.79 4 ? -1.2 0.1 0.14 0.14 43 74 .. 509 537 .. 499 596 .. 0.53 Alignments for each domain: == domain 1 score: 94.8 bits; conditional E-value: 2.7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++ss+++ag +a+na+Dg+++trWssa + qw++vdLg+++++++v l+w a +++ y++++S +g+tWtt++++++ t g UWZ52551.1|CBM32|GH16_3 61 TASSTENAG-TPASNATDGNTGTRWSSAfSdpQWIQVDLGATQSITRVALNWeaA---YASAYQIQTSGNGSTWTTIYSTTTST-G 141 333444555.9****************85379********************744...5******************9876644.3 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++ t++ ++ryvR++ t+rat ++g+s++E++ UWZ52551.1|CBM32|GH16_3 142 GIQSLTVT--GSGRYVRVNTTARAT-QYGVSLWEFQ 174 32334444..568*******77766.8*******96 PP == domain 2 score: 99.5 bits; conditional E-value: 9.6e-33 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++++g +a+ a+Dg+++trWssa qw++vdLg+++++ +v+l+w a +++ +++++St+g+tWt ++++++ t g UWZ52551.1|CBM32|GH16_3 195 ATASSTENAGTPAASAFDGNTGTRWSSAAgdpQWIQVDLGTTQSICGVTLNWetA---YATAFQLQTSTNGSTWTNIYSTTTGTGG 277 33444455559****************84479********************644...5******************988764423 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++ t++ ++ryvRl++t+rat +wg+s++E++ UWZ52551.1|CBM32|GH16_3 278 V-QELTVT--GSGRYVRLNGTARAT-QWGYSLWEFQ 309 3.344555..568*******77766.8*******96 PP == domain 3 score: 90.1 bits; conditional E-value: 7.6e-30 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as++++ s+ ++ ++++a+D+dp +rW+++ + w++vdLg++ ++++vvl+w a+ + +y++++S D +Wt++++ UWZ52551.1|CBM32|GH16_3 355 ASTSQNDSNCNP-CTPDKAFDNDPASRWATSptNgwvdpGWIYVDLGATAQIKQVVLQWdpAY---AVSYQIQTSADAVNWTPIYT 436 555655555555.89***************5431347888*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ + et t++ t+ryvR+++t+r++ +g+s++E++ UWZ52551.1|CBM32|GH16_3 437 TTTGKGF-RETLTVN--GTGRYVRMYGTQRSN-GYGYSLWEFK 475 7764322.2355666..679*******77754.799*****96 PP == domain 4 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 43 gkpttvdkvvltwaengrikdykvevStDgkt 74 g++ + +k+++++ g+ ++ ++++ t+ ++ UWZ52551.1|CBM32|GH16_3 509 GTNVDTSKWTVDP---GTGQNGEIQYYTNLEN 537 4555555555553...3344555555444333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (730 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.05 // Query: WTL23148.1|CBM32|GH3 [L=1031] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-59 185.1 15.2 1.7e-32 98.7 2.9 2.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.7 2.9 1.7e-32 1.7e-32 9 123 .. 54 166 .. 48 167 .. 0.82 2 ! 91.0 4.6 4.1e-30 4.1e-30 10 123 .. 191 302 .. 184 303 .. 0.83 Alignments for each domain: == domain 1 score: 98.7 bits; conditional E-value: 1.7e-32 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtteti 92 +ss+++gg +a++avDgdp+trWss+ q l+vdLg++ tv++v+l+w a +++++k++vS D ++Wt+v+++++ + g +t WTL23148.1|CBM32|GH3 54 ASSTENGGTPASAAVDGDPGTRWSSTAtdpQALQVDLGATATVSSVTLNWeaA---YATSFKIQVSADAQNWTDVYATTTGPGGV-QTL 138 3455567699***************844799*******************744...5******************8876644233.344 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ ++ryvR+++t+rat +g+s++E++ WTL23148.1|CBM32|GH3 139 PVS--GSGRYVRMYGTARAT-GYGYSLWEFQ 166 555..679*******88776.699*****96 PP == domain 2 score: 91.0 bits; conditional E-value: 4.1e-30 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetit 93 +s+++g +++++a+Dg ++trWss+ qwl+vdLg++ tv++v+++w a ++k y+vevS++g+ Wt+++++++ + g e+ + WTL23148.1|CBM32|GH3 191 ASTWEGANAPAAALDGRTDTRWSSQFadnQWLQVDLGGTATVTGVEINWesA---YAKGYRVEVSDNGTAWTVLHSTTTGKGGV-EKLS 275 456677799***************83468********************644...5******************9877643243.3447 PP CBM32.hmm 94 fdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvRl +t+rat +g+s++E++ WTL23148.1|CBM32|GH3 276 LT--GKGRYVRLFGTARAT-GYGFSVWEFQ 302 77..678*******88776.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1031 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 130.27 // Query: BGA82589.1|CBM32|GH3 [L=1055] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-59 186.2 17.9 1.4e-32 99.0 3.6 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 99.0 3.6 1.4e-32 1.4e-32 3 123 .. 34 147 .. 29 148 .. 0.79 2 ! 92.3 6.5 1.6e-30 1.6e-30 7 123 .. 171 284 .. 165 285 .. 0.80 Alignments for each domain: == domain 1 score: 99.0 bits; conditional E-value: 1.4e-32 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 tas s+++ag +a++avDgd++trWssa qwl+vdLg++ t+++v+l w a +++ +k++vS+Dg++Wt+++ ++ + BGA82589.1|CBM32|GH3 34 TAS----SAENAG-TPASAAVDGDAGTRWSSAFadpQWLQVDLGATATLSQVTLSWeaA---YATAFKIQVSSDGSSWTDIYGTTAGPG 114 233....334555.9****************84469********************744...5******************86665432 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 gt +++ + t+ryvR+++t ra n +g+s++E++ BGA82589.1|CBM32|GH3 115 GT---QNLTVTGTGRYVRMYGTVRA-NGYGYSLWEFQ 147 43...355544679*******6654.5799*****96 PP == domain 2 score: 92.3 bits; conditional E-value: 1.6e-30 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 + +ss++gg+++++a+Dg ++trWss+ + qwl vdLg++ +v++v+l+w a +++ y++evS +g+tWttv+++++ g BGA82589.1|CBM32|GH3 171 VT-ASSYEGGNAPAAALDGRTTTRWSSQfSadQWLRVDLGGAGRVTGVTLNWesA---YATAYRIEVSANGTTWTTVYSTTTGR-GG-- 252 33.34445669*********9******85379********************644...5******************9876532.33.. PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEla 123 +++ + t+ryvR+++t+rat +g+s++E++ BGA82589.1|CBM32|GH3 253 VENLTVTGTGRYVRFVGTTRAT-GYGYSLWEFQ 284 2355544679*******88776.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1055 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 122.29 // Query: WHX47212.1|CBM32|CBM6|GH3 [L=1263] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-33 99.6 5.1 9.2e-33 99.6 5.1 4.8 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.1 0.18 0.18 78 78 .. 121 121 .. 44 188 .. 0.62 2 ? -1.5 2.1 0.17 0.17 54 74 .. 276 292 .. 190 333 .. 0.57 3 ! 99.6 5.1 9.2e-33 9.2e-33 10 123 .. 351 462 .. 343 463 .. 0.85 4 ? 1.6 4.9 0.019 0.019 4 78 .. 489 569 .. 486 615 .. 0.65 5 ? -1.8 0.1 0.23 0.23 40 67 .. 617 654 .. 586 664 .. 0.63 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.18 CBM32.hmm 78 v 78 v WHX47212.1|CBM32|CBM6|GH3 121 V 121 2 PP == domain 2 score: -1.5 bits; conditional E-value: 0.17 CBM32.hmm 54 twaengrikdykvevStDgkt 74 t + ++ ++ + tDg+t WHX47212.1|CBM32|CBM6|GH3 276 T----TATSGATIKYTTDGST 292 1....1122333333333322 PP == domain 3 score: 99.6 bits; conditional E-value: 9.2e-33 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 sss ag + a++a+Dg+ +trW+s+ + qw++vdLg+++tv++v+l+w a ++ yk++vSt+ ++Wt+v++++ t +t WHX47212.1|CBM32|CBM6|GH3 351 SSSIAG-NVADAAFDGNSGTRWESEfSdpQWIYVDLGTNHTVTGVRLHWetA---SARAYKIQVSTNASDWTDVYTQAYGTGNT 430 455566.9****************85379********************644...5*******************987543244 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEla 123 e+itfd pvtaryvR+ +t+r+t ++g+s++E++ WHX47212.1|CBM32|CBM6|GH3 431 -EDITFD-PVTARYVRMHGTERTT-DYGYSLWEFE 462 .799**9.9**********77655.89******96 PP == domain 4 score: 1.6 bits; conditional E-value: 0.019 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssagqwltvdLgkpttvdkvvltw....ae...n.grikdykvevStDgktWttv 78 a+s + +s++ag ++++++Dg++ t s+++ + + +tt++++ +++ +e + +i+ +kv +g+ tt WHX47212.1|CBM32|CBM6|GH3 489 AQSVTLTSATAG-ATIKYTTDGSTPTQASATY-TGPIQVPVTTTIKAIAVKPdmtdSEvatGtYTITAFKVVSPVNGQMVTTT 569 566777788888.99*******7767777653.345777888999***99997654225543577788887766777433333 PP == domain 5 score: -1.8 bits; conditional E-value: 0.23 CBM32.hmm 40 vdLgkpttvdkvvltw......ae...n.grikdykve 67 ++p vd+++++w ++ + ++i +++v+ WHX47212.1|CBM32|CBM6|GH3 617 TQVNAPSLVDRWTYKWyvvavdGSgnkSqSDIGQFSVY 654 45567777888888887775541133324666666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1263 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 34.77 // Query: XLD85916.1|CBM32|GH16_3 [L=725] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-83 263.3 24.1 1.1e-31 96.1 2.6 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.0 2.1 2e-30 2e-30 9 123 .. 57 169 .. 52 170 .. 0.81 2 ! 96.1 2.6 1.1e-31 1.1e-31 9 123 .. 192 304 .. 185 305 .. 0.84 3 ! 86.1 4.2 1.3e-28 1.3e-28 4 123 .. 344 464 .. 340 465 .. 0.79 Alignments for each domain: == domain 1 score: 92.0 bits; conditional E-value: 2e-30 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 +ss+++ ++a++avDgd++trWssa qwl vdLg+p v++v l w a +++d++++ StDg++Wtt++++ + t g+ XLD85916.1|CBM32|GH16_3 57 ASSTESIAFPASAAVDGDNGTRWSSAAadpQWLRVDLGSPVAVSRVALRWetA---YASDFTIQLSTDGSSWTTAHTTVGGTGGD- 138 233445559****************84579********************644...5******************8754433333. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ + taryvRl t rat awg+s++E++ XLD85916.1|CBM32|GH16_3 139 --QSLTVAGTARYVRLHTTRRAT-AWGVSLFEFQ 169 ..344444789*******77766.8*******96 PP == domain 2 score: 96.1 bits; conditional E-value: 1.1e-31 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 +ss ++g ++a++avDg+++trWssa qwl vdLg+++ + +v+l+w a+ +++++S Dg+tWttv++++n t g XLD85916.1|CBM32|GH16_3 192 ASSVESGAYPASAAVDGNTGTRWSSAAadpQWLRVDLGSTQAICGVTLNWeaAY---GVAFTIQTSADGNTWTTVHTTTNGTGGV- 273 45667788*****************84579********************7445...*******************988755333. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ + ++r+vR+ +t+rat +g+s++E++ XLD85916.1|CBM32|GH16_3 274 Q--NLTVTGSGRFVRVHGTTRAT-PYGYSLWEFQ 304 2..55544668*******77665.79******96 PP == domain 3 score: 86.1 bits; conditional E-value: 1.3e-28 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass + s+ + + +++a+D+dp trW+++ + w++vdLg++ t+++vvl+w a+ +++y+++vS + +tWtt+++ XLD85916.1|CBM32|GH16_3 344 ASSDQ-SDVNCYECVPARAFDNDPATRWATSsTtgwvdpGWIYVDLGATATITQVVLQWdpAY---ATSYQIQVSPNATTWTTIYS 425 44443.455555578***************6413457889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +eti+ + t+ryvR+++t+rat +g+s++E+ XLD85916.1|CBM32|GH16_3 426 TTSGRGF-KETINTT--GTGRYVRMYGTARAT-PYGYSLYEFR 464 7753322.3567665..679*******77765.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (725 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.44 // Query: UQU66578.1|CBM32|GH16_3 [L=580] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-51 157.6 18.9 1.7e-28 85.8 6.1 3.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 85.8 6.1 1.7e-28 1.7e-28 7 123 .. 53 168 .. 47 169 .. 0.81 2 ! 79.2 2.0 1.9e-26 1.9e-26 4 123 .. 201 321 .. 197 322 .. 0.79 3 ? -2.7 0.1 0.41 0.41 82 82 .. 393 393 .. 361 437 .. 0.51 Alignments for each domain: == domain 1 score: 85.8 bits; conditional E-value: 1.7e-28 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt 88 +++ss +++g +a++a+Dg+++trWssa + qw++vdLg+++ v++v+l+w + +++ ++v+ St+g+t+t + ++ ++g UQU66578.1|CBM32|GH16_3 53 TTASSVEWEGTPASAATDGNTGTRWSSAfSanQWIQVDLGSTMAVTRVNLNWeN--AYATAFTVQFSTNGTTFTNATNTLRGNVGA 136 44567778889****************85379********************52..56****************984332322232 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++i+++ +aryvRl+ t+ra + +g+s++E++ UQU66578.1|CBM32|GH16_3 137 -QNIPVT--GSARYVRLNLTERALSIYGYSLWEFQ 168 .456666..679*******99996579******96 PP == domain 2 score: 79.2 bits; conditional E-value: 1.9e-26 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass+ +++ + + +a++a+D dp trW+++ + w++vdLg++ ++++v+l+w a+ ++ yk++vS + +tWt++++ UQU66578.1|CBM32|GH16_3 201 ASSE-QNDVNCNPCTANKAFDLDPATRWATSsTtgwvdpGWIYVDLGATAQISRVELQWdpAY---ATAYKIQVSPNASTWTDIYS 282 4444.4555566689***************6413457889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgtteti.tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ + + ++ +++ ++ryvR+++t+r ++ +g+s++ ++ UQU66578.1|CBM32|GH16_3 283 TTTGKGFK--EVlNVS--GSGRYVRMYGTAR-SGPYGYSLYDFN 321 77643333..454887..568*******554.55799**99885 PP == domain 3 score: -2.7 bits; conditional E-value: 0.41 CBM32.hmm 82 g 82 g UQU66578.1|CBM32|GH16_3 393 G 393 1 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (580 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.64 // Query: WNV82129.1|CBM32 [L=479] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-30 91.2 5.9 3.7e-30 91.2 5.9 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.2 5.9 3.7e-30 3.7e-30 8 123 .. 54 167 .. 48 168 .. 0.81 2 ? -3.4 0.2 0.68 0.68 78 79 .. 202 203 .. 186 231 .. 0.50 Alignments for each domain: == domain 1 score: 91.2 bits; conditional E-value: 3.7e-30 CBM32.hmm 8 essssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitfd 95 ++ss ++ +++a++avDgd+++rWssa + qw++vdLg+ ++kvvl+w a +kd++v++S D +tWtt+ ++ + + g t+d WNV82129.1|CBM32 54 TASSLEGDQFTADRAVDGDTGSRWSSAfQdpQWIQVDLGSDAAISKVVLNWerA---SAKDFTVQTSGDATTWTTISTVVDGD-GG--VETLD 140 3455566669****************85379********************544...5******************8765432.33..23555 PP CBM32.hmm 96 kpvtaryvRltvtkratnawgasiaEla 123 + ++ryvRl++tkr+t ++g+s++E++ WNV82129.1|CBM32 141 VTGSGRYVRLNATKRST-QYGVSLWEFQ 167 44679*******88876.79******96 PP == domain 2 score: -3.4 bits; conditional E-value: 0.68 CBM32.hmm 78 va 79 WNV82129.1|CBM32 202 TT 203 11 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (479 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 91.64 // Query: XEM50545.1|CBM32|GH16_3 [L=583] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-59 185.2 10.9 3.8e-33 100.8 2.5 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.8 2.5 3.8e-33 3.8e-33 4 123 .. 57 169 .. 53 170 .. 0.82 2 ! 88.7 1.4 2.1e-29 2.1e-29 3 122 .. 191 311 .. 189 313 .. 0.80 Alignments for each domain: == domain 1 score: 100.8 bits; conditional E-value: 3.8e-33 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnt 84 assa ++a+ ++a++avDgdp+trWss+ + q+l+vdLg+++++++vvl+w a ++k +++++S Dg tW t++++++ XEM50545.1|CBM32|GH16_3 57 ASSA----ESAA-FPASAAVDGDPGTRWSSGfSdpQTLQVDLGSTQQLSQVVLNWeaA---YAKAFTLQASADGATWSTLYSTTTG 134 3333....4556.*****************8536999******************744...5******************987664 PP CBM32.hmm 85 tdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 gt +t t++ ++ryvRlt+t+rat ++g+s++E++ XEM50545.1|CBM32|GH16_3 135 AGGT-QTLTVT--GSGRYVRLTGTQRAT-QYGYSLWEFQ 169 4344.455666..568*******99887.79******96 PP == domain 2 score: 88.7 bits; conditional E-value: 2.1e-29 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttva 79 tass++ + +g ++++a+D dp trW+++ + w+tvdLg++ v++vvl+w a+ + y+++vS+D+ +Wt ++ XEM50545.1|CBM32|GH16_3 191 TASSYQDDGACPG-CAPAKAFDRDPATRWATSatTgwvdpGWITVDLGAVAAVHQVVLQWdpAY---AVAYQIQVSNDNANWTSLY 272 5666764454444.89***************5431457889*******************6555...******************9 PP CBM32.hmm 80 ekgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEl 122 ++++ + +et t++ ++ryvR+++t+r +n +g+s++ + XEM50545.1|CBM32|GH16_3 273 STTSGKGF-KETLTLN--GSGRYVRMYGTAR-SNGYGYSLWGF 311 88764333.3577888..568*******665.55799**9977 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (583 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.43 // Query: XOU80253.1|CBM32|GH3 [L=1578] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-95 301.0 43.4 2.4e-28 85.3 1.9 5.2 6 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.5 1.7 8.5e-28 8.5e-28 11 122 .. 53 162 .. 48 164 .. 0.83 2 ! 74.9 5.3 4e-25 4e-25 14 122 .. 191 297 .. 182 299 .. 0.82 3 ! 81.9 2.5 2.7e-27 2.7e-27 11 122 .. 423 534 .. 416 536 .. 0.81 4 ? -3.8 0.1 0.94 0.94 17 47 .. 630 653 .. 619 665 .. 0.61 5 ? -2.4 0.2 0.33 0.33 31 54 .. 1339 1365 .. 1287 1396 .. 0.53 6 ! 85.3 1.9 2.4e-28 2.4e-28 13 123 .. 1431 1539 .. 1421 1540 .. 0.82 Alignments for each domain: == domain 1 score: 83.5 bits; conditional E-value: 8.5e-28 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitf 94 ss++ g + ++a+Dg+ +trW s++ qw++vdLg+p t+ +v++ w a + +dy+++ S+Dg++W tva+++n t gt ++t XOU80253.1|CBM32|GH3 53 SSTQVGLEVTAANDGNLGTRWGSDWedpQWIYVDLGQPSTIYEVEVVWegA---YGSDYDIQFSNDGSNWATVASVTNGTGGT--ERTA 136 3445558899*************86789********************644...5********************99866454..3444 PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEl 122 + +a+yvRl +r t wg+s++E+ XOU80253.1|CBM32|GH3 137 A-GGSAQYVRLHLLARGT-GWGYSLFEF 162 4.4679*******55444.5*******9 PP == domain 2 score: 74.9 bits; conditional E-value: 4e-25 CBM32.hmm 14 aggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd.gttetitfdk 96 +gg++a++a+Dg+++trW s+ w++vdL+++ +++++l w a + k+yk+++S+D ++Wt+++ + + d g+ + i ++ XOU80253.1|CBM32|GH3 191 EGGNTASAATDGNESTRWGSDFvddAWIYVDLEQVSVISSIELSWeaA---YGKEYKIQTSNDANNWTDIYYT-DSGDgGS-DIIAVN- 273 56799***************844689*******************744...5******************744.3334355.455988. PP CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEl 122 ++a++vR+++++r t wg+s++ + XOU80253.1|CBM32|GH3 274 -TSAQFVRMQGISRGT-GWGYSLWSF 297 .689*******87765.599***988 PP == domain 3 score: 81.9 bits; conditional E-value: 2.7e-27 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitf 94 s++ gg+ a++++Dgd+ trW+s+ qw+++dL++++t+++vvl+w a+ +y++++S+D ++W++v + + g++++i+f XOU80253.1|CBM32|GH3 423 STEVGGNYAQAVTDGDDETRWESEAadpQWIYIDLDAAQTFQRVVLNWevAY---GANYTIQISNDATNWQDVEIILGGN-GEEDNINF 507 33445588***************84579********************7666...9*****************6533322.434589** PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEl 122 ++pvtaryvR+ +++r t +g+s++ + XOU80253.1|CBM32|GH3 508 ANPVTARYVRMLGSARGT-GYGFSLWSF 534 *************55444.599999987 PP == domain 4 score: -3.8 bits; conditional E-value: 0.94 CBM32.hmm 17 ggaenavDgdpntrWssagqwltvdLgkptt 47 ++a n+ D W + w++v g+++t XOU80253.1|CBM32|GH3 630 FTAPNLSDR-----WTYK--WFVVAVGGAQT 653 444444443.....6554..67777776665 PP == domain 5 score: -2.4 bits; conditional E-value: 0.33 CBM32.hmm 31 Wssag...qwltvdLgkpttvdkvvlt 54 W+ + ++ +dL+ + +++++ XOU80253.1|CBM32|GH3 1339 WAGGKtrsPTFGFDLNDTSAPPAFNVY 1365 222112333455555555555555555 PP == domain 6 score: 85.3 bits; conditional E-value: 2.4e-28 CBM32.hmm 13 aaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd.gtteti. 92 +++ + ++a+Dgdp trW+s++ q ++vdLg+++ v++vvl+w a + + y++ +StDg++W++++ + n d g +ti XOU80253.1|CBM32|GH3 1431 SSA-SIVDAATDGDPATRWQSKYsdaQHIIVDLGETYLVNRVVLNWesA---YGRAYRLHASTDGENWQEIYYT-NSGDgG-IDTIn 1511 233.6799*************9668999******************644...5******************844.433434.47898 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +v aryv++++++ra+ a+g+s++E++ XOU80253.1|CBM32|GH3 1512 NLS-AV-ARYVKMEGIERAS-AYGYSLWEFE 1539 998.45.9*******88875.69******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1578 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.96 // Query: XOU88434.1|CBM32|GH3 [L=1578] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-95 301.0 43.4 2.4e-28 85.3 1.9 5.2 6 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.5 1.7 8.5e-28 8.5e-28 11 122 .. 53 162 .. 48 164 .. 0.83 2 ! 74.9 5.3 4e-25 4e-25 14 122 .. 191 297 .. 182 299 .. 0.82 3 ! 81.9 2.5 2.7e-27 2.7e-27 11 122 .. 423 534 .. 416 536 .. 0.81 4 ? -3.8 0.1 0.94 0.94 17 47 .. 630 653 .. 619 665 .. 0.61 5 ? -2.4 0.2 0.33 0.33 31 54 .. 1339 1365 .. 1287 1396 .. 0.53 6 ! 85.3 1.9 2.4e-28 2.4e-28 13 123 .. 1431 1539 .. 1421 1540 .. 0.82 Alignments for each domain: == domain 1 score: 83.5 bits; conditional E-value: 8.5e-28 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitf 94 ss++ g + ++a+Dg+ +trW s++ qw++vdLg+p t+ +v++ w a + +dy+++ S+Dg++W tva+++n t gt ++t XOU88434.1|CBM32|GH3 53 SSTQVGLEVTAANDGNLGTRWGSDWedpQWIYVDLGQPSTIYEVEVVWegA---YGSDYDIQFSNDGSNWATVASVTNGTGGT--ERTA 136 3445558899*************86789********************644...5********************99866454..3444 PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEl 122 + +a+yvRl +r t wg+s++E+ XOU88434.1|CBM32|GH3 137 A-GGSAQYVRLHLLARGT-GWGYSLFEF 162 4.4679*******55444.5*******9 PP == domain 2 score: 74.9 bits; conditional E-value: 4e-25 CBM32.hmm 14 aggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd.gttetitfdk 96 +gg++a++a+Dg+++trW s+ w++vdL+++ +++++l w a + k+yk+++S+D ++Wt+++ + + d g+ + i ++ XOU88434.1|CBM32|GH3 191 EGGNTASAATDGNESTRWGSDFvddAWIYVDLEQVSVISSIELSWeaA---YGKEYKIQTSNDANNWTDIYYT-DSGDgGS-DIIAVN- 273 56799***************844689*******************744...5******************744.3334355.455988. PP CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEl 122 ++a++vR+++++r t wg+s++ + XOU88434.1|CBM32|GH3 274 -TSAQFVRMQGISRGT-GWGYSLWSF 297 .689*******87765.599***988 PP == domain 3 score: 81.9 bits; conditional E-value: 2.7e-27 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitf 94 s++ gg+ a++++Dgd+ trW+s+ qw+++dL++++t+++vvl+w a+ +y++++S+D ++W++v + + g++++i+f XOU88434.1|CBM32|GH3 423 STEVGGNYAQAVTDGDDETRWESEAadpQWIYIDLDAAQTFQRVVLNWevAY---GANYTIQISNDATNWQDVEIILGGN-GEEDNINF 507 33445588***************84579********************7666...9*****************6533322.434589** PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEl 122 ++pvtaryvR+ +++r t +g+s++ + XOU88434.1|CBM32|GH3 508 ANPVTARYVRMLGSARGT-GYGFSLWSF 534 *************55444.599999987 PP == domain 4 score: -3.8 bits; conditional E-value: 0.94 CBM32.hmm 17 ggaenavDgdpntrWssagqwltvdLgkptt 47 ++a n+ D W + w++v g+++t XOU88434.1|CBM32|GH3 630 FTAPNLSDR-----WTYK--WFVVAVGGAQT 653 444444443.....6554..67777776665 PP == domain 5 score: -2.4 bits; conditional E-value: 0.33 CBM32.hmm 31 Wssag...qwltvdLgkpttvdkvvlt 54 W+ + ++ +dL+ + +++++ XOU88434.1|CBM32|GH3 1339 WAGGKtrsPTFGFDLNDTSAPPAFNVY 1365 222112333455555555555555555 PP == domain 6 score: 85.3 bits; conditional E-value: 2.4e-28 CBM32.hmm 13 aaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd.gtteti. 92 +++ + ++a+Dgdp trW+s++ q ++vdLg+++ v++vvl+w a + + y++ +StDg++W++++ + n d g +ti XOU88434.1|CBM32|GH3 1431 SSA-SIVDAATDGDPATRWQSKYsdaQHIIVDLGETYLVNRVVLNWesA---YGRAYRLHASTDGENWQEIYYT-NSGDgG-IDTIn 1511 233.6799*************9668999******************644...5******************844.433434.47898 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +v aryv++++++ra+ a+g+s++E++ XOU88434.1|CBM32|GH3 1512 NLS-AV-ARYVKMEGIERAS-AYGYSLWEFE 1539 998.45.9*******88875.69******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1578 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 112.03 // Query: XMG35912.1|CBM32|GH3 [L=1159] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-85 268.3 26.7 7.3e-34 103.1 7.3 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 103.1 7.3 7.3e-34 7.3e-34 6 123 .. 46 160 .. 40 161 .. 0.82 2 ! 94.8 2.5 2.7e-31 2.7e-31 3 122 .. 184 296 .. 178 298 .. 0.80 3 ! 81.0 1.7 5.1e-27 5.1e-27 10 123 .. 320 430 .. 313 431 .. 0.83 Alignments for each domain: == domain 1 score: 103.1 bits; conditional E-value: 7.3e-34 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 +a++ss++ag ++a++avDgd++trW+sa+ qw++vdLg+p ++ +vvl+w a +k+y+++vStD tWttv+++++ gt XMG35912.1|CBM32|GH3 46 TATASSAQAG-NAAAAAVDGDTGTRWESAWadpQWIQVDLGAPASIGQVVLQWetA---SAKSYQLQVSTDAATWTTVYSTTTGAGGT- 129 4555555566.9****************9778*********************644...5******************9876644344. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 e+ t++ t+ryvRlt+t+r+t +g+s++E++ XMG35912.1|CBM32|GH3 130 ESLTVN--GTGRYVRLTGTARNT-GYGYSLWEFQ 160 455666..679*******66554.699*****96 PP == domain 2 score: 94.8 bits; conditional E-value: 2.7e-31 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 ta ss+++ag +a++a+Dgd++trWssa qwl+vdLg+++t+ + +l w a +++ ++++vStDg tWt+v+++++ t XMG35912.1|CBM32|GH3 184 TA----SSAENAG-TPASAAFDGDTGTRWSSAAsdpQWLQVDLGAVQTLCRASLMWeaA---YATAFQLQVSTDGATWTPVYSTTTGTG 264 22....3334555.9****************84479********************744...5******************98876543 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEl 122 gt +t +++ t+ryvR+++t+rat +g+s++ l XMG35912.1|CBM32|GH3 265 GT-QTLDVS--GTGRYVRMYGTARAT-GYGYSLWSL 296 43.344555..679*******88776.699999976 PP == domain 3 score: 81.0 bits; conditional E-value: 5.1e-27 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetit 93 ss ag +++++a+Dg ++trW+s+ qw+ dLg++ tv+ vvl+w a +++ y++ vS Dg tWttv ++++ + g et + XMG35912.1|CBM32|GH3 320 SSFVAG-NAPAAALDGRTTTRWESQAsdpQWIATDLGGTATVNCVVLNWesA---YASAYTIDVSPDGRTWTTVFSTTSGKGGV-ETLS 403 445566.89********9******84479********************644...5******************9877643243.4668 PP CBM32.hmm 94 fdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++r++R+++t+rat +g+s++E++ XMG35912.1|CBM32|GH3 404 LS--GSGRFIRMNGTTRAT-GYGYSLWEFE 430 88..568*******88776.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1159 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 128.41 // Query: BFZ72484.1|CBM32|GH16_3 [L=846] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-64 202.1 27.4 3.6e-25 75.0 3.3 4.3 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 74.6 2.6 5e-25 5e-25 7 121 .. 48 163 .. 42 166 .. 0.78 2 ! 75.0 3.3 3.6e-25 3.6e-25 6 123 .. 209 326 .. 204 327 .. 0.80 3 ! 64.8 3.0 5.4e-22 5.4e-22 4 123 .. 357 483 .. 351 484 .. 0.73 4 ? -0.6 0.1 0.093 0.093 69 92 .. 521 543 .. 502 595 .. 0.70 5 ? -3.5 0.0 0.77 0.77 83 107 .. 727 751 .. 721 761 .. 0.62 Alignments for each domain: == domain 1 score: 74.6 bits; conditional E-value: 5e-25 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 +++++s +g+++a+n++Dg+p trWss++ +++++dL +++ +d+v l+w a +++y+v++StD+ktW+t+a+ + t g BFZ72484.1|CBM32|GH16_3 48 TAKATSIEGNNPASNVTDGNPATRWSSEYrdgESVQIDLAATCVIDRVDLNWegA---FASEYTVSGSTDDKTWQTLATGTATGAG 130 4445555677*****************8667899******************644...5******************987654334 PP CBM32.hmm 88 tteti.tfdkpvta.ryvRltvtkratnawgasiaE 121 +t ++++ + a r++++t+ kr + ++g s++ BFZ72484.1|CBM32|GH16_3 131 A-QTLdKLAD-IGAiRHLKVTGDKRGS-DYGISLYT 163 4.45557773.3344*******55443.68888875 PP == domain 2 score: 75.0 bits; conditional E-value: 3.6e-25 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekgnttd.g 87 +a++s++++g+ +++na+Dg+p+trWss+ qw+tvdLg++ +d+v+l+w++ ++++ y +e+S +g tW + ++++ d g BFZ72484.1|CBM32|GH16_3 209 KASASTTENGDLAPKNATDGNPKTRWSSQAadgQWITVDLGATFLLDAVELDWET-SYARGYVLETSLNGWTWFPYESVTGS-DgG 292 3444556667789***************84469********************44.56****************99887654.435 PP CBM32.hmm 88 ttetitfd.kpvtaryvRltvtkratnawgasiaEla 123 + it d p ++r+vR+t t+r++ ++g+s++ ++ BFZ72484.1|CBM32|GH16_3 293 R-DVITSDkHP-RTRFVRMTSTERSS-QFGVSLWHFN 326 4.556777444.58*******88775.7999999985 PP == domain 3 score: 64.8 bits; conditional E-value: 5.4e-22 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa...g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgk.tWttvae 80 ass++ ++ + + ++++++D d trW+ a + w++vdL ++ +++++vl w a +k+y++ev + + Wttv++ BFZ72484.1|CBM32|GH16_3 357 ASSSQ-NDPQCVDCTPDKLFDQDLATRWAVAekdWsdnAWVQVDLAAQAEISQIVLRWdpAF---AKSYSIEVADSPTgPWTTVYK 438 33333.333344466**************9644326899*******************6555...*********764327****75 PP CBM32.hmm 81 .kgnttdgttetitfdkpvtaryvRltvtkra....tnawgasiaEla 123 +g+ t g+ e i++d+ + +ryv +++t+r+ n++g+s++E+ BFZ72484.1|CBM32|GH16_3 439 tVGG-TGGK-EVINIDT-TAGRYVQVNMTERTvgwgGNKYGFSLYEFR 483 1444.3354.5679993.346*******9977544344699*****95 PP == domain 4 score: -0.6 bits; conditional E-value: 0.093 CBM32.hmm 69 StDgktWttvaekgnttd.gtteti 92 D+k+Wt ++ ++n d ++ + BFZ72484.1|CBM32|GH16_3 521 AADDKKWT-LDHTANPGDnNN-AEL 543 56889999.765656544333.222 PP == domain 5 score: -3.5 bits; conditional E-value: 0.77 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRltv 107 +++ ++ ++++f++ + yvR+ BFZ72484.1|CBM32|GH16_3 727 DWPGsPD-KDTKFPAEMLVDYVRVFQ 751 5553232.366888556679999865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (846 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 87.61 // Query: XRE14181.1|CBM32|GH16_3 [L=560] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-51 159.2 20.7 1.5e-28 86.0 6.2 3.5 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 86.0 6.2 1.5e-28 1.5e-28 9 123 .. 44 156 .. 38 157 .. 0.82 2 ! 81.6 0.9 3.3e-27 3.3e-27 4 123 .. 179 299 .. 174 300 .. 0.80 3 ? 0.2 0.1 0.053 0.053 17 78 .. 332 389 .. 325 419 .. 0.59 4 ? -3.0 0.1 0.52 0.52 19 42 .. 470 499 .. 458 502 .. 0.47 Alignments for each domain: == domain 1 score: 86.0 bits; conditional E-value: 1.5e-28 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 +ss++ +++ ++avDgdp+trWssa qw+ +dLg+++ +d+vvl+w a +++ +++e+S Dg W t++++++ t g+ XRE14181.1|CBM32|GH16_3 44 TSSTEFDWSTGAAAVDGDPGTRWSSAAadnQWIRIDLGSVQAIDRVVLDWetA---YASGFRIETSADGAAWSTIYSTTTGTGGD- 125 34444555889**************84469********************644...5******************9887655444. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++d ++ry+Rl +t+rat +wg+s++El+ XRE14181.1|CBM32|GH16_3 126 QSLDVD--GSGRYLRLWATQRAT-QWGVSLWELQ 156 344666..678*******99887.8*******86 PP == domain 2 score: 81.6 bits; conditional E-value: 3.3e-27 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass+++ + + ++++a+D dp +rW+ + + w+ vdLg++ v++vvl+w a ++++++evS++g+tW+tv++ XRE14181.1|CBM32|GH16_3 179 ASSSQNDGNCWL-CSPDKAFDLDPASRWAVSpdTgwvdeGWIAVDLGAAAHVTSVVLQWdpAF---ATTFDIEVSDNGSTWRTVHT 260 344433333333.56*************995441347788*******************6555...*******************9 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkra.tnawgasiaEla 123 ++n t ++ti++d +++r+vR+ + r ++ +g+s++E++ XRE14181.1|CBM32|GH16_3 261 TTNGTGF-KQTIPLD--ANGRHVRVHM--RDrSGPYGYSLWEFQ 299 9885543.3699**9..568*******..665668*******96 PP == domain 3 score: 0.2 bits; conditional E-value: 0.053 CBM32.hmm 17 ggaenavDgdpntrWssagqwltvdLgkpttvdkvvltw.ae..ngrikdykvevSt...DgktWttv 78 g+a a Dg ++W+ +d g p++ + v+t+ ++ ++ ++ +e+ Dg ++t XRE14181.1|CBM32|GH16_3 332 GPAGTAADG---SKWH-------IDAGLPQNNEQQVYTPsGNgfQDGQGNFVLEARRedrDGRQYTSH 389 566777777...6665.......677777777777777752233366667777777434456777643 PP == domain 4 score: -3.0 bits; conditional E-value: 0.52 CBM32.hmm 19 aenavDgdpn....trWssag..qwltvdL 42 a ++ Dg++ W++++ + +++ L XRE14181.1|CBM32|GH16_3 470 AYALPDGSKIsdgfHTWAAEWdsEGIQFSL 499 555556643211122344432233377766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (560 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 59.89 // Query: XKS79141.1|CBM32|GH16_3 [L=576] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-56 174.9 10.1 3.4e-31 94.5 0.5 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.5 0.5 3.4e-31 3.4e-31 10 123 .. 45 155 .. 40 156 .. 0.84 2 ! 83.8 3.5 6.9e-28 6.9e-28 3 123 .. 182 303 .. 180 304 .. 0.81 Alignments for each domain: == domain 1 score: 94.5 bits; conditional E-value: 3.4e-31 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 ss++++ ++a avDg+p trWssa + qw+ vdLg+p ++++v+l+w a + k ++++vS+D +tW tv+e+++ t gt + XKS79141.1|CBM32|GH16_3 45 SSTEDP-FTAPGAVDGNPATRWSSAfSdpQWIRVDLGAPARISRVTLQWeaA---YGKAFRIQVSDDAETWSTVHETADGTGGT-Q 125 455677.9****************85379********************744...5******************9887755344.3 PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEla 123 + t+ t+ryvR+++t+r t ++g+s++E++ XKS79141.1|CBM32|GH16_3 126 NLTLM--GTGRYVRMYGTQRGT-QYGFSLWEFQ 155 44665..568*******88766.799*****96 PP == domain 2 score: 83.8 bits; conditional E-value: 6.9e-28 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttva 79 tass++s + ++ ++++a+D dp +rW+++ + w+ vdLg++ +++kvvl+w a+ +k+++++vS +g++Wt+++ XKS79141.1|CBM32|GH16_3 182 TASSSQSDGNCWE-CTPARAFDRDPASRWATSstTgwtdpGWISVDLGATAQITKVVLQWdpAY---AKSFQIQVSPNGTDWTPIY 263 5677766666566.99***************5331456889*******************6555...******************9 PP CBM32.hmm 80 ekgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++++ t + +t +++ t+r+vR+++t+rat +g+s++E++ XKS79141.1|CBM32|GH16_3 264 STTSGTGFK-QTLSVS--GTGRHVRMYGTERAT-PYGYSLWEFQ 303 887644322.355666..579*******88876.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (576 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.19 // Query: XIF80999.1|CBM32|GH16_3 [L=589] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-58 182.1 21.7 1.7e-31 95.4 4.9 2.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.7 0.1 0.42 0.42 70 81 .. 256 267 .. 236 283 .. 0.59 2 ! 95.4 4.9 1.7e-31 1.7e-31 7 123 .. 337 450 .. 330 451 .. 0.80 3 ! 95.1 5.0 2.2e-31 2.2e-31 6 123 .. 471 585 .. 466 586 .. 0.82 Alignments for each domain: == domain 1 score: -2.7 bits; conditional E-value: 0.42 CBM32.hmm 70 tDgktWttvaek 81 Dg+++ t+ ++ XIF80999.1|CBM32|GH16_3 256 LDGTQYFTLNST 267 366666665432 PP == domain 2 score: 95.4 bits; conditional E-value: 1.7e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++sss++a+ ++a na+Dgd +trWss+ + qwl+vdLg+++++++ +ltw a ++ y++++StDg++W ++a+ +n XIF80999.1|CBM32|GH16_3 337 TASSSESAQ-FPAGNATDGDLTTRWSSGfSdpQWLQVDLGQNYNLSHATLTWeaA---AASAYQIQTSTDGNNWAVAASNNN---- 414 444555555.*****************85379********************743...5****************7765433.... PP CBM32.hmm 88 tteti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++++i +++ taryvR+++t+ra+ +wg s++Ela XIF80999.1|CBM32|GH16_3 415 SPQDIqSLALSGTARYVRVNATSRAS-QWGDSLYELA 450 32355566633679*******88765.7******985 PP == domain 3 score: 95.1 bits; conditional E-value: 2.2e-31 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 +++sss++a+ ++a navDg+++trWss+ + qwl+vdLg+ +++++v l+w a +++ ++++vS+D++tWt + ++ XIF80999.1|CBM32|GH16_3 471 ATASSSENAS-FTAGNAVDGNTGTRWSSQfSdpQWLEVDLGASHQLSRVDLNWetA---YAQAFQIQVSNDNNTWTNLTPVTAGAA 552 3444556666.*****************85379********************644...5******************87775433 PP CBM32.hmm 87 .gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + ++ t++ ++ryvR+ +t+rat +wg+s++E++ XIF80999.1|CBM32|GH16_3 553 gP--QSLTVS--GSGRYVRMLGTQRAT-QWGYSLWEFQ 585 23..355776..568*******99887.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (589 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.85 // Query: UZF72140.1|CBM32|GH16_3 [L=568] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-58 182.7 15.4 1.9e-33 101.8 4.0 2.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 101.8 4.0 1.9e-33 1.9e-33 4 123 .. 42 154 .. 37 155 .. 0.83 2 ! 88.4 1.2 2.5e-29 2.5e-29 4 122 .. 177 296 .. 174 298 .. 0.77 3 ? -3.8 0.1 0.94 0.94 64 79 .. 503 516 .. 485 527 .. 0.62 Alignments for each domain: == domain 1 score: 101.8 bits; conditional E-value: 1.9e-33 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnt 84 a ss+++a+ ++a++avDgdp+trWssa + q+l+vdLg+++++++vvltw a ++k +++++S Dg+tWt ++++++ UZF72140.1|CBM32|GH16_3 42 A----SSTESAA-FPASAAVDGDPGTRWSSAfSdpQYLQVDLGSTQQLSQVVLTWeaA---YAKAFTIQASADGNTWTSLYSTTTA 119 2....3334555.*****************8536999******************744...5******************988765 PP CBM32.hmm 85 tdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t gt +t +++ ++ryvRlt+t+rat ++g+s++E++ UZF72140.1|CBM32|GH16_3 120 TGGT-QTLNVT--GSGRYVRLTGTQRAT-QYGYSLWEFQ 154 4354.455666..578*******99887.79******96 PP == domain 2 score: 88.4 bits; conditional E-value: 2.5e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass++ + +g +++a+D dp trW+++ + w+tvdLg+p v++vvl+w a+ + y+++vS+D+ +Wt +++ UZF72140.1|CBM32|GH16_3 177 ASSYQDDGACPG-CLPAKAFDHDPATRWATSatTgwvdpGWITVDLGAPAAVHQVVLQWdpAY---AVAYQLQVSNDNANWTSIYS 258 555543333333.66***************5431457889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEl 122 +++ + + et t++ ++ryvR+++t+r +n +g+s++ + UZF72140.1|CBM32|GH16_3 259 TTTGKGFK-ETLTVN--GSGRYVRMYGTAR-SNGYGYSLWGF 296 77643333.455666..568*******665.55799**9977 PP == domain 3 score: -3.8 bits; conditional E-value: 0.94 CBM32.hmm 64 ykvevStDgktWttva 79 ++++ Dg+ ++t+ UZF72140.1|CBM32|GH16_3 503 MTFY--VDGNAFETIN 516 4444..4566666664 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (568 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.46 // Query: BGA86229.1|CBM32|GH16 [L=406] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-58 181.6 16.4 7.5e-33 99.8 5.2 2.4 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 99.8 5.2 7.5e-33 7.5e-33 7 123 .. 32 146 .. 27 147 .. 0.82 2 ! 87.1 3.4 6.4e-29 6.4e-29 5 123 .. 190 309 .. 186 310 .. 0.79 Alignments for each domain: == domain 1 score: 99.8 bits; conditional E-value: 7.5e-33 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 ++sss+++ ++a+ avDg+++trWssa + qw++vdLg++ t+++vvl+w a + + +++++S +g+tWt v+++++ t g BGA86229.1|CBM32|GH16 32 TASSSESTVAFPAASAVDGNAGTRWSSAfSdpQWIQVDLGATATISQVVLNWeaA---YGRAFQIQTSANGTTWTSVYSTTTGTGGV- 115 3344555566*****************85379********************744...5******************9887644233. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 +t t++ ++ryvR+++t+ra ++g+s++E++ BGA86229.1|CBM32|GH16 116 QTLTVS--GSGRYVRMYGTQRAL-QYGYSLWEFQ 146 355666..568*******99884.599*****96 PP == domain 2 score: 87.1 bits; conditional E-value: 6.4e-29 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgn 83 s+++ s+++ + ++++a+D dp +rW+++ + w++vdLg++ +v++vvl+w a+ +++++++vS+D +W t++++++ BGA86229.1|CBM32|GH16 190 STSQ-SDANCWECTPARAFDLDPASRWATSsTtgwvdpGWIYVDLGAVAQVHRVVLQWdpAY---ARSFQIQVSNDAANWSTIYTTTT 273 4444.444445589***************6413457889*******************6555...******************98876 PP CBM32.hmm 84 ttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t + + +++ + t+ryvR+++t+r+ +a+g+s++E++ BGA86229.1|CBM32|GH16 274 GTGFK-Q--NLTVNGTGRYVRMYGTQRS-GAYGYSLWEFQ 309 44322.2..44444679*******7765.479******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (406 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 62.53 // Query: WEH42961.1|CBM32|GH16_3 [L=574] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-56 175.9 15.7 9.3e-32 96.3 1.2 2.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.3 1.2 9.3e-32 9.3e-32 7 123 .. 42 155 .. 36 156 .. 0.81 2 ! 88.4 2.8 2.6e-29 2.6e-29 4 123 .. 181 301 .. 178 302 .. 0.82 3 ? -3.7 0.1 0.87 0.87 66 78 .. 509 521 .. 494 534 .. 0.59 Alignments for each domain: == domain 1 score: 96.3 bits; conditional E-value: 9.3e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++ss++++ +ga+ avDgd +trWss+ qw+++dLg++ +++vvltw a ++k +++evS+D +Wt+v+++++ t g WEH42961.1|CBM32|GH16_3 42 VTASSTEGP-FGASSAVDGDLGTRWSSGFadpQWIQIDLGANAAISRVVLTWeaA---YAKGFRIEVSSDAASWTVVHQTATGT-G 122 444555556.*****************84469********************744...5******************9765543.3 PP CBM32.hmm 88 tteti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ + t+ryvR+++t+rat +g+s++E++ WEH42961.1|CBM32|GH16_3 123 G---VqNLAVTGTGRYVRMYGTQRAT-LYGYSLWEFQ 155 3...3366655779*******88775.599*****96 PP == domain 2 score: 88.4 bits; conditional E-value: 2.6e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass+++ s+ ++ ++++a+D dp +rW+++ + w+ vdLg++ ++dkvvl+w a+ +k+++++vS++g +Wt++++ WEH42961.1|CBM32|GH16_3 181 ASSSQADSNCWE-CTPARAFDRDPASRWATSptTgwtdpGWISVDLGATAQIDKVVLQWdpAY---AKSFQIQVSSNGADWTPIYS 262 567777777777.99***************5431346789*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + +t ++ t+ryvR+++t+rat +g+s++E++ WEH42961.1|CBM32|GH16_3 263 TTSGTGFK-QTLAVS--GTGRYVRMYGTQRAT-PYGYSLWEFQ 301 87644322.355665..679*******88876.79******96 PP == domain 3 score: -3.7 bits; conditional E-value: 0.87 CBM32.hmm 66 vevStDgktWttv 78 + +S Dg t t+ WEH42961.1|CBM32|GH16_3 509 ITYSLDGRTVFTL 521 4455565554444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (574 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.12 // Query: XUZ25307.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-57 178.5 10.2 6.6e-31 93.6 1.9 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.6 1.9 6.6e-31 6.6e-31 9 123 .. 49 160 .. 42 161 .. 0.83 2 ! 88.1 1.7 3.2e-29 3.2e-29 4 123 .. 184 304 .. 181 305 .. 0.78 3 ? -3.1 0.0 0.57 0.57 83 105 .. 553 575 .. 546 576 .. 0.65 Alignments for each domain: == domain 1 score: 93.6 bits; conditional E-value: 6.6e-31 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 +ss++++ ++a avDgdp+trWssa + +w+ +dLg+ t+v +vvl+w a ++++y++evS++g++W+tv+++++ + g XUZ25307.1|CBM32|GH16_3 49 ASSTEGP-FTAPSAVDGDPSTRWSSAfTddEWIRIDLGTSTSVAQVVLDWeaA---YARSYRLEVSDNGTDWRTVHSTTTGSGGV- 129 3444455.*****************853699*******************744...5******************9876643243. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+r++R+ +++rat +wg+s++E++ XUZ25307.1|CBM32|GH16_3 130 ETLTVS--GTGRFIRMHGIERAT-DWGYSLHEFQ 160 455666..579*******99887.7*******96 PP == domain 2 score: 88.1 bits; conditional E-value: 3.2e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as++++ + ++ ++++a+D dp +rW+++ + w+ vdLg+ ++++vvl+w a+ ++ y++evS++g++Wtt+++ XUZ25307.1|CBM32|GH16_3 184 ASTSQHDGTCWE-CSPDKAFDRDPASRWATSpeggWtdpGWIAVDLGARAEIHRVVLQWdpAY---ARAYRIEVSDNGTDWTTIHS 265 555554555455.89***************5443326788*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + t+d t+r+vRl++t r ++++g+s++E++ XUZ25307.1|CBM32|GH16_3 266 TTTGTG-F--RETLDVSGTGRHVRLYATRR-SGEYGYSLWEFQ 304 876442.2..2355544679*******665.5579******96 PP == domain 3 score: -3.1 bits; conditional E-value: 0.57 CBM32.hmm 83 nttd.gtte.titfdkpvtaryvRl 105 +++ + + t++f+++ + yv++ XUZ25307.1|CBM32|GH16_3 553 DWPGpP--DaTTRFPQKMSIDYVKV 575 454333..33778998888899987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.26 // Query: BFE68979.1|CBM32 [L=411] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-51 159.1 13.6 7.9e-29 86.9 5.3 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 86.9 5.3 7.9e-29 7.9e-29 8 123 .. 63 177 .. 57 178 .. 0.80 2 ! 77.4 1.2 6.8e-26 6.8e-26 5 123 .. 212 332 .. 208 333 .. 0.79 Alignments for each domain: == domain 1 score: 86.9 bits; conditional E-value: 7.9e-29 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekg.nttdgttetitf 94 ++ss +++g +a++a+Dg+++trWssa qwl+vdLg++t v++v+l+w a +++ ++v+ St+g+t+t + + ++g + it+ BFE68979.1|CBM32 63 TASSVEWAGTPASAATDGNTGTRWSSAFapsQWLQVDLGATTAVSSVNLNWeaA---YATAFTVQFSTNGTTFTNAT-GTlRGNVGA-QAITV 150 4456666669****************84478********************744...5****************983.331221233.46677 PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 + +aryvRl+ t+ra +g+s++E++ BFE68979.1|CBM32 151 A--GNARYVRLNLTERALAIYGYSLWEFQ 177 6..679*******99996469******96 PP == domain 2 score: 77.4 bits; conditional E-value: 6.8e-26 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 +s+e+++ + + + +a+D dp trW+++ + w++vdLg++ ++++v+l+w a+ ++ y+++vS + +tWt+++++++ + + BFE68979.1|CBM32 212 ASSEQNDVNCNPCTVGKAFDLDPATRWATSsTtgwvdpGWIYVDLGATAQISRVELQWdpAY---ATAYRIQVSPNASTWTDIYSTTTGKGFK 301 344456666666889**************6413457889*******************6555...******************9877643333 PP CBM32.hmm 89 teti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ +++ ++ryvR+++t+r ++ +g+s++ ++ BFE68979.1|CBM32 302 --EVlNVS--GSGRYVRMYGTAR-SGPYGYSLYDFN 332 ..454887..568*******554.55799**99885 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (411 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 60.65 // Query: UUS33873.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-58 182.0 15.0 1.7e-32 98.7 2.9 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.7 2.9 1.7e-32 1.7e-32 10 123 .. 46 156 .. 41 157 .. 0.83 2 ! 88.1 4.4 3.3e-29 3.3e-29 4 123 .. 184 304 .. 181 305 .. 0.80 Alignments for each domain: == domain 1 score: 98.7 bits; conditional E-value: 1.7e-32 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 ss+ ++ ++ +navDgdp+trWssa qw++vdLg++ ++++v+l+w a ++k ++v+vS D tW tv+e++ g+ + UUS33873.1|CBM32|GH16_3 46 SST-ENPFAGANAVDGDPGTRWSSAFadpQWIQVDLGAAAKISEVTLNWeaA---YAKAFQVQVSADARTWSTVHETTAGAGGS-Q 126 333.4559****************84469********************744...5******************9887644344.3 PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ t+ryvR+++t+rat ++g+s++E++ UUS33873.1|CBM32|GH16_3 127 RLSVS--GTGRYVRVYGTQRAT-QYGYSLWEFQ 156 44665..578*******99887.79******96 PP == domain 2 score: 88.1 bits; conditional E-value: 3.3e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa...g....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass+++ + ++ ++++a+D dp +rW+++ g w+ vdLg++ +++kvvl+w a +k ++++vS D+++Wt++++ UUS33873.1|CBM32|GH16_3 184 ASSSQNDGHCWE-CTPARAFDRDPASRWATSptnGwtdpGWISVDLGATAQISKVVLQWdaA---SAKAFQIQVSPDNTNWTPIYS 265 455555555555.89***************5433146789*******************643...5******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + +t t + t+ryvR+++t+rat ++g+s++E++ UUS33873.1|CBM32|GH16_3 266 TTTGTGFK-QTLTMS--GTGRYVRVYGTQRAT-QYGYSLWEFQ 304 87644332.456766..578*******99887.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 93.95 // Query: WNI19517.1|CBM32|GH16_3 [L=700] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-85 268.5 43.4 3e-34 104.4 4.8 4.2 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 97.8 11.3 3.2e-32 3.2e-32 6 123 .. 33 148 .. 29 149 .. 0.82 2 ! 104.4 4.8 3e-34 3e-34 8 123 .. 172 285 .. 165 286 .. 0.84 3 ! 83.1 4.6 1.1e-27 1.1e-27 4 122 .. 323 442 .. 320 444 .. 0.78 4 ? -1.9 0.1 0.24 0.24 61 81 .. 493 512 .. 481 568 .. 0.55 5 ? -1.6 0.0 0.19 0.19 68 83 .. 637 653 .. 609 699 .. 0.62 Alignments for each domain: == domain 1 score: 97.8 bits; conditional E-value: 3.2e-32 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 +a++ss++++g +a+ avDgd++trWssa qwl+vdLg++ t+++v+l w a ++k y++++S Dg++Wtt++++++ WNI19517.1|CBM32|GH16_3 33 TATASSTENAGTPASSAVDGDNGTRWSSAAadpQWLQVDLGATSTITQVTLSWeaA---YAKAYQIQTSGDGQNWTTAYSTTTGAG 115 344455555659****************84579********************744...5******************98766432 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 gt +++ + ++ryvR++ t+rat +wg+s++E++ WNI19517.1|CBM32|GH16_3 116 GT---ENLTVNGSGRYVRIYTTQRAT-QWGVSLWEFQ 148 43...455544679*******99887.8*******96 PP == domain 2 score: 104.4 bits; conditional E-value: 3e-34 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 ++ss++++g +a+ avDgd++trWssa qw++vdLg+ +++ +v+l w a ++k y+v+vS Dg++Wtt++++++ + gt WNI19517.1|CBM32|GH16_3 172 TASSTENAGTPASSAVDGDNGTRWSSAAadpQWVQVDLGSSQNICGVNLVWeaA---YAKAYQVQVSADGQNWTTAYSTTTGPGGT 254 3344445559****************84579********************744...5******************9887654355 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEla 123 e it++ t+ry+R+++t+rat ++g+s++E++ WNI19517.1|CBM32|GH16_3 255 -ELITLT--GTGRYIRVYGTQRAT-QYGYSLWEFQ 285 .688**9..568*******99887.79******96 PP == domain 3 score: 83.1 bits; conditional E-value: 1.1e-27 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as+ + ++s g ++++a+D+dp trW+++ + w+ vdLg++ ++kvvl+w a+ + y++++S D+++Wt v++ WNI19517.1|CBM32|GH16_3 323 ASTFQDANSCVG-CTPAKAFDEDPATRWATSdsNgwvdpGWISVDLGATAHITKVVLQWdpAY---AVAYQIQTSPDNTNWTSVYS 404 444443444444.88***************6431457889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEl 122 +++ + +et t+d ++ryvR+++t+r +n +g+s++ + WNI19517.1|CBM32|GH16_3 405 TTTGKGF-KETLTVD--GNGRYVRMYGTAR-SNGYGYSLWTF 442 7764333.3566887..568*******665.55799***988 PP == domain 4 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 61 ikdykvevStDgktWttvaek 81 ++ ++e+ t+g + tt + WNI19517.1|CBM32|GH16_3 493 GQNGELETYTNGDN-TTMDGN 512 44555555555544.444422 PP == domain 5 score: -1.6 bits; conditional E-value: 0.19 CBM32.hmm 68 vStDgktWttvaekg.n 83 S Dg+ + t+++ + + WNI19517.1|CBM32|GH16_3 637 FSVDGHAFFTADKATvE 653 57788888888655422 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (700 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 66.82 // Query: XQE90132.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-59 186.6 8.5 4.9e-33 100.4 2.0 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.4 2.0 4.9e-33 4.9e-33 7 123 .. 47 160 .. 41 161 .. 0.82 2 ! 88.8 0.5 2e-29 2e-29 4 123 .. 184 304 .. 180 305 .. 0.77 3 ? -2.8 0.0 0.46 0.46 83 105 .. 553 575 .. 548 576 .. 0.67 Alignments for each domain: == domain 1 score: 100.4 bits; conditional E-value: 4.9e-33 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++++ ++a navDg+p trWss+ + qw+ +dLg+ t v +vvl+w a +++ y++e S +g++Wtt++++++ t g XQE90132.1|CBM32|GH16_3 47 ATASSAEGP-FTAPNAVDGNPATRWSSEfTddQWIRIDLGTSTAVGQVVLNWeaA---YARGYRIELSANGTNWTTIHSTTTGTGG 128 333444455.*****************85369********************744...5******************988764423 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ry+Rl +t+rat wg+s++E++ XQE90132.1|CBM32|GH16_3 129 V-ETLTVS--GTGRYIRLLGTQRAT-PWGYSLHEFQ 160 3.455666..579*******88876.8*******96 PP == domain 2 score: 88.8 bits; conditional E-value: 2e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as+++ +++ + g+++a+D dp +rW+++ + w+ vdLg+p ++++vvl+w a+ ++ y++evS++g +W+t+++ XQE90132.1|CBM32|GH16_3 184 ASTSQ-HDGTCWECGPDKAFDRDPASRWATSpeggWtdpGWIAVDLGAPARINRVVLQWdpAY---ARAYRIEVSDNGADWRTIHQ 265 33343.344444488***************5443326788*******************6555...******************97 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + et +++ t+r+vRl++t+r+ +++g+s++E++ XQE90132.1|CBM32|GH16_3 266 TASGTGFK-ETLDVS--GTGRHVRLYATQRS-GQYGYSLWEFQ 304 76644322.344555..679*******7765.47*******96 PP == domain 3 score: -2.8 bits; conditional E-value: 0.46 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRl 105 +++ ++ +t++f+++ ++ y+++ XQE90132.1|CBM32|GH16_3 553 DWPGpPD-TTTRFPQKLSVDYIKV 575 5554343.3669998888999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.05 // Query: UOX92130.1|CBM32|GH16_3 [L=722] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-59 185.2 13.8 7.3e-34 103.1 4.2 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 103.1 4.2 7.3e-34 7.3e-34 9 123 .. 196 308 .. 191 309 .. 0.84 2 ! 86.7 2.0 8.6e-29 8.6e-29 3 122 .. 330 450 .. 326 452 .. 0.77 Alignments for each domain: == domain 1 score: 103.1 bits; conditional E-value: 7.3e-34 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 +ss+++g ++a++avDgd++trWssa g qwl+vdLg+++++++vvltw a ++k +++++S Dg tWt ++++++ t g+ UOX92130.1|CBM32|GH16_3 196 ASSTESGAFPASAAVDGDAGTRWSSAfGdpQWLQVDLGSTQQLSQVVLTWeaA---YAKAFTIQASADGATWTSLYSTTTATGGS- 277 35556777*****************85379********************744...5******************9887655454. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 +t +++ ++ryvRlt+t+rat ++g+s++E++ UOX92130.1|CBM32|GH16_3 278 QTLNVT--GSGRYVRLTGTQRAT-QYGYSLWEFQ 308 455666..568*******99887.79******96 PP == domain 2 score: 86.7 bits; conditional E-value: 8.6e-29 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttva 79 tass++ + +g +++a+D dp trW+++ + w+tvdLg++ +++vvl+w a+ + y+++vS+D+ +Wt ++ UOX92130.1|CBM32|GH16_3 330 TASSYQDDGACPG-CLPAKAFDHDPATRWATSatTgwvdpGWITVDLGATAAIHQVVLQWdpAY---AVAYQIQVSNDNANWTSLY 411 3445543333333.55***************5431457889*******************6555...******************9 PP CBM32.hmm 80 ekgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEl 122 ++++ + +et t++ ++ryvR+++t+r +n +g+s++ + UOX92130.1|CBM32|GH16_3 412 STTSGKGF-KETLTVN--GSGRYVRMYGTAR-SNGYGYSLWGF 450 88764333.2455666..568*******665.55799**9977 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (722 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.28 // Query: BFP57343.1|CBM32|GH16_3 [L=578] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-58 182.5 13.5 1.5e-32 98.9 4.0 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.9 4.0 1.5e-32 1.5e-32 7 123 .. 47 160 .. 41 161 .. 0.84 2 ! 88.0 1.8 3.5e-29 3.5e-29 4 123 .. 185 305 .. 181 306 .. 0.77 3 ? -3.1 0.0 0.54 0.54 83 105 .. 554 576 .. 548 577 .. 0.66 Alignments for each domain: == domain 1 score: 98.9 bits; conditional E-value: 1.5e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++a+ ++a+ avDgd trWssa + +w+ +dLg+ t++ +vvl+w a ++k y++evS Dg++Wtt++++++ + g BFP57343.1|CBM32|GH16_3 47 ATASSTEAP-FTAASAVDGDRATRWSSAfTddEWIRIDLGASTSIGQVVLDWeaA---YAKGYRLEVSADGTDWTTIHSTTTGSGG 128 455677788.*****************853699*******************744...5******************987664324 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ry+R+ +t+rat awg+s++E++ BFP57343.1|CBM32|GH16_3 129 V-ETLTVS--GTGRYIRMHGTERAT-AWGYSLHEFQ 160 3.455666..579*******88876.7*******96 PP == domain 2 score: 88.0 bits; conditional E-value: 3.5e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekg 82 as+++ +++ + ++++a+D dp +rW+++ + w+ vdLg+ ++++vvl+w+ +++ y++evS++g++Wtt+++++ BFP57343.1|CBM32|GH16_3 185 ASTSQ-HDGTCWECSPDKAFDRDPASRWATSpeggWtdqGWIAVDLGARAEIHRVVLQWDP-AHARAYRIEVSDNGTDWTTIHSTT 268 33333.334444478***************5433326788*******************54.56******************9887 PP CBM32.hmm 83 nttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + t + et +++ +r+vRl++t+r+ +a+g+s++E++ BFP57343.1|CBM32|GH16_3 269 TGTGFK-ETLDVSG--AGRHVRLYATQRS-GAYGYSLWEFQ 305 644322.3556654..36*******7765.479******96 PP == domain 3 score: -3.1 bits; conditional E-value: 0.54 CBM32.hmm 83 nttd.gtte.titfdkpvtaryvRl 105 +++ + + t++f+++ ++ yv++ BFP57343.1|CBM32|GH16_3 554 DWPGpP--DaTTRFPQKLSVDYVKV 576 554333..33779998888999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (578 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.39 // Query: XUK20490.1|CBM32|GH16_3 [L=588] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-60 187.7 12.7 2.6e-34 104.6 2.3 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 104.6 2.3 2.6e-34 2.6e-34 8 123 .. 57 169 .. 51 170 .. 0.82 2 ! 87.7 3.0 4.2e-29 4.2e-29 5 123 .. 196 315 .. 191 316 .. 0.79 Alignments for each domain: == domain 1 score: 104.6 bits; conditional E-value: 2.6e-34 CBM32.hmm 8 essssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 ++ss++++ ++a+ avDgd++trWss+ + qwl+vdLg+ t++++vvl w a ++k y+++vS Dg +Wtt++++++ t g+ XUK20490.1|CBM32|GH16_3 57 TASSQEGP-FTAASAVDGDDGTRWSSEfSddQWLQVDLGADTDISRVVLRWeaA---YAKGYRIQVSADGAQWTTLHTTTEGTGGD 138 34555555.*****************85369********************744...5******************9887644343 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEla 123 et +++ t+ryvR+ +t+rat +g+s++E++ XUK20490.1|CBM32|GH16_3 139 -ETLDVS--GTGRYVRMLGTERAT-PYGYSLWEFQ 169 .344555..679*******88876.79******96 PP == domain 2 score: 87.7 bits; conditional E-value: 4.2e-29 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaek 81 s+++ + + ++++a+D dp +rW+++ + w+ vdLg+ t+++vvl+w a+ +k y++ vS++g++W+tv+++ XUK20490.1|CBM32|GH16_3 196 STSQDDGTCWL-CTPDKAFDRDPASRWATSpeggWtdpGWIAVDLGADATIHRVVLQWdpAY---AKAYRIDVSDNGTDWRTVYQT 277 34433333333.67***************5443326788*******************6555...******************977 PP CBM32.hmm 82 gnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++ + +eti++d +t+r+vR+++t+r+ +++g+s++E++ XUK20490.1|CBM32|GH16_3 278 TTGKGF-KETIDLD--TTGRHVRMYGTQRS-GEYGYSLWEFQ 315 654333.4699999..679*******7765.479******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (588 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.88 // Query: WNI16456.1|CBM32|GH16_3 [L=615] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-62 194.9 27.3 3.5e-34 104.2 8.8 3.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.0 0.51 0.51 70 81 .. 273 284 .. 252 304 .. 0.63 2 ! 97.8 7.9 3.3e-32 3.3e-32 7 123 .. 356 469 .. 349 470 .. 0.80 3 ! 104.2 8.8 3.5e-34 3.5e-34 6 123 .. 497 611 .. 492 612 .. 0.81 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.51 CBM32.hmm 70 tDgktWttvaek 81 Dg ++ t+ + WNI16456.1|CBM32|GH16_3 273 LDGANYFTLSSN 284 466666666432 PP == domain 2 score: 97.8 bits; conditional E-value: 3.3e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++sss++a+ ++a+na+Dgd +trWss+ + qwl+vdLg+++t+++ ++ w a ++ y++++St+g+tWttv++ +n + WNI16456.1|CBM32|GH16_3 356 TASSSESAT-FPASNATDGDVTTRWSSGfSdpQWLQVDLGQNYTINHATVIWeaA---AASAYQLQTSTNGTTWTTVYTNNNSP-A 436 444555556.*****************85379********************643...5******************9765432.2 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ ++ +taryvR+++t+ra+ ++g s++Ela WNI16456.1|CBM32|GH16_3 437 DIQDTALN--ATARYVRVYATARAS-QYGDSLYELA 469 22355666..679*******77665.7999**9985 PP == domain 3 score: 104.2 bits; conditional E-value: 3.5e-34 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 +++sss++a+ ++a navDg+++trWssa + qwl+vdLg+++ v++vvl+w a + + y++++S Dg+tWttv++++n t WNI16456.1|CBM32|GH16_3 497 ATASSSENAS-FTAPNAVDGNTGTRWSSAfSdpQWLQVDLGATHAVSQVVLNWeaA---YGTAYQIQTSADGTTWTTVYSTTNAT- 577 3334555555.*****************85379********************744...5******************9988755. PP CBM32.hmm 87 gtteti.tfdkpvtaryvRltvtkratnawgasiaEla 123 g + t++ + ++ryvR+++t+r+t ++g+s++E++ WNI16456.1|CBM32|GH16_3 578 GG---VqTLPVTGSGRYVRFYGTARST-QYGYSLWEFQ 611 33...2255544679*******77766.89******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (615 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.26 // Query: XUT57034.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-58 181.8 11.1 6.1e-32 96.9 2.6 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.9 2.6 6.1e-32 6.1e-32 7 123 .. 47 160 .. 41 161 .. 0.84 2 ! 88.3 2.1 2.9e-29 2.9e-29 4 123 .. 184 304 .. 180 305 .. 0.77 3 ? -3.5 0.0 0.77 0.77 83 105 .. 553 575 .. 548 576 .. 0.65 Alignments for each domain: == domain 1 score: 96.9 bits; conditional E-value: 6.1e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++a+ ++a avDgd++trWss+ + +w+ vdLg+ t++ +vvl+w a ++k y++evS++g +W+t++++++ + g XUT57034.1|CBM32|GH16_3 47 ATASSTEAP-FTAPSAVDGDTSTRWSSGfTddEWIRVDLGASTSIGQVVLNWeaA---YAKGYRLEVSDNGADWRTIHSTTTGSGG 128 455677788.*****************853699*******************744...5******************987664324 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ry+R+ +t+rat wg+s++E++ XUT57034.1|CBM32|GH16_3 129 V-ETLTVS--GTGRYIRMHGTERAT-PWGYSLHEFQ 160 3.455666..579*******88876.8*******96 PP == domain 2 score: 88.3 bits; conditional E-value: 2.9e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as++++ + + ++++a+D dp +rW+++ + w+ vdLg+ ++++vvl+w a+ ++ y++evS++g +Wtt+++ XUT57034.1|CBM32|GH16_3 184 ASTSQHDGT-CWECSPDKAFDRDPASRWATSpeggWtdpGWIAVDLGARAEINRVVLQWdpAY---ARAYRIEVSDNGADWTTIHS 265 334433333.44478***************5443326788*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + et +++ t+r+vRl++t+r+ +++g+s++E++ XUT57034.1|CBM32|GH16_3 266 TTTGTGFK-ETLDVS--GTGRHVRLYATQRS-GEYGYSLWEFQ 304 87644322.344555..679*******7765.479******96 PP == domain 3 score: -3.5 bits; conditional E-value: 0.77 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRl 105 +++ ++ t++f+++ + y+++ XUT57034.1|CBM32|GH16_3 553 DWPGpPD-STTRFPQKMSIDYIKV 575 5544333.3669998888899987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.93 // Query: WAM33792.1|CBM32|GH81 [L=1051] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-35 108.9 9.2 1.2e-35 108.9 9.2 4.8 6 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.8 0.28 0.28 63 63 .. 264 264 .. 212 319 .. 0.48 2 ? -3.4 0.5 0.69 0.69 63 78 .. 411 432 .. 366 452 .. 0.50 3 ? 0.3 0.1 0.048 0.048 15 34 .. 511 539 .. 505 580 .. 0.62 4 ? -2.0 0.1 0.25 0.25 35 53 .. 744 765 .. 703 770 .. 0.55 5 ! 108.9 9.2 1.2e-35 1.2e-35 7 123 .. 769 884 .. 763 885 .. 0.85 6 ? 0.2 6.5 0.053 0.053 20 112 .. 916 1031 .. 903 1044 .. 0.59 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.28 CBM32.hmm 63 d 63 + WAM33792.1|CBM32|GH81 264 N 264 1 PP == domain 2 score: -3.4 bits; conditional E-value: 0.69 CBM32.hmm 63 dykvevStDgk......tWttv 78 ++ ++StD k tW t+ WAM33792.1|CBM32|GH81 411 WFTYSGSTDSKyfyynsTWGTL 432 3444555654322222266665 PP == domain 3 score: 0.3 bits; conditional E-value: 0.048 CBM32.hmm 15 ggggaenavDgdpn.tr......Wss...a 34 + +g +n vDg+++ ++ W++ + WAM33792.1|CBM32|GH81 511 A-SGHANFVDGNNQeSFseamnaWQAiilW 539 3.5789*****9763222222226654432 PP == domain 4 score: -2.0 bits; conditional E-value: 0.25 CBM32.hmm 35 g...qwltvdLgkpttvdkvvl 53 + ++ltvd g++ t +++ l WAM33792.1|CBM32|GH81 744 TasaNSLTVDSGGASTQTNIAL 765 0223346666666666665555 PP == domain 5 score: 108.9 bits; conditional E-value: 1.2e-35 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 a++ss ++++++a++a+Dg+ +trWssa + qw+ vdLg+++++++v+l+w a ++k+++++vStD+++Wttv+++++ t g WAM33792.1|CBM32|GH81 769 ATASSVENSNYPAAYAFDGNLSTRWSSAfSdpQWIAVDLGATYNITGVKLYWetA---YAKSFQIQVSTDNTNWTTVYSTTSGTGG-I 852 4567777888*****************85379********************644...5******************988754433.2 PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 ++itf+ p++aryvR+++t+r t +wg+s++E++ WAM33792.1|CBM32|GH81 853 NNITFT-PINARYVRMYGTERGT-QWGYSLWEFE 884 478998.99*********88766.7*******96 PP == domain 6 score: 0.2 bits; conditional E-value: 0.053 CBM32.hmm 20 enavDgdpn.trWssag.......qwltvdLgkpttvdkvvltw.aen.grikdykvevSt...DgktWttvaekg.nttd.gt.. 88 en+ + + t W+ ++ +w+ +++++ ++++ ++ g +++kve+ + Dg+ t + +++ + ++ gt WAM33792.1|CBM32|GH81 916 ENLQTTNSSvTGWQPTTtittttkHWYSPAINGTYKAGTWQFILwTNSpGSSSQVKVEIYKvnsDGSGATLIGSQTvDVNTtGTgn 1001 5555556567899996334457899***************9996633347788888885433347765444444443333223354 PP CBM32.hmm 89 ........te.titfdkpvtaryvRltvtkra.t 112 t +++f+ + +R+ +tk + WAM33792.1|CBM32|GH81 1002 hqsvfnisTSsDVSFN----NQRIRISITKVSgV 1031 4333332212244555....599***99885543 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1051 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 44.74 // Query: UWE07526.1|CBM32|GH16_3 [L=623] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-63 197.0 25.6 3.1e-34 104.3 7.8 3.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.48 0.48 70 81 .. 280 291 .. 260 311 .. 0.61 2 ! 100.2 6.8 6e-33 6e-33 7 123 .. 360 474 .. 354 475 .. 0.81 3 ! 104.3 7.8 3.1e-34 3.1e-34 6 123 .. 505 619 .. 500 620 .. 0.82 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.48 CBM32.hmm 70 tDgktWttvaek 81 Dg ++ t+ + UWE07526.1|CBM32|GH16_3 280 LDGANYFTLSSN 291 466666666432 PP == domain 2 score: 100.2 bits; conditional E-value: 6e-33 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++sss+++++++a+na+Dgd++trWss+ + qwl+vdLg+++++++ +ltw a ++ y++++StDg++Wttv++ +n + UWE07526.1|CBM32|GH16_3 360 TTSSSNESATFPASNATDGDITTRWSSGfSdpQWLQVDLGQNYNLNHATLTWeaA---AASAYQLQTSTDGSNWTTVYSNNNSP-A 441 3455566666*****************85379********************743...5******************9765532.3 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + ++++++ +taryvR+++t+ra+ ++g s++Ela UWE07526.1|CBM32|GH16_3 442 DIQDTNLS--ATARYVRVYATARAS-QYGDSLYELA 474 23466887..579*******77665.7999**9985 PP == domain 3 score: 104.3 bits; conditional E-value: 3.1e-34 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 +++sss++++ ++a avDg+++trWss+ + qwl+vdLg+ +++++vvl+w a +k++++++S Dg++Wttv+++++ t UWE07526.1|CBM32|GH16_3 505 ATASSSENDS-FTAPMAVDGNTGTRWSSGfSdpQWLQVDLGASHSISQVVLNWetA---AAKSFQIQTSADGSNWTTVYSTTTGTG 586 3334555555.*****************85379********************643...5******************98877555 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 g+ +ti+++ t+ryvR+++t+r t+++g+s++E++ UWE07526.1|CBM32|GH16_3 587 GN-QTIPVT--GTGRYVRMNGTAR-TTQYGYSLWEFQ 619 33.588888..568*******665.558*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (623 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 87.86 // Query: WFE39798.1|CBM32|GH3 [L=1029] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-54 170.2 13.4 2.9e-31 94.7 3.5 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 80.2 2.4 9.3e-27 9.3e-27 7 123 .. 53 167 .. 48 168 .. 0.79 2 ! 94.7 3.5 2.9e-31 2.9e-31 9 123 .. 190 303 .. 184 304 .. 0.82 Alignments for each domain: == domain 1 score: 80.2 bits; conditional E-value: 9.3e-27 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevS.tDgktWttvaekgnttdgtt 89 + +ss++++ +a++a+Dgd++trWssa qwl+vdLg++ t+d+v+l w a +++ ++++v Wt v++++ gt WFE39798.1|CBM32|GH3 53 T-ASSTEGAATPAAAATDGDAGTRWSSAFadpQWLQVDLGATATIDQVQLVWeaA---YATAFQIQVApAPSGPWTSVYSTTAGAGGT- 136 2.3444455589***************84469********************744...5*********655669****9887543244. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 +t ++ ++ryvR+++t+rat +g+s++E++ WFE39798.1|CBM32|GH3 137 QTLAVT--GSGRYVRMYGTGRAT-GYGYSLWEFK 167 344555..678*******88877.699*****96 PP == domain 2 score: 94.7 bits; conditional E-value: 2.9e-31 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttet 91 ++ss++gg+++++a+Dg +trWss+ g qwl vd+g++ t+++vvl w a +++ y++e+StDg+tWtt++++++ gt e+ WFE39798.1|CBM32|GH3 190 TASSWEGGNAPAAALDGRSTTRWSSQfGsdpQWLRVDFGGVATINRVVLVWeaA---YATGYRLETSTDGSTWTTIHATTTGRGGT-EQ 274 345667779********999*****752579********************744...5******************9876543244.45 PP CBM32.hmm 92 itfdkpvtaryvRltvtkratnawgasiaEla 123 t++ t+ry+Rl++t+rat +g+s++El+ WFE39798.1|CBM32|GH3 275 LTVS--GTGRYLRLYGTARAT-GYGYSLWELQ 303 5666..568*******88776.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1029 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.30 // Query: BFE55874.1|CBM32|GH16_3 [L=729] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-83 264.0 40.3 7e-33 99.9 9.4 4.0 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.8 7.1 4.9e-30 4.9e-30 7 123 .. 64 178 .. 58 179 .. 0.81 2 ! 99.9 9.4 7e-33 7e-33 5 123 .. 199 315 .. 194 316 .. 0.82 3 ! 88.2 3.8 3e-29 3e-29 4 123 .. 354 474 .. 351 475 .. 0.80 4 ? -1.8 0.1 0.23 0.23 80 80 .. 548 548 .. 502 594 .. 0.46 Alignments for each domain: == domain 1 score: 90.8 bits; conditional E-value: 4.9e-30 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++ss+++a+ +a+ a+Dgd++trWssa + qwl+vdLg++++++++ l+w a +++ +++++S+D ++Wt ++++++ g BFE55874.1|CBM32|GH16_3 64 TASSAESAA-TPASSATDGDAGTRWSSAfSvpQWLQVDLGSQQSITRIGLNWeaA---YATAFTIQTSNDATNWTNIYSTTSGAGG 145 333344555.89***************85379********************744...5******************988765435 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkra.tnawgasiaEla 123 + ++++ + t+ryvRl++ +a ++++g s++E++ BFE55874.1|CBM32|GH16_3 146 S--AVSLSVTGTGRYVRLNA--TAkNTQYGISLWEFQ 178 5..5577755789*******..553446*******96 PP == domain 2 score: 99.9 bits; conditional E-value: 7e-33 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgntt 85 ++a++ss++++g +a+ avDg+++trWssa qwl+vdLg++++v +v+l+w a +++ +++++St+g+tWtt++++++ t BFE55874.1|CBM32|GH16_3 199 KTATASSTENAGTPASSAVDGNNGTRWSSAAsdpQWLQVDLGSVQSVCGVTLNWetA---YATAFQIQTSTNGTTWTTIYTTTTGT 281 4555566666669****************84479********************644...5******************9887644 PP CBM32.hmm 86 dgtteti.tfdkpvtaryvRltvtkratnawgasiaEla 123 g + +++ + ++ryvR+++t+rat ++g+s++E++ BFE55874.1|CBM32|GH16_3 282 -GG---VqNLNVTGSGRYVRMNGTARAT-QYGYSLWEFQ 315 .33...3356544679*******77766.89******96 PP == domain 3 score: 88.2 bits; conditional E-value: 3e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa...g....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as++++ s+ ++ ++++a+D+dp +rW+++ g w++vdLg++ +++vvl+w a+ + +y++++S+D +Wt +++ BFE55874.1|CBM32|GH16_3 354 ASTSQNDSNCNP-CTPDKAFDNDPASRWATSpdnGwvdpGWIYVDLGAQAHITQVVLQWdpAY---AVSYQIQTSNDAANWTNIYS 435 555655555555.89***************5443147788*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ + + et t++ ++ryvR+++t+r++ +g+s++E++ BFE55874.1|CBM32|GH16_3 436 TTTGKGFK-ETLTVN--GNGRYVRMYGTQRSN-GYGYSLWEFK 474 87643333.455666..568*******77754.799*****96 PP == domain 4 score: -1.8 bits; conditional E-value: 0.23 CBM32.hmm 80 e 80 + BFE55874.1|CBM32|GH16_3 548 A 548 1 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (729 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.12 // Query: WFR59990.1|CBM32|CBM6|GH3 [L=1262] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-29 88.0 0.6 3.5e-29 88.0 0.6 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.3 0.4 0.05 0.05 60 81 .. 129 152 .. 69 198 .. 0.59 2 ! 88.0 0.6 3.5e-29 3.5e-29 6 123 .. 346 461 .. 341 462 .. 0.82 3 ? -1.9 0.2 0.23 0.23 21 55 .. 504 537 .. 492 618 .. 0.52 Alignments for each domain: == domain 1 score: 0.3 bits; conditional E-value: 0.05 CBM32.hmm 60 rikdykvevStDg..ktWttvaek 81 +++ +v + t+g +W ++ ++ WFR59990.1|CBM32|CBM6|GH3 129 GARTLRVNAVTNGwnLNWLELTSS 152 244444444444322355555444 PP == domain 2 score: 88.0 bits; conditional E-value: 3.5e-29 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnt 84 +a+++s +g + a++a+Dg+++trW+s+ + q+++vdLg+++++d+v+l+w a k+y ++vS+Dg++W++v++ +n WFR59990.1|CBM32|CBM6|GH3 346 TAQATSFLGG-NIANAAFDGNDKTRWESEfSdpQEIYVDLGSTYWIDGVKLNWetA---SGKEYILQVSKDGSEWHKVYTGNNA 425 4555566556.89***************8536999******************644...59*****************977554 PP CBM32.hmm 85 tdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + g e+i+fd p+++ryv+l ++ r ++ +g+s++E++ WFR59990.1|CBM32|CBM6|GH3 426 PGG-IESINFD-PAEGRYVKLIGNVR-NTPYGYSLWEFE 461 324.4799**9.889********443.336*******96 PP == domain 3 score: -1.9 bits; conditional E-value: 0.23 CBM32.hmm 21 navDgdpntrWssagqwltvdLgkpttvdkvvltw 55 +++Dg++ t s + + + Lg +tt++++ WFR59990.1|CBM32|CBM6|GH3 504 YTTDGSTPTATSPVY-TAPLHLGVTTTIRAIATGN 537 556663333322211.3556666666666666662 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1262 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 68.54 // Query: XOD98509.1|CBM32|GH16_3 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-24 72.9 4.0 1.6e-24 72.9 4.0 2.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.9 4.0 1.6e-24 1.6e-24 9 122 .. 7 133 .. 2 135 .. 0.75 2 ? -1.1 0.2 0.14 0.14 70 79 .. 364 373 .. 305 442 .. 0.66 Alignments for each domain: == domain 1 score: 72.9 bits; conditional E-value: 1.6e-24 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd.gt 88 +s++++ +++++a+D++++trW+s+ w+ vdLg+p ++++v+++w a ++y +evS+D +tWt++ ++ ++t g+ XOD98509.1|CBM32|GH16_3 7 ASTTQDRASDPQFAIDNSASTRWASGiAanAWYMVDLGAPAQISRVEIDWetAF---SSRYLIEVSNDRTTWTPASTVVTKTMnGN 89 3344555589***************752478*******************6544...99**************9987444444344 PP CBM32.hmm 89 .....tetitfdkpvtaryvRltvtk...ra.tn.awgasiaEl 122 +++++++ t ryvR++ t+ ra + ++g+s++ + XOD98509.1|CBM32|GH16_3 90 tlpplADRVNITASGTWRYVRMNSTErgwRAgDGsQYGVSMYDF 133 47643367788877889*******99444223223588888877 PP == domain 2 score: -1.1 bits; conditional E-value: 0.14 CBM32.hmm 70 tDgktWttva 79 +g t++tv XOD98509.1|CBM32|GH16_3 364 LNGRTFRTVT 373 4444444442 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 32.24 // Query: WUX73202.1|CBM32|GH16_3 [L=573] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-57 179.5 17.1 4.4e-33 100.6 3.6 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.6 3.6 4.4e-33 4.4e-33 6 123 .. 41 155 .. 36 156 .. 0.81 2 ! 85.4 3.7 2.2e-28 2.2e-28 4 123 .. 180 300 .. 177 301 .. 0.79 3 ? -2.1 0.0 0.28 0.28 86 86 .. 529 529 .. 491 572 .. 0.50 Alignments for each domain: == domain 1 score: 100.6 bits; conditional E-value: 4.4e-33 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 +a++ss+ +g ++a navDgdp+trWssa + qw+++dLg+ ++++v+l+w a + k +++evS++ ++Wt+v+++++ t WUX73202.1|CBM32|GH16_3 41 AATASSA-EGPFDARNAVDGDPGTRWSSAfTdpQWIQIDLGSSAKISRVTLNWeaA---YGKAFRIEVSDNAQEWTVVHQTTTGTG 122 3444444.555*****************85379********************744...5******************97766443 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 gt ++ ++ t+ryvR+++t+r+t ++g+s++E++ WUX73202.1|CBM32|GH16_3 123 GT-QSLAVT--GTGRYVRMYGTQRST-QYGYSLWEFQ 155 44.344554..679*******99877.79******96 PP == domain 2 score: 85.4 bits; conditional E-value: 2.2e-28 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass++ ++++ + ++++a+D dp +rW+++ + w+ vdLg++ +++kvvl+w a+ +k+++++vS +g++Wt++++ WUX73202.1|CBM32|GH16_3 180 ASSSQ-TDQNCWECTPARAFDRDPASRWATStTtgwtdpGWISVDLGATAQISKVVLQWdpAY---AKSFQIQVSPNGQDWTPIYS 261 44554.444455599***************5313456889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + +t ++ t+ryvR+++t+rat +g+s++E++ WUX73202.1|CBM32|GH16_3 262 TTSGTGFK-QTLAVS--GTGRYVRMYGTERAT-PYGYSLWEFQ 300 87644322.355665..679*******88876.79******96 PP == domain 3 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 86 d 86 WUX73202.1|CBM32|GH16_3 529 R 529 1 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (573 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 69.42 // Query: BFE49529.1|CBM32|GH16_3 [L=563] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-58 181.9 11.4 1.3e-32 99.1 5.6 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 99.1 5.6 1.3e-32 1.3e-32 8 123 .. 38 151 .. 31 152 .. 0.83 2 ! 85.5 0.3 2.1e-28 2.1e-28 3 123 .. 171 292 .. 168 293 .. 0.79 Alignments for each domain: == domain 1 score: 99.1 bits; conditional E-value: 1.3e-32 CBM32.hmm 8 essssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 +ss+++++ ++++navDg+p+trWssa + qwl+vdLg +++v + +ltw a +++ +++++StDg+tWt+v+++++ t gt BFE49529.1|CBM32|GH16_3 38 ASSTETGSPFTPANAVDGNPGTRWSSAfSdpQWLQVDLGWTKEVCGATLTWeaA---YATAFRLQTSTDGTTWTDVYSTTTGTGGT 120 334445566*****************85379********************744...5******************9887655455 PP CBM32.hmm 89 teti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + f+ t+r+vRl++t+rat +wg+s++E+a BFE49529.1|CBM32|GH16_3 121 --QNpAFT--GTGRFVRLYATARAT-QWGVSLWEFA 151 ..444888..568*******77766.8*******96 PP == domain 2 score: 85.5 bits; conditional E-value: 2.1e-28 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttva 79 tass + + + ++++a+D +p trW+++ + w+ vdLg+p +v+kvvl+w a+ +k +++e+S Dg++Wt ++ BFE49529.1|CBM32|GH16_3 171 TASSFQDDGA-CPACTPAKALDFNPATRWATSatTgwvdpGWIAVDLGAPARVSKVVLQWdpAY---AKGFRIETSPDGTNWTAIH 252 4555543333.34478***************5431457889*******************6555...******************9 PP CBM32.hmm 80 ekgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++++ t ++ti+++ t+r+vR+ t+r ++ +g+s++E++ BFE49529.1|CBM32|GH16_3 253 TTTTGTGF-KQTIPVS--GTGRHVRVALTAR-SGPYGYSLWEFQ 292 88764433.3588888..568*******554.557*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (563 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.64 // Query: XCX26352.1|CBM32|GH26 [L=450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-31 95.3 2.3 1.9e-31 95.3 2.3 1.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.1 0.29 0.29 72 83 .. 129 140 .. 89 156 .. 0.63 2 ! 95.3 2.3 1.9e-31 1.9e-31 8 122 .. 336 447 .. 330 449 .. 0.82 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.29 CBM32.hmm 72 gktWttvaekgn 83 + +W +++++g+ XCX26352.1|CBM32|GH26 129 DAQWSQLVTSGT 140 346777766544 PP == domain 2 score: 95.3 bits; conditional E-value: 1.9e-31 CBM32.hmm 8 essssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttd.gtte 90 +s++++a+ ++a+ a+Dg+p trWssa + ++l vdLg+++ v++v+l+w a ++++y+++vS+Dg+tWttv++ d gt + XCX26352.1|CBM32|GH26 336 SSATESAS-HPASHAFDGNPATRWSSAfTdqHSLWVDLGAVRPVRRVRLDWeA--AHARQYQLQVSDDGTTWTTVHADYA-ADgGT-D 418 34455666.9****************8536899******************63..57******************75432.24355.8 PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEl 122 +it++ ++aryv+l++ +rat +g+s++E+ XCX26352.1|CBM32|GH26 419 EITLN--TSARYVKLYAFQRAT-PYGYSLWEV 447 99**9..679*******66555.79*****97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (450 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.61 // Query: WXA97910.1|CBM32|GH3 [L=1027] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-57 178.3 14.3 4.1e-31 94.2 3.8 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.2 3.8 4.1e-31 4.1e-31 7 123 .. 55 168 .. 48 169 .. 0.81 2 ! 89.0 2.8 1.8e-29 1.8e-29 11 123 .. 190 300 .. 186 301 .. 0.84 Alignments for each domain: == domain 1 score: 94.2 bits; conditional E-value: 4.1e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 ++ss+++++ + a +a+Dg+++trWssa + qwl+vdLg+++++ +++l+w a +++ y++++S+Dg++W+t++++++ gt WXA97910.1|CBM32|GH3 55 TASSQENDA-FIAGAATDGNAGTRWSSAfSdpQWLQVDLGSNQSICGIQLNWeaA---YARAYQIQTSSDGSNWNTIYSTTTGAGGT-- 137 333444445.99***************85379********************744...5******************9876644355.. PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ t++ ++ryvR+++t+rat +g+s++ ++ WXA97910.1|CBM32|GH3 138 EVlTVS--GNGRYVRMYGTARAT-GYGYSLWDFQ 168 455777..458*******88776.699****986 PP == domain 2 score: 89.0 bits; conditional E-value: 1.8e-29 CBM32.hmm 11 ssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtteti.t 93 ss++gg+++ +a+Dg +ntrWss+ + qw++vdLg++ t+++v+l+w a +++ y++evS+D +tW++++++++ + g i + WXA97910.1|CBM32|GH3 190 SSWEGGNAPGAALDGRTNTRWSSQfSdpQWIYVDLGGNATITGVTLNWetA---YATGYRIEVSNDASTWNPIYTTTTGK-GG---IeN 271 5567779****************85379********************644...5******************9876633.33...447 PP CBM32.hmm 94 fdkpvtaryvRltvtkratnawgasiaEla 123 ++ t+ryvR+ +t+ra+ +g+s++E++ WXA97910.1|CBM32|GH3 272 LAVSGTGRYVRMLGTARAS-GYGYSLWEFE 300 7755789*******77765.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1027 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 152.97 // Query: BFE60663.1|CBM32 [L=518] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-31 93.8 4.9 1.4e-30 92.5 4.9 1.7 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.5 4.9 1.4e-30 1.4e-30 8 123 .. 42 156 .. 36 157 .. 0.82 Alignments for each domain: == domain 1 score: 92.5 bits; conditional E-value: 1.4e-30 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgttetitfdk 96 ++ss++++g +a++avDg+++trWssa qw++vdLg++ +v+++ +tw + ++k ++++ S+Dg+ +t+++++++ + g+ + ++++ BFE60663.1|CBM32 42 TASSQESAGTPAAAAVDGNTGTRWSSAFaagQWFQVDLGAAASVSRIDITWeN--AYAKAFTIQFSSDGSAYTQAYSTTTGPGGK-Q--SIAA 129 2344445559****************84468********************52..56******************9887654343.3..4455 PP CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEla 123 + taryvR++ t+ra a+g+s +E++ BFE60663.1|CBM32 130 AGTARYVRINLTTRALAAYGYSFWEFQ 156 5789*******9999668*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (518 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 129.30 // Query: XOU72070.1|CBM32|GH3 [L=1578] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-95 301.0 43.4 2.4e-28 85.3 1.9 5.2 6 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.5 1.7 8.5e-28 8.5e-28 11 122 .. 53 162 .. 48 164 .. 0.83 2 ! 74.9 5.3 4e-25 4e-25 14 122 .. 191 297 .. 182 299 .. 0.82 3 ! 81.9 2.5 2.7e-27 2.7e-27 11 122 .. 423 534 .. 416 536 .. 0.81 4 ? -3.8 0.1 0.94 0.94 17 47 .. 630 653 .. 619 665 .. 0.61 5 ? -2.4 0.2 0.33 0.33 31 54 .. 1339 1365 .. 1287 1396 .. 0.53 6 ! 85.3 1.9 2.4e-28 2.4e-28 13 123 .. 1431 1539 .. 1421 1540 .. 0.82 Alignments for each domain: == domain 1 score: 83.5 bits; conditional E-value: 8.5e-28 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitf 94 ss++ g + ++a+Dg+ +trW s++ qw++vdLg+p t+ +v++ w a + +dy+++ S+Dg++W tva+++n t gt ++t XOU72070.1|CBM32|GH3 53 SSTQVGLEVTAANDGNLGTRWGSDWedpQWIYVDLGQPSTIYEVEVVWegA---YGSDYDIQFSNDGSNWATVASVTNGTGGT--ERTA 136 3445558899*************86789********************644...5********************99866454..3444 PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEl 122 + +a+yvRl +r t wg+s++E+ XOU72070.1|CBM32|GH3 137 A-GGSAQYVRLHLLARGT-GWGYSLFEF 162 4.4679*******55444.5*******9 PP == domain 2 score: 74.9 bits; conditional E-value: 4e-25 CBM32.hmm 14 aggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd.gttetitfdk 96 +gg++a++a+Dg+++trW s+ w++vdL+++ +++++l w a + k+yk+++S+D ++Wt+++ + + d g+ + i ++ XOU72070.1|CBM32|GH3 191 EGGNTASAATDGNESTRWGSDFvddAWIYVDLEQVSVISSIELSWeaA---YGKEYKIQTSNDANNWTDIYYT-DSGDgGS-DIIAVN- 273 56799***************844689*******************744...5******************744.3334355.455988. PP CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEl 122 ++a++vR+++++r t wg+s++ + XOU72070.1|CBM32|GH3 274 -TSAQFVRMQGISRGT-GWGYSLWSF 297 .689*******87765.599***988 PP == domain 3 score: 81.9 bits; conditional E-value: 2.7e-27 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitf 94 s++ gg+ a++++Dgd+ trW+s+ qw+++dL++++t+++vvl+w a+ +y++++S+D ++W++v + + g++++i+f XOU72070.1|CBM32|GH3 423 STEVGGNYAQAVTDGDDETRWESEAadpQWIYIDLDAAQTFQRVVLNWevAY---GANYTIQISNDATNWQDVEIILGGN-GEEDNINF 507 33445588***************84579********************7666...9*****************6533322.434589** PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEl 122 ++pvtaryvR+ +++r t +g+s++ + XOU72070.1|CBM32|GH3 508 ANPVTARYVRMLGSARGT-GYGFSLWSF 534 *************55444.599999987 PP == domain 4 score: -3.8 bits; conditional E-value: 0.94 CBM32.hmm 17 ggaenavDgdpntrWssagqwltvdLgkptt 47 ++a n+ D W + w++v g+++t XOU72070.1|CBM32|GH3 630 FTAPNLSDR-----WTYK--WFVVAVGGAQT 653 444444443.....6554..67777776665 PP == domain 5 score: -2.4 bits; conditional E-value: 0.33 CBM32.hmm 31 Wssag...qwltvdLgkpttvdkvvlt 54 W+ + ++ +dL+ + +++++ XOU72070.1|CBM32|GH3 1339 WAGGKtrsPTFGFDLNDTSAPPAFNVY 1365 222112333455555555555555555 PP == domain 6 score: 85.3 bits; conditional E-value: 2.4e-28 CBM32.hmm 13 aaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd.gtteti. 92 +++ + ++a+Dgdp trW+s++ q ++vdLg+++ v++vvl+w a + + y++ +StDg++W++++ + n d g +ti XOU72070.1|CBM32|GH3 1431 SSA-SIVDAATDGDPATRWQSKYsdaQHIIVDLGETYLVNRVVLNWesA---YGRAYRLHASTDGENWQEIYYT-NSGDgG-IDTIn 1511 233.6799*************9668999******************644...5******************844.433434.47898 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +v aryv++++++ra+ a+g+s++E++ XOU72070.1|CBM32|GH3 1512 NLS-AV-ARYVKMEGIERAS-AYGYSLWEFE 1539 998.45.9*******88875.69******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1578 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 125.78 // Query: XCN12400.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-58 180.9 11.6 6.8e-32 96.8 2.7 2.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.8 2.7 6.8e-32 6.8e-32 7 123 .. 47 160 .. 41 161 .. 0.84 2 ! 88.2 2.0 3.1e-29 3.1e-29 4 123 .. 184 304 .. 180 305 .. 0.77 3 ? -3.7 0.0 0.86 0.86 83 105 .. 553 575 .. 547 576 .. 0.62 Alignments for each domain: == domain 1 score: 96.8 bits; conditional E-value: 6.8e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++a+ ++a avDgd++trWss+ + +w+ +dLg+ t++ +vvl+w a ++k y++evS +g++Wtt++e+++ + g XCN12400.1|CBM32|GH16_3 47 ATASSTEAP-FTAPSAVDGDTSTRWSSGfTddEWIRIDLGASTSIGQVVLDWeaA---YAKGYRLEVSGNGTDWTTIHETTTGSGG 128 455677788.*****************853699*******************744...5******************988764324 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ry+R+ +t+rat wg+s++E++ XCN12400.1|CBM32|GH16_3 129 V-ETLTVS--GTGRYIRMHGTERAT-PWGYSLHEFQ 160 3.455666..579*******88876.8*******96 PP == domain 2 score: 88.2 bits; conditional E-value: 3.1e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as++++ + + ++++a+D dp +rW+++ + w+ vdLg+ ++++vvl+w a+ ++ y++evS++g++Wtt++e XCN12400.1|CBM32|GH16_3 184 ASTSQHDGT-CWECSPDKAFDRDPASRWATSpeggWtdpGWIAVDLGARAEISRVVLQWdpAY---ARAYRIEVSDNGTDWTTIHE 265 334433333.44478***************5443326788*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + et +++ t+r+vRl++t r ++++g+s++E++ XCN12400.1|CBM32|GH16_3 266 TTTGTGFK-ETLDVS--GTGRHVRLYATRR-SGEYGYSLWEFQ 304 87644322.344555..679*******665.5579******96 PP == domain 3 score: -3.7 bits; conditional E-value: 0.86 CBM32.hmm 83 nttd.gtte.titfdkpvtaryvRl 105 +++ + + t++f+++ + y+++ XCN12400.1|CBM32|GH16_3 553 DWPGpP--DaTTRFPQKMSIDYIKV 575 444323..33678887788888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 66.71 // Query: WXA87398.1|CBM32|GH3 [L=1026] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-56 174.2 15.2 3.1e-30 91.4 5.4 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.4 5.4 3.1e-30 3.1e-30 8 123 .. 55 168 .. 48 169 .. 0.82 2 ! 87.8 2.2 4.1e-29 4.1e-29 11 123 .. 189 299 .. 185 300 .. 0.83 Alignments for each domain: == domain 1 score: 91.4 bits; conditional E-value: 3.1e-30 CBM32.hmm 8 essssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttet 91 +sss+++ +++a +a+Dg+++trWssa + qwl+vdL +++++ +++l+w a +++ y++++S+Dg +W+tv+++++ gt + WXA87398.1|CBM32|GH3 55 TSSSQENDTFSAGAATDGNAGTRWSSAfSdpQWLQVDLASNQSICGIQLNWeaA---YARAYQIQTSSDGVNWNTVYNTTTGAGGT--E 138 4455556669****************85379********************744...5******************9876644355..4 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 + t++ ++ryvR+++t+r t a+g+s++ ++ WXA87398.1|CBM32|GH3 139 VlTVS--GNGRYVRMYGTARGT-AYGYSLWDFQ 168 55777..458*******66654.79*****986 PP == domain 2 score: 87.8 bits; conditional E-value: 4.1e-29 CBM32.hmm 11 ssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitf 94 ss++gg+++ +a+Dg ++trWss+ + qw+ vdLg++ t+++v+l+w a +++ y++evS+D tW++++++++ + g ++ WXA87398.1|CBM32|GH3 189 SSWEGGNAPGAALDGRATTRWSSQfSdpQWISVDLGGNATITGVTLNWetA---YATGYRIEVSNDAVTWNPIHSTTTGK-GG--VENL 271 5567889*********9******85379********************644...5******************9876643.33..2366 PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 + t+ryvR+ +t+rat a+g+s++E++ WXA87398.1|CBM32|GH3 272 AVSGTGRYVRMLGTARAT-AYGYSLWEFE 299 644679*******77766.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1026 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 130.99 // Query: XQE78158.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-59 184.7 7.7 2.2e-32 98.3 1.5 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.3 1.5 2.2e-32 2.2e-32 7 123 .. 47 160 .. 41 161 .. 0.81 2 ! 88.8 0.5 2e-29 2e-29 4 123 .. 184 304 .. 180 305 .. 0.77 3 ? -2.8 0.0 0.46 0.46 83 105 .. 553 575 .. 548 576 .. 0.67 Alignments for each domain: == domain 1 score: 98.3 bits; conditional E-value: 2.2e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++++ ++a navDg+p trWss+ + qw+ +dLg+ t v +vvl+w a +++ y++e S +g++Wtt++++ + t g XQE78158.1|CBM32|GH16_3 47 ATASSAEGP-FTAPNAVDGNPATRWSSEfTddQWIRIDLGTSTAVGQVVLNWeaA---YARGYRIELSANGTNWTTIHSTITGTGG 128 333444455.*****************85369********************744...5******************975554323 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ry+Rl +t+rat wg+s++E++ XQE78158.1|CBM32|GH16_3 129 V-ETLTVS--GTGRYIRLLGTQRAT-PWGYSLHEFQ 160 3.455666..579*******88876.8*******96 PP == domain 2 score: 88.8 bits; conditional E-value: 2e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as+++ +++ + g+++a+D dp +rW+++ + w+ vdLg+p ++++vvl+w a+ ++ y++evS++g +W+t+++ XQE78158.1|CBM32|GH16_3 184 ASTSQ-HDGTCWECGPDKAFDRDPASRWATSpeggWtdpGWIAVDLGAPARINRVVLQWdpAY---ARAYRIEVSDNGADWRTIHQ 265 33343.344444488***************5443326788*******************6555...******************97 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + et +++ t+r+vRl++t+r+ +++g+s++E++ XQE78158.1|CBM32|GH16_3 266 TASGTGFK-ETLDVS--GTGRHVRLYATQRS-GQYGYSLWEFQ 304 76644322.344555..679*******7765.47*******96 PP == domain 3 score: -2.8 bits; conditional E-value: 0.46 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRl 105 +++ ++ +t++f+++ ++ y+++ XQE78158.1|CBM32|GH16_3 553 DWPGpPD-TTTRFPQKLSVDYIKV 575 5554343.3669998888999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.54 // Query: BGA86232.1|CBM32 [L=300] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-06 12.5 0.0 1.5e-05 11.7 0.0 1.4 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 11.7 0.0 1.5e-05 1.5e-05 97 123 .. 7 32 .. 1 33 [. 0.78 Alignments for each domain: == domain 1 score: 11.7 bits; conditional E-value: 1.5e-05 CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEla 123 ++ryvRl t rat +wg+s++E++ BGA86232.1|CBM32 7 SGNGRYVRLHTTRRAT-QWGVSLWEFQ 32 3568*******77766.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (300 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.12 // Query: USQ85518.1|CBM32|GH16_3 [L=574] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-56 175.5 14.4 6.5e-31 93.6 3.4 2.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.6 3.4 6.5e-31 6.5e-31 9 123 .. 43 155 .. 36 156 .. 0.83 2 ! 86.5 3.3 1e-28 1e-28 4 123 .. 181 301 .. 178 302 .. 0.80 Alignments for each domain: == domain 1 score: 93.6 bits; conditional E-value: 6.5e-31 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 +ss++g ++a avDgd++trWssa qw+++dLg++ +v++v l+w a + k +++evS+D + Wt+v+e+++ t g USQ85518.1|CBM32|GH16_3 43 VASSTEGVFSAGSAVDGDAGTRWSSAFadpQWIQIDLGTTAEVSRVALNWeaA---YGKAFRIEVSNDAQRWTVVHETATGT-GG- 123 34556777*****************84469********************744...5******************9876643.33. PP CBM32.hmm 90 eti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ + t+ryvR+++t+rat ++g+s++E++ USQ85518.1|CBM32|GH16_3 124 --VqSLAVAGTGRYVRMYGTQRAT-SYGYSLWEFQ 155 ..3366656789*******99886.799*****96 PP == domain 2 score: 86.5 bits; conditional E-value: 1e-28 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass++s ++ ++ ++++a+D dp +rW+++ + w+ vdLg++ ++kvvl+w a+ +k+++++vS +g +Wt++++ USQ85518.1|CBM32|GH16_3 181 ASSSQSDQNCWE-CTPARAFDRDPASRWATSatTgwtdpGWIAVDLGATAHINKVVLQWdpAY---AKSFQIQVSPNGADWTPIYS 262 556654555445.89***************5431346889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + +t t++ ++ryvR+++t+rat +g+s++E++ USQ85518.1|CBM32|GH16_3 263 TTTGTGFK-QTLTVS--GNGRYVRMYGTERAT-PYGYSLWEFQ 301 87644332.456776..568*******88876.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (574 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 69.56 // Query: XAN41278.1|CBM32|GH16_3 [L=710] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-85 269.2 25.5 6e-32 96.9 4.7 3.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.9 4.7 6e-32 6e-32 4 123 .. 55 167 .. 51 168 .. 0.81 2 ! 96.3 1.6 9.4e-32 9.4e-32 7 123 .. 190 303 .. 184 304 .. 0.81 3 ! 86.7 3.9 8.6e-29 8.6e-29 2 123 .. 329 451 .. 328 452 .. 0.79 Alignments for each domain: == domain 1 score: 96.9 bits; conditional E-value: 6e-32 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnt 84 a ss+++a+ ++a++avDgd +trWssa qwl vdLg++ tv++vvl w a +++ y+v+vS Dg tWtt+ ++++ XAN41278.1|CBM32|GH16_3 55 A----SSTQSAA-FPASAAVDGDSGTRWSSAAadpQWLSVDLGAAATVSQVVLSWeaA---YATAYQVQVSADGATWTTLRAVTGG 132 2....2334555.*****************84579********************744...5******************888763 PP CBM32.hmm 85 tdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + g t++ + t+ryvR+t t+r t a+g+s++E++ XAN41278.1|CBM32|GH16_3 133 D-GG--VDTLAVAGTGRYVRVTTTARGT-AYGVSLWEFQ 167 3.33..2366655789*******66654.7*******96 PP == domain 2 score: 96.3 bits; conditional E-value: 9.4e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd. 86 ++ss+++a+ +a++avDg+p+trWssa qwl vdLg ++ v +v ltw a +++ y+v+ StDg tWttv+++++ t XAN41278.1|CBM32|GH16_3 190 TASSTENAA-LPASAAVDGNPGTRWSSAAadpQWLRVDLGVERAVCRVDLTWeaA---YATAYQVQLSTDGATWTTVYATTTGTGg 271 223334555.9****************84579********************744...5******************888765554 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 g+ + t++ ++ry+R+ +t+rat a+g+s++Ela XAN41278.1|CBM32|GH16_3 272 GQ--QLTVT--GSGRYLRVLGTARAT-AYGYSLWELA 303 54..55555..458*******77766.79******86 PP == domain 3 score: 86.7 bits; conditional E-value: 8.6e-29 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttv 78 atass++ + ++ ++++a+D dp +rW+++ + w+ vdLg++ tv++vvl+w a+ ++ y++++StD +tWtt+ XAN41278.1|CBM32|GH16_3 329 ATASSYQDDGACWQ-CSPARAFDLDPASRWATSptTgwvdpGWISVDLGATATVHRVVLQWdpAY---ATAYQIQTSTDATTWTTI 410 57778875665555.89***************5441457888*******************6555...****************** PP CBM32.hmm 79 aekgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + +++ + g ++ t++ t+ryvR+++t+r +n +g+s++E++ XAN41278.1|CBM32|GH16_3 411 YRTTTNP-GFRQDLTVS--GTGRYVRMYGTAR-SNGYGYSLWEFQ 451 9665432.322355665..568*******665.55799*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (710 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.47 // Query: XRK08075.1|CBM32|GH16_3 [L=455] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-33 102.6 9.6 2e-33 101.7 8.1 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.8 0.0 0.11 0.11 64 78 .. 260 275 .. 231 326 .. 0.71 2 ! 101.7 8.1 2e-33 2e-33 7 123 .. 338 451 .. 331 452 .. 0.81 Alignments for each domain: == domain 1 score: -0.8 bits; conditional E-value: 0.11 CBM32.hmm 64 ykvevS.tDgktWttv 78 +++ +S D tWt++ XRK08075.1|CBM32|GH16_3 260 FTLPASrVDAATWTKA 275 3333333344444444 PP == domain 2 score: 101.7 bits; conditional E-value: 2e-33 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd. 86 ++ss+++ag ga+na+Dg+++trWssa + qw+ vdLg+ +++++v+ltw a + k y++++S+Dg+tWt ++++++ d XRK08075.1|CBM32|GH16_3 338 TASSTENAG-TGAANATDGNAGTRWSSAfSdpQWVRVDLGRSYNINHVNLTWeaA---YGKAYQIQTSQDGNTWTNIYSTTTG-Dg 418 333444555.99***************85379********************744...5******************987654.32 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 gt ++ ++ t+ry+R+++t+rat ++g+s++E+a XRK08075.1|CBM32|GH16_3 419 GT-DDLAVT--GTGRYIRMYGTQRAT-QYGYSLWEFA 451 44.444555..679*******99887.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (455 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 60.77 // Query: XRK10313.1|CBM32 [L=478] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-32 96.7 2.8 1.2e-31 95.9 2.8 1.3 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 95.9 2.8 1.2e-31 1.2e-31 6 123 .. 52 167 .. 47 168 .. 0.83 Alignments for each domain: == domain 1 score: 95.9 bits; conditional E-value: 1.2e-31 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetit 93 +a++sss+ g+ ++++avDg+++trWss+ + qwl+vdLg++ t++k+vl+w a+ ++ ++++vS+ g +W+t+ +++ dg +t + XRK10313.1|CBM32 52 TATASSSERGDLSPSAAVDGKAGTRWSSKfSdpQWLQVDLGATSTISKIVLNWehAY---ATAFTIQVSNGGGQWKTIRSTTAGVDGV-QTLN 140 4556677788899***************85379********************7445...******************8776533344.3556 PP CBM32.hmm 94 fdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvRl++tkr++ ++g+s++E++ XRK10313.1|CBM32 141 VS--GSGRYVRLYATKRSS-QYGVSLWEFQ 167 66..578*******88875.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (478 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 93.23 // Query: XCX22552.1|CBM32|GH3 [L=1023] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-53 166.9 19.5 9.7e-30 89.8 5.4 3.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.8 5.4 9.7e-30 9.7e-30 7 123 .. 48 161 .. 43 162 .. 0.83 2 ! 85.9 1.5 1.5e-28 1.5e-28 9 123 .. 183 295 .. 176 296 .. 0.82 3 ? -1.2 0.2 0.14 0.14 75 111 .. 401 442 .. 358 455 .. 0.61 Alignments for each domain: == domain 1 score: 89.8 bits; conditional E-value: 9.7e-30 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 ++ss+++ag +a++a+Dg+++trWssa qwl vdLg++ +d+vvl w a ++ +++++S Dg tWttv++++n t gt + XCX22552.1|CBM32|GH3 48 TASSTENAG-TAASAATDGNTGTRWSSAFadpQWLSVDLGATAALDRVVLSWeaAF---ATAFQLQTSADGVTWTTVHTTANGTGGT-Q 131 333444555.99***************84469********************7445...*******************988865454.6 PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEla 123 +i ++ ++r+vR+ +t+rat +g+s++E++ XCX22552.1|CBM32|GH3 132 DIAVT--GSGRHVRVLGTARAT-GYGYSLWEFQ 161 77877..568*******88776.699*****96 PP == domain 2 score: 85.9 bits; conditional E-value: 1.5e-28 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtteti 92 ++s+++gg+++++a+Dg +ntrWss+ qwl vd+g++ tv++vvl+w a ++ y++e S+D +Wt ++++++ + g XCX22552.1|CBM32|GH3 183 AASTWEGGNAPAAALDGRANTRWSSQFadnQWLRVDFGGVATVNQVVLNWegA---FARGYRLELSNDAVNWTAIHSTTTGP-GG--VE 265 356778889****************83468********************644...5******************9887644.33..22 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t+ry+Rl +t+rat +g+s++E++ XCX22552.1|CBM32|GH3 266 RLNVGGTGRYLRLFATTRAT-GYGVSLWEFQ 295 45533679*******77776.699*****96 PP == domain 3 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 75 Wttvaekg.nttd.gt..t.e.ti.tfdkpvtaryvRltvtkra 111 W +va g + t+ ++ t ++ t++ + a vR+++ +r XCX22552.1|CBM32|GH3 401 WFVVAVDGsGGTSaSNirTfSlYVpTLT--TVADGVRIVNGSRD 442 5555332213222122221112443443..23788888775544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1023 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 113.72 // Query: XPR74008.1|CBM32|GH16_3 [L=561] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-54 168.6 15.0 2.8e-30 91.6 6.0 3.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.6 6.0 2.8e-30 2.8e-30 9 123 .. 44 156 .. 39 157 .. 0.83 2 ! 81.5 0.8 3.7e-27 3.7e-27 4 123 .. 180 300 .. 174 301 .. 0.79 3 ? -1.2 0.0 0.14 0.14 43 78 .. 336 390 .. 315 419 .. 0.46 Alignments for each domain: == domain 1 score: 91.6 bits; conditional E-value: 2.8e-30 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 +ss++ ++++ +navDgdp+trWss+ qw+ vdLg+++ +d+vvl+w a +++ ++vevS+Dg +W t++++++ t g+ XPR74008.1|CBM32|GH16_3 44 TSSNEFAWSTGANAVDGDPGTRWSSSAadnQWIRVDLGSVQAIDHVVLDWetA---YASGFRVEVSNDGGSWSTLYSTTTGTGGD- 125 34445556899**************84469********************644...5******************9887654343. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 ++d + ++ry+Rl vt+rat +wg+s++El+ XPR74008.1|CBM32|GH16_3 126 --QNLDVDGSGRYLRLWVTQRAT-QWGVSLWELQ 156 ..355544679*******99887.8*******86 PP == domain 2 score: 81.5 bits; conditional E-value: 3.7e-27 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass+++ + + g+++a+D dp +rW+ + + w+ vdLg++ ++++vvl+w a ++ +++evS++g+tW+tv++ XPR74008.1|CBM32|GH16_3 180 ASSSQNDGTCWL-CGPDKAFDLDPASRWAVNpdTgwvddGWIAVDLGAAARISSVVLQWdpAF---ATVFDIEVSDNGSTWRTVHT 261 333333333333.56**************95441347788*******************6555...******************99 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkra.tnawgasiaEla 123 +++ t ++ti++d +t+r+vR+ + r ++ +g+s++E++ XPR74008.1|CBM32|GH16_3 262 TTGGTGF-KQTIPLD--TTGRHVRVHM--RDrSGPYGYSLWEFQ 300 8865433.3699**9..679*******..665668*******96 PP == domain 3 score: -1.2 bits; conditional E-value: 0.14 CBM32.hmm 43 gkpttvdkvvltw....ae...ngrik............dykvevSt...DgktWttv 78 g+p + +++++++ ++ + ++ +e+ Dg ++t XPR74008.1|CBM32|GH16_3 336 GTPANASRWTIDPglpaNNeleV---YtpsgngfhdgqgNFVLEARRedrDGRQYTSH 390 55555566666643332111110...01112222222224444444222234555433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (561 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 61.38 // Query: WBB71408.1|CBM32|GH3 [L=1029] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-54 167.8 13.0 1.2e-30 92.7 3.1 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.6 2.4 1.4e-26 1.4e-26 7 123 .. 53 167 .. 48 168 .. 0.79 2 ! 92.7 3.1 1.2e-30 1.2e-30 9 123 .. 190 303 .. 184 304 .. 0.81 Alignments for each domain: == domain 1 score: 79.6 bits; conditional E-value: 1.4e-26 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevS.tDgktWttvaekgnttdgtt 89 + +ss++++ +a++a+Dgd++trWssa qwl++dLg++ tvd+v+l w a +++ ++++v Wt v++++ gt WBB71408.1|CBM32|GH3 53 T-ASSTEGAATPAAAATDGDAGTRWSSAFadpQWLQIDLGATATVDQVQLVWeaA---YATAFQIQVApAPSGPWTSVYSTTAGAGGT- 136 2.3444455589***************84469********************744...5*********655669****9887543244. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 +t ++ ++ryvR+++t+rat +g+s++E++ WBB71408.1|CBM32|GH3 137 QTLAVT--GSGRYVRMYGTGRAT-GYGYSLWEFK 167 344555..678*******88877.699*****96 PP == domain 2 score: 92.7 bits; conditional E-value: 1.2e-30 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttet 91 ++ss++gg+++++a+Dg +trWss+ g qwl vd+g++ t+++vvl w a +++ y++e+StDg+tWtt++++++ gt e+ WBB71408.1|CBM32|GH3 190 AASSWEGGNAPAAALDGRSTTRWSSQfGsdpQWLRVDFGGVATINRVVLAWeaA---YATGYRLETSTDGSTWTTIYATTTGRGGT-EQ 274 345667779********999*****752579********************744...5******************8776533244.45 PP CBM32.hmm 92 itfdkpvtaryvRltvtkratnawgasiaEla 123 t++ t+ry+Rl++ +rat +g+s++El+ WBB71408.1|CBM32|GH3 275 LTVS--GTGRYLRLYGAARAT-GYGYSLWELQ 303 5666..568*******55555.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1029 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 131.82 // Query: ASS68012.1|CBM32|CBM4|CBM54|GH16_3 [L=1790] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-23 69.7 0.5 7.9e-23 67.5 0.1 2.4 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.4 0.0 0.33 0.33 17 34 .. 742 762 .. 734 782 .. 0.72 2 ! 67.5 0.1 7.9e-23 7.9e-23 8 123 .. 1666 1783 .. 1660 1784 .. 0.79 Alignments for each domain: == domain 1 score: -2.4 bits; conditional E-value: 0.33 CBM32.hmm 17 ggaenavDgd...pntrWssa 34 g++ + vDg+ +++rW s+ ASS68012.1|CBM32|CBM4|CBM54|GH16_3 742 GEIRWYVDGKvyqTQSRWDSQ 762 667888999853344799985 PP == domain 2 score: 67.5 bits; conditional E-value: 7.9e-23 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevSt..... 70 ++s+s+a ++a+navDgd +trW++++ qw+ vdLg+ +++d+ vl+w a +k+yk+++S+ ASS68012.1|CBM32|CBM4|CBM54|GH16_3 1666 TASASTAK-QAAANAVDGDSGTRWETESadpQWIAVDLGGLYRLDEAVLHWegA---FAKSYKLQISSaespg 1734 33444555.89***************85679********************644...5*********989998 PP CBM32.hmm 71 DgktWttvaekgnttdgttetitfdkpvtaryvRltvtkra.tnawgasiaEla 123 Dg +W +++ + g e+i ++ v+ar++R+ + +++g+s++El+ ASS68012.1|CBM32|CBM4|CBM54|GH16_3 1735 DG-DWSDAYVQPAG-GGGIERIALS-GVQARHIRVLG--LLrGTQYGYSLWELE 1783 88.*****754332.1223677888.689********..443447*******85 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1790 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 194.73 // Query: XHM90257.1|CBM32|GH16_3 [L=720] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-89 281.9 41.1 9.8e-35 105.9 5.7 4.5 5 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 102.7 8.2 1e-33 1e-33 5 123 .. 49 165 .. 43 166 .. 0.84 2 ! 105.9 5.7 9.8e-35 9.8e-35 5 123 .. 186 302 .. 182 303 .. 0.84 3 ! 89.2 4.2 1.5e-29 1.5e-29 2 122 .. 341 462 .. 340 464 .. 0.80 4 ? 0.2 0.1 0.053 0.053 59 107 .. 511 573 .. 497 599 .. 0.55 5 ? -1.9 0.0 0.23 0.23 68 82 .. 657 671 .. 628 718 .. 0.59 Alignments for each domain: == domain 1 score: 102.7 bits; conditional E-value: 1e-33 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgntt 85 +sa++ss+++ g +a+ avDgd +trWssa qwl+vdLg++ ++++v+l w a + k y++++StDg tWttv+++++ t XHM90257.1|CBM32|GH16_3 49 KSATASSTENVGTPASSAVDGDGGTRWSSAAadpQWLQVDLGATADISQVKLVWetA---YGKAYQIQTSTDGATWTTVYSTTTGT 131 56667777777799***************84579********************644...5******************9887654 PP CBM32.hmm 86 dgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 gt et +++ ++ryvR+++t+rat ++g+s++E++ XHM90257.1|CBM32|GH16_3 132 GGT-ETLNVT--GSGRYVRMYGTQRAT-QYGYSLWEFQ 165 344.455665..678*******99887.79******96 PP == domain 2 score: 105.9 bits; conditional E-value: 9.8e-35 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgntt 85 ++a++ss++++g +a+ avDgd +trWssa qwl+vdLg+++t+ +v+l w a ++k y++++StDg tWttv+++++ + XHM90257.1|CBM32|GH16_3 186 KTATASSTENAGTPASSAVDGDGGTRWSSAAadpQWLQVDLGSTQTICGVQLAWetA---YAKAYQIQTSTDGATWTTVYSTTTGP 268 4445555566669****************84579********************644...5******************9887654 PP CBM32.hmm 86 dgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 g te it++ ++ry+R+++t+rat ++g+s++E++ XHM90257.1|CBM32|GH16_3 269 -GATELITLS--GSGRYIRVYGTQRAT-QYGYSLWEFQ 302 .444688**9..568*******99887.79******96 PP == domain 3 score: 89.2 bits; conditional E-value: 1.5e-29 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttv 78 atas+++ ++ +g ++++a+D+dp trW+++ + w+ vdLg++ v+kvvl+w a+ ++ y+++vS Dg+tWt++ XHM90257.1|CBM32|GH16_3 341 ATASTYQDDANCSG-CNPAKAFDEDPATRWATSdvNgwvdpGWIRVDLGATAHVTKVVLQWdpAY---ATAYQIQVSPDGNTWTDI 422 56677765555555.89***************6441347888*******************6555...****************** PP CBM32.hmm 79 aekgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEl 122 +++++ + +et ++d t+ryvR+++t+r +n +g+s++ + XHM90257.1|CBM32|GH16_3 423 YSTTTGKGF-KETLNVD--GTGRYVRMYGTAR-SNGYGYSLWTF 462 988764333.3566887..579*******665.55799***988 PP == domain 4 score: 0.2 bits; conditional E-value: 0.053 CBM32.hmm 59 grikdykvevStDgktWttva........ekgnttdgt............t..etitfd.kpvtaryvRltv 107 g+ ++ ++e+ t+g + tt + + + + ++f+ v+ +++t+ XHM90257.1|CBM32|GH16_3 511 GNGQNGELETYTNGDN-TTMDgngnlvieA-------RkeangqytsgriNtsDHFNFTyGHVE-ARIKVTG 573 7788888888888866.7776233332221.......133322232333312123355543332.3455555 PP == domain 5 score: -1.9 bits; conditional E-value: 0.23 CBM32.hmm 68 vStDgktWttvaekg 82 Dg+ + tv+ + XHM90257.1|CBM32|GH16_3 657 FTVDGNAFFTVDRAN 671 234666677666443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (720 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.02 // Query: WGO98097.1|CBM32|GH3 [L=1578] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-95 301.0 43.4 2.4e-28 85.3 1.9 5.2 6 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.5 1.7 8.5e-28 8.5e-28 11 122 .. 53 162 .. 48 164 .. 0.83 2 ! 74.9 5.3 4e-25 4e-25 14 122 .. 191 297 .. 182 299 .. 0.82 3 ! 81.9 2.5 2.7e-27 2.7e-27 11 122 .. 423 534 .. 416 536 .. 0.81 4 ? -3.8 0.1 0.94 0.94 17 47 .. 630 653 .. 619 665 .. 0.61 5 ? -2.4 0.2 0.33 0.33 31 54 .. 1339 1365 .. 1287 1396 .. 0.53 6 ! 85.3 1.9 2.4e-28 2.4e-28 13 123 .. 1431 1539 .. 1421 1540 .. 0.82 Alignments for each domain: == domain 1 score: 83.5 bits; conditional E-value: 8.5e-28 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitf 94 ss++ g + ++a+Dg+ +trW s++ qw++vdLg+p t+ +v++ w a + +dy+++ S+Dg++W tva+++n t gt ++t WGO98097.1|CBM32|GH3 53 SSTQVGLEVTAANDGNLGTRWGSDWedpQWIYVDLGQPSTIYEVEVVWegA---YGSDYDIQFSNDGSNWATVASVTNGTGGT--ERTA 136 3445558899*************86789********************644...5********************99866454..3444 PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEl 122 + +a+yvRl +r t wg+s++E+ WGO98097.1|CBM32|GH3 137 A-GGSAQYVRLHLLARGT-GWGYSLFEF 162 4.4679*******55444.5*******9 PP == domain 2 score: 74.9 bits; conditional E-value: 4e-25 CBM32.hmm 14 aggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd.gttetitfdk 96 +gg++a++a+Dg+++trW s+ w++vdL+++ +++++l w a + k+yk+++S+D ++Wt+++ + + d g+ + i ++ WGO98097.1|CBM32|GH3 191 EGGNTASAATDGNESTRWGSDFvddAWIYVDLEQVSVISSIELSWeaA---YGKEYKIQTSNDANNWTDIYYT-DSGDgGS-DIIAVN- 273 56799***************844689*******************744...5******************744.3334355.455988. PP CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEl 122 ++a++vR+++++r t wg+s++ + WGO98097.1|CBM32|GH3 274 -TSAQFVRMQGISRGT-GWGYSLWSF 297 .689*******87765.599***988 PP == domain 3 score: 81.9 bits; conditional E-value: 2.7e-27 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitf 94 s++ gg+ a++++Dgd+ trW+s+ qw+++dL++++t+++vvl+w a+ +y++++S+D ++W++v + + g++++i+f WGO98097.1|CBM32|GH3 423 STEVGGNYAQAVTDGDDETRWESEAadpQWIYIDLDAAQTFQRVVLNWevAY---GANYTIQISNDATNWQDVEIILGGN-GEEDNINF 507 33445588***************84579********************7666...9*****************6533322.434589** PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEl 122 ++pvtaryvR+ +++r t +g+s++ + WGO98097.1|CBM32|GH3 508 ANPVTARYVRMLGSARGT-GYGFSLWSF 534 *************55444.599999987 PP == domain 4 score: -3.8 bits; conditional E-value: 0.94 CBM32.hmm 17 ggaenavDgdpntrWssagqwltvdLgkptt 47 ++a n+ D W + w++v g+++t WGO98097.1|CBM32|GH3 630 FTAPNLSDR-----WTYK--WFVVAVGGAQT 653 444444443.....6554..67777776665 PP == domain 5 score: -2.4 bits; conditional E-value: 0.33 CBM32.hmm 31 Wssag...qwltvdLgkpttvdkvvlt 54 W+ + ++ +dL+ + +++++ WGO98097.1|CBM32|GH3 1339 WAGGKtrsPTFGFDLNDTSAPPAFNVY 1365 222112333455555555555555555 PP == domain 6 score: 85.3 bits; conditional E-value: 2.4e-28 CBM32.hmm 13 aaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd.gtteti. 92 +++ + ++a+Dgdp trW+s++ q ++vdLg+++ v++vvl+w a + + y++ +StDg++W++++ + n d g +ti WGO98097.1|CBM32|GH3 1431 SSA-SIVDAATDGDPATRWQSKYsdaQHIIVDLGETYLVNRVVLNWesA---YGRAYRLHASTDGENWQEIYYT-NSGDgG-IDTIn 1511 233.6799*************9668999******************644...5******************844.433434.47898 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 +++ +v aryv++++++ra+ a+g+s++E++ WGO98097.1|CBM32|GH3 1512 NLS-AV-ARYVKMEGIERAS-AYGYSLWEFE 1539 998.45.9*******88875.69******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1578 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 111.20 // Query: WIX91949.1|CBM32|GH16_3 [L=568] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-59 184.9 14.3 8.4e-33 99.7 3.1 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 99.7 3.1 8.4e-33 8.4e-33 4 123 .. 42 154 .. 37 155 .. 0.83 2 ! 92.2 1.0 1.8e-30 1.8e-30 4 122 .. 177 296 .. 174 298 .. 0.77 3 ? -2.2 0.1 0.28 0.28 68 82 .. 505 519 .. 491 533 .. 0.74 Alignments for each domain: == domain 1 score: 99.7 bits; conditional E-value: 8.4e-33 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnt 84 a ss+++a+ ++a++avDgdp+trWss+ + q+l+vdLg+++++++vvl w a ++k ++v++S Dg tWt ++++++ WIX91949.1|CBM32|GH16_3 42 A----SSTESAA-FPASAAVDGDPGTRWSSGfSdpQYLQVDLGSTQQLSQVVLSWeaA---YAKAFTVQASADGATWTSLYSTTTA 119 2....3334555.*****************8536999******************744...5******************988765 PP CBM32.hmm 85 tdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t g+ +t +++ ++ryvRlt+t+rat ++g+s++E++ WIX91949.1|CBM32|GH16_3 120 TGGS-QTLNVT--GSGRYVRLTGTQRAT-QYGYSLWEFQ 154 5454.455666..568*******99887.79******96 PP == domain 2 score: 92.2 bits; conditional E-value: 1.8e-30 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass++ a +g +++a+D dp trW+++ + wltvdLg+p +++vvl+w a+ + y+++vS+D+ +Wtt+++ WIX91949.1|CBM32|GH16_3 177 ASSSQDDG-ACPGCLPAKAFDHDPATRWATSatTgwvdpGWLTVDLGAPAAIHQVVLQWdpAY---AVAYQIQVSNDNANWTTLYS 258 44444333.333366***************5431457889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEl 122 +++ + + et t++ ++ryvR+++t+r +n +g+s++ + WIX91949.1|CBM32|GH16_3 259 TTTGKGFK-ETLTVN--GSGRYVRMYGTAR-SNGYGYSLWGF 296 87643333.455666..568*******665.55799**9977 PP == domain 3 score: -2.2 bits; conditional E-value: 0.28 CBM32.hmm 68 vStDgktWttvaekg 82 S Dg+ ++t+ + WIX91949.1|CBM32|GH16_3 505 FSVDGTAFETINRDT 519 588999999995433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (568 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 65.21 // Query: WXB12212.1|CBM32|GH3 [L=1063] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-53 165.1 19.9 5.6e-31 93.8 4.6 2.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.8 4.6 5.6e-31 5.6e-31 7 123 .. 74 188 .. 68 189 .. 0.82 2 ! 81.9 1.7 2.6e-27 2.6e-27 12 123 .. 226 335 .. 221 336 .. 0.82 3 ? -3.6 0.4 0.79 0.79 75 93 .. 416 432 .. 392 460 .. 0.49 Alignments for each domain: == domain 1 score: 93.8 bits; conditional E-value: 5.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 ++sss+++g+ +a++a+Dg+p trWssa + qwl+vdLg+++ + +++l w a ++ y++++S+Dg +W+t+ +++ gt WXB12212.1|CBM32|GH3 74 TTSSSAENGSWPASAATDGNPATRWSSAfSdpQWLQVDLGSTQAICAIQLSWetAF---ATAYQIQTSSDGIDWNTLSSTSAGAGGT-- 157 345556667799***************85379********************6445...******************8665433255.. PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ t++ ++ryvR+++t+r+t +wg+s++E++ WXB12212.1|CBM32|GH3 158 EVlTVN--GSGRYVRMYGTARST-QWGYSLWEFQ 188 454777..568*******77766.8*******96 PP == domain 2 score: 81.9 bits; conditional E-value: 2.6e-27 CBM32.hmm 12 saaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtteti.tf 94 s +gg+++++a+Dg ++trWss++ qw++vdLg++ ++kvvl+w a +++ y + vS+D tW+t++++++ + g i t+ WXB12212.1|CBM32|GH3 226 SFEGGNAPAAALDGRTSTRWSSQSsdpQWIYVDLGGTAAIRKVVLNWetA---YATGYHIDVSDDAVTWNTIYSTTTGK-GG---IeTL 307 3346699***************85589********************644...5******************9876633.33...3355 PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 + + ++r+vR+ +t+rat +g+s++El+ WXB12212.1|CBM32|GH3 308 AVQGKGRFVRMFGTARAT-GYGYSLWELE 335 544789*******88776.699*****85 PP == domain 3 score: -3.6 bits; conditional E-value: 0.79 CBM32.hmm 75 Wttvaekgnttd.gttetit 93 +t+vae ++tt +t + WXB12212.1|CBM32|GH3 416 YTKVAEPTGTTYtPT---WD 432 555555443332222...22 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1063 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 125.62 // Query: UTR80155.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-60 188.8 11.0 2.9e-33 101.2 1.9 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 101.2 1.9 2.9e-33 2.9e-33 7 123 .. 47 160 .. 41 161 .. 0.83 2 ! 91.5 1.9 2.8e-30 2.8e-30 4 123 .. 184 304 .. 181 305 .. 0.80 3 ? -2.8 0.0 0.46 0.46 83 105 .. 553 575 .. 548 576 .. 0.67 Alignments for each domain: == domain 1 score: 101.2 bits; conditional E-value: 2.9e-33 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++++ ++a navDgdp+trWssa + qw+ +dLg+ t v +vvl+w a ++k y++e S Dg++Wtt++++++ t g UTR80155.1|CBM32|GH16_3 47 ATASSAEGP-FTAPNAVDGDPGTRWSSAfSddQWIRIDLGTSTAVGQVVLNWeaA---YAKGYRIELSADGQQWTTIHSTTTGTGG 128 333444455.*****************85369********************744...5******************988765434 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t et t++ t+r++Rl++t+rat wg+s++E++ UTR80155.1|CBM32|GH16_3 129 T-ETLTVS--GTGRHIRLVGTERAT-PWGYSLYEFQ 160 4.455666..579*******88876.8*******96 PP == domain 2 score: 91.5 bits; conditional E-value: 2.8e-30 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekg 82 as++++ s+ ++ ++++a+D dp +rW+++ + w+ vdLg+p t+++vvl+w+ +++ y++evS++g++W+t++ ++ UTR80155.1|CBM32|GH16_3 184 ASTSQHDSTCWQ-CTPDKAFDRDPASRWATSpeggWtdpGWIAVDLGAPATINRVVLQWDP-AHARAYRIEVSDNGTDWRTIHRTT 267 455555566555.89***************5443326788*******************54.56******************9776 PP CBM32.hmm 83 nttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + t +et +++ t+r+vRl++t+r+ +++g+s++E++ UTR80155.1|CBM32|GH16_3 268 TGTGF-KETLNVS--GTGRHVRLYATQRS-GEYGYSLWEFQ 304 64433.2456776..679*******7765.479******96 PP == domain 3 score: -2.8 bits; conditional E-value: 0.46 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRl 105 +++ ++ +t++f+++ ++ y+++ UTR80155.1|CBM32|GH16_3 553 DWPGpPD-TTTRFPQKLSVDYIKV 575 5554343.3669998888999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.54 // Query: XAO67688.1|CBM32|GH141 [L=839] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-50 156.3 18.2 5.7e-27 80.9 6.3 3.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.8 3.9 1.2e-26 1.2e-26 6 122 .. 582 701 .. 578 703 .. 0.78 2 ! 80.9 6.3 5.7e-27 5.7e-27 6 122 .. 716 834 .. 712 836 .. 0.78 Alignments for each domain: == domain 1 score: 79.8 bits; conditional E-value: 1.2e-26 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltwae.n.grikdykvevStDgktWttvaekg.nt 84 +a++ss ++++++a++avDgd +trW+ a+ wl+vdLg+++++++++ a+ g+ +yk+e StDg+tW + a+ + ++ XAO67688.1|CBM32|GH141 582 AATASSMYSSTYDASKAVDGDSTTRWAQASgaadpSWLQVDLGATYSITRINTA-AYmMsGHGMKYKIESSTDGTTWADYATHTaQY 667 45567777888*****************74456799******************.5553499******************9887343 PP CBM32.hmm 85 tdgttetitfdkpvtaryvRltvtkratnawgasiaEl 122 t + e+ + +v aryvR+t+++ t++ g si+ + XAO67688.1|CBM32|GH141 668 TAPA-EDMPA-GQVLARYVRITFID--TQHQGGSIYQF 701 3233.23333.45779*******66..44567888877 PP == domain 2 score: 80.9 bits; conditional E-value: 5.7e-27 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltwaen.grikdykvevStDgktWttvae.kgntt 85 +a++ss ++++++a++avDgd++trW+ a+ wl+vdLg++++v++++ +++ +yk+e+StD+++Wt +a+ +g+ t XAO67688.1|CBM32|GH141 716 TATASSIYSSTYDASKAVDGDTTTRWAQASgaadpSWLEVDLGANHSVTSITTLA--YlTNPVRYKIEYSTDNSSWTSFADhQGTDT 800 445566667779****************74456799***************9993..2378******************87354443 PP CBM32.hmm 86 d.gttetitfdkpvtaryvRltvtkratnawgasiaEl 122 + gt + vtary+R+t t+ t + g si+E+ XAO67688.1|CBM32|GH141 801 TpGT--DAAPGGSVTARYLRITLTN--THSQGGSIYEF 834 3344..344446799********55..555789****9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (839 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 115.17 // Query: WBQ03081.1|CBM32|GH16_3 [L=586] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-56 176.4 24.9 9.1e-33 99.6 10.1 2.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 99.6 10.1 9.1e-33 9.1e-33 6 123 .. 54 169 .. 49 170 .. 0.84 2 ! 85.8 2.5 1.7e-28 1.7e-28 4 123 .. 193 313 .. 189 314 .. 0.79 3 ? -2.1 0.1 0.27 0.27 68 95 .. 505 534 .. 496 542 .. 0.57 Alignments for each domain: == domain 1 score: 99.6 bits; conditional E-value: 9.1e-33 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 +a++ss++++ ++a+ avDgd++trWssa+ qw++vdLg++ tv++v+l+w a +k ++++vS Dg++W+ ++++++ t WBQ03081.1|CBM32|GH16_3 54 TATASSAENTVFTAASAVDGDAGTRWSSAHadpQWIQVDLGQTATVNQVQLNWetA---AAKAFQIQVSADGTNWNSIYTTTTSTG 136 55666777788*****************85579********************643...5******************98876655 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 g+ +t t++ ++ryvR+ +t+r+t +wg+s++E++ WBQ03081.1|CBM32|GH16_3 137 GN-QTLTVS--GSGRYVRMLGTQRTT-QWGYSLWEFK 169 43.466777..568*******77655.8*******96 PP == domain 2 score: 85.8 bits; conditional E-value: 1.7e-28 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag.......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass+++ ++ ++ ++++a+D dp +rW++++ w+ vdLg++ ++dkv l+w a+ +k+y+++vS D+ +Wt++++ WBQ03081.1|CBM32|GH16_3 193 ASSQQHDNNCWE-CTPARAFDLDPASRWATTTdsgwvdpGWISVDLGATAQIDKVILQWdpAS---AKSYQIQVSGDNVNWTPIYT 274 455555555455.89***************6334457889*******************6545...******************99 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++ + + et +++ ++ryvR+++t+r+t +g+s++E++ WBQ03081.1|CBM32|GH16_3 275 STAGPGFK-ETLNVT--GSGRYVRMYGTQRNT-PYGYSLWEFQ 313 87644332.455666..578*******77654.6*******96 PP == domain 3 score: -2.1 bits; conditional E-value: 0.27 CBM32.hmm 68 vStDgktWttv.aekg.nttdgt..teti.tfd 95 +S+D +tW + ++kg +t +t+ t+d WBQ03081.1|CBM32|GH16_3 505 YSDDFHTWAAAwDSKGiV---YTldGRTVfTLD 534 678888887773334322...222112444555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (586 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.11 // Query: XTC01442.1|CBM32|GH16_3 [L=710] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-86 270.7 34.1 1.1e-33 102.5 3.3 3.9 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.2 6.9 2.5e-32 2.5e-32 8 123 .. 58 170 .. 52 171 .. 0.81 2 ! 102.5 3.3 1.1e-33 1.1e-33 8 123 .. 194 307 .. 187 308 .. 0.83 3 ! 84.1 5.0 5.8e-28 5.8e-28 2 122 .. 331 452 .. 330 454 .. 0.81 4 ? -3.1 0.0 0.54 0.54 63 76 .. 505 517 .. 494 570 .. 0.54 Alignments for each domain: == domain 1 score: 98.2 bits; conditional E-value: 2.5e-32 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 +ss+++ag +a++avDg+++trWssa qwl vdLg++ t++kvvl+w a + + y++++S Dg++Wttv+++++ gt XTC01442.1|CBM32|GH16_3 58 ASSTENAG-TPASAAVDGNAGTRWSSAAadpQWLRVDLGATATISKVVLNWetA---YGSAYQIQTSPDGTDWTTVYTTTTGAGGT 139 23334555.9****************84579********************644...5******************9876644344 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEla 123 et +++ ++ryvR+++t r+t ++g+s++E++ XTC01442.1|CBM32|GH16_3 140 -ETLNVT--GSGRYVRINGTVRHT-QYGYSLWEFQ 170 .455665..678*******77665.89******96 PP == domain 2 score: 102.5 bits; conditional E-value: 1.1e-33 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgt 88 ++ss++++g +a++avDg+++trWssa qwl+vdLg+ +++ +v+l w a +++ y++++S Dg +Wtt++++++ + g XTC01442.1|CBM32|GH16_3 194 TASSTENAGTPATAAVDGNAGTRWSSAAadpQWLQVDLGTGQSICGVQLSWetA---YARAYQIQTSADGINWTTIHSTTTGP-GA 275 3344444559****************84579********************644...5******************9887654.44 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEla 123 te it++ t+ry+R+++t+rat a+g+s++E++ XTC01442.1|CBM32|GH16_3 276 TELITLS--GTGRYIRVYGTQRAT-AYGYSLWEFQ 307 4688**9..568*******99876.79******96 PP == domain 3 score: 84.1 bits; conditional E-value: 5.8e-28 CBM32.hmm 2 atassaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttv 78 atas++++++s +g ++++a+D+dp trW+++ + w+ vdLg++ v+kvvl+w a+ ++ y+++vS Dg++W + XTC01442.1|CBM32|GH16_3 331 ATASTYQNANSCTG-CTPAKALDEDPATRWATSdtNgwvdpGWIAVDLGATAHVTKVVLQWdpAY---ATAYQIQVSPDGTNWASI 412 57788876666666.99***************6431457889*******************6555...****************** PP CBM32.hmm 79 aekgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEl 122 +++++ + +et t+d ++ryvR+++t+r++ ++g+s++ + XTC01442.1|CBM32|GH16_3 413 YSTTTGKGF-KETLTVD--GNGRYVRMYGTARSS-SYGYSLWTF 452 987764333.3566887..568*******77664.699***988 PP == domain 4 score: -3.1 bits; conditional E-value: 0.54 CBM32.hmm 63 dykvevStDgktWt 76 + ++e+ t+g + t XTC01442.1|CBM32|GH16_3 505 NGELEYYTNGDN-T 517 444444444433.2 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (710 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.33 // Query: WIY74451.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-58 180.3 9.8 1.1e-31 96.1 2.3 2.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.1 2.3 1.1e-31 1.1e-31 7 123 .. 47 160 .. 41 161 .. 0.82 2 ! 87.3 1.1 5.9e-29 5.9e-29 4 123 .. 184 304 .. 180 305 .. 0.77 3 ? -2.1 0.0 0.28 0.28 83 106 .. 553 576 .. 546 577 .] 0.68 Alignments for each domain: == domain 1 score: 96.1 bits; conditional E-value: 1.1e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++++ +ga++avDgd+ trWssa g +wl +dLg+ t++ +vvl+w a ++k y++evS Dg+ Wtt++++++ g WIY74451.1|CBM32|GH16_3 47 ATASSTEGP-FGAAAAVDGDTATRWSSAfGddEWLRIDLGASTSIGRVVLDWeaA---YAKGYRLEVSGDGQWWTTIHSTTTGAGG 128 344455555.*****************853699*******************744...5******************987664323 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ry+R+ +t+rat awg+s++E++ WIY74451.1|CBM32|GH16_3 129 V-ETLTVS--GTGRYIRMHGTERAT-AWGYSLHEFQ 160 3.455666..579*******88876.7*******96 PP == domain 2 score: 87.3 bits; conditional E-value: 5.9e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekg 82 as++++ + + ++++a+D dp +rW+++ + w+ vdLg+ ++++vvl+w+ +++ y++evS++g++Wtt++e++ WIY74451.1|CBM32|GH16_3 184 ASTSQHDGT-CWECSPDKAFDRDPASRWATSpeggWtdpGWIAVDLGARAEINRVVLQWDP-AHARAYRIEVSDNGTDWTTIHETA 267 334443333.44478***************5443326788*******************54.56******************9876 PP CBM32.hmm 83 nttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + + et +++ t+r+vRl++t+r+ +++g+s++E++ WIY74451.1|CBM32|GH16_3 268 SGAGFK-ETLDVS--GTGRHVRLYATQRS-GEYGYSLWEFQ 304 643222.344555..679*******7765.479******96 PP == domain 3 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 83 nttd.gtte.titfdkpvtaryvRlt 106 +++ + + t++f+++ ++ y+++ WIY74451.1|CBM32|GH16_3 553 DWPGpP--DaTTRFPQKMSVDYIKVW 576 554333..337799988999999985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.12 // Query: BGA17258.1|CBM12|CBM32|GH16_3 [L=500] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-29 88.8 4.6 5e-29 87.5 4.6 1.7 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.5 4.6 5e-29 5e-29 8 123 .. 322 435 .. 316 436 .. 0.83 Alignments for each domain: == domain 1 score: 87.5 bits; conditional E-value: 5e-29 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekg 82 ++ss ++g+++a++avDg+++trWssa+ +w +vdLg+ + +++v+++w a+ + y+++ S++g+tW++++++ BGA17258.1|CBM12|CBM32|GH16_3 322 SASSVESGNQAAAFAVDGSTSTRWSSAHsepHWWQVDLGSSRALSRVRINWeaAY---GRAYSIQLSDNGSTWREAYSTF 398 45677788899***************85579********************7445...******************8653 PP CBM32.hmm 83 nttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + + g e+i ++ taryvR+++t+rat +g+s +E++ BGA17258.1|CBM12|CBM32|GH16_3 399 TGS-GGVEDIGVS--GTARYVRFNGTQRAT-VYGFSFWEFQ 435 422.333578887..579*******99875.4999****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (500 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.90 // Query: XMN10835.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-59 183.8 7.3 2.5e-32 98.2 1.4 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.2 1.4 2.5e-32 2.5e-32 7 123 .. 47 160 .. 41 161 .. 0.82 2 ! 88.0 0.4 3.6e-29 3.6e-29 4 123 .. 184 304 .. 180 305 .. 0.77 3 ? -2.7 0.0 0.42 0.42 83 105 .. 553 575 .. 547 576 .. 0.67 Alignments for each domain: == domain 1 score: 98.2 bits; conditional E-value: 2.5e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd. 86 a++ss++++ ++a n+vDg+p trWss+ + qw+ +dLg+ t v +vvl+w a +++ y++e S Dg++Wtt++++++ t XMN10835.1|CBM32|GH16_3 47 ATASSAEGP-FTAPNVVDGNPATRWSSEfTddQWIRIDLGTSTAVGQVVLNWeaA---YARGYRIELSADGQQWTTIHSTTTGTGg 128 333444455.*****************85369********************744...5******************988765532 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ry+Rl +t+rat wg+s++E++ XMN10835.1|CBM32|GH16_3 129 F--ETLTVS--GTGRYIRLLGTQRAT-PWGYSLHEFQ 160 3..355666..578*******88876.8*******96 PP == domain 2 score: 88.0 bits; conditional E-value: 3.6e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as+++ +++ + g+++a+D dp +rW+++ + w+ vdLg+p ++++vvl+w a+ ++ y++evS++g +W+t+++ XMN10835.1|CBM32|GH16_3 184 ASTSQ-HDGTCWECGPDKAFDRDPASRWATSpeggWtdpGWIAVDLGAPARINRVVLQWdpAY---ARAYRIEVSDNGADWRTIHQ 265 33343.344444488***************5443326788*******************6555...******************97 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ + et +++ t+r+vRl+vt+r+ +++g+s++E++ XMN10835.1|CBM32|GH16_3 266 TASGAGFK-ETLDVS--GTGRHVRLYVTQRS-GEYGYSLWEFQ 304 66543222.344555..679*******7765.479******96 PP == domain 3 score: -2.7 bits; conditional E-value: 0.42 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRl 105 +++ ++ +t++f+++ ++ y+++ XMN10835.1|CBM32|GH16_3 553 DWPGpPD-TTTRFPQKLSVDYIKV 575 5554333.3669998888999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 77.58 // Query: WVK87602.1|CBM32|GH16_3 [L=717] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-86 271.3 35.4 7e-33 99.9 7.2 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 95.6 8.1 1.6e-31 1.6e-31 7 123 .. 54 167 .. 48 168 .. 0.81 2 ! 99.9 7.2 7e-33 7e-33 6 123 .. 189 305 .. 183 306 .. 0.83 3 ! 87.2 4.2 6.1e-29 6.1e-29 13 123 .. 350 462 .. 339 463 .. 0.78 Alignments for each domain: == domain 1 score: 95.6 bits; conditional E-value: 1.6e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++ss+++a+ +a+ a+Dg+++trWssa + qw++vdLg+++ +++v l+w a +++ +++++S+Dg++Wt ++++++ g WVK87602.1|CBM32|GH16_3 54 TASSAENAA-TPAASATDGNTGTRWSSAfTvpQWIQVDLGSAQAISRVGLNWeaA---YATAFQIQTSNDGTNWTNIYTTTTGAGG 135 333444555.89***************85479********************744...5******************988765543 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + ++ t++ ++ryvRl++t++at ++g+s++E++ WVK87602.1|CBM32|GH16_3 136 N-QSLTVS--GNGRYVRLNATAKAT-QYGVSLWEFQ 167 3.455776..468*******66554.8*******96 PP == domain 2 score: 99.9 bits; conditional E-value: 7e-33 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 +a++ss++++g +a+ avD++ +trWssa qwl+vdLg+ + v +v+l+w a +++ ++++vS +g+tWt+v+++++ t WVK87602.1|CBM32|GH16_3 189 TATASSTENAGTPASSAVDNNLGTRWSSAAsdpQWLQVDLGSSQLVCGVTLNWeaA---YATAFQIQVSANGTTWTQVYSTTTGTG 271 444555556669****************84479********************744...5******************98876554 PP CBM32.hmm 87 gtteti.tfdkpvtaryvRltvtkratnawgasiaEla 123 gt ++ t++ p+ +ryvR+++t+rat +wg+s++E+a WVK87602.1|CBM32|GH16_3 272 GT--QVlTVT-PTAGRYVRMNGTARAT-QWGYSLWEFA 305 55..444776.6667*******77766.8*******96 PP == domain 3 score: 87.2 bits; conditional E-value: 6.1e-29 CBM32.hmm 13 aaggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 + + ++++a+D+dp +rW+++ + w++vdLg++ ++++vvl+w a+ + +y++++S+D ++Wt+++++++ + WVK87602.1|CBM32|GH16_3 350 NCNPCSPDKAFDNDPASRWATSsTngwvdpGWIYVDLGAVAQIKQVVLQWdpAY---AVSYQIQTSNDATNWTPIYTTTTGKGF-R 431 334467***************6413457889*******************6555...******************987764322.2 PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ ++ryvR+++t+r++ +g+s++E++ WVK87602.1|CBM32|GH16_3 432 ETLTVN--GSGRYVRMYGTQRSN-GYGYSLWEFK 462 355666..578*******77754.799*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (717 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.32 // Query: WFE35134.1|CBM32|GH3 [L=1050] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-54 169.2 13.1 4.2e-31 94.2 3.5 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.5 2.2 1.5e-26 1.5e-26 7 123 .. 74 188 .. 69 189 .. 0.79 2 ! 94.2 3.5 4.2e-31 4.2e-31 9 123 .. 211 324 .. 205 325 .. 0.82 Alignments for each domain: == domain 1 score: 79.5 bits; conditional E-value: 1.5e-26 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevS.tDgktWttvaekgnttdgtt 89 + +ss++++ +a++a+Dgd++trWssa qwl++dLg++ tvd+v+l w a +++ ++++v Wt v++++ gt WFE35134.1|CBM32|GH3 74 T-ASSTEGAATPAAAATDGDAGTRWSSAFadpQWLQIDLGATATVDQVQLVWeaA---YATAFQIQVApAPSGPWTSVYSTTAGAGGT- 157 2.3444455589***************84469********************744...5*********655669****9887543244. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 +t ++ ++ryvR+++t+rat +g+s++E+ WFE35134.1|CBM32|GH3 158 QTLAVT--GSGRYVRMYGTGRAT-GYGYSLWEFR 188 344555..678*******88877.699*****96 PP == domain 2 score: 94.2 bits; conditional E-value: 4.2e-31 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttet 91 ++ss++gg+++++a+Dg +trWss+ g qwl vd+g++ t+++vvl w a +++ y++e+StDg+tWtt++++++ gt e+ WFE35134.1|CBM32|GH3 211 AASSWEGGNAPAAALDGRSTTRWSSQfGsdpQWLRVDFGGVATINRVVLAWeaA---YATGYRLETSTDGSTWTTIYATTTGRGGT-EQ 295 345667779********999*****752579********************744...5******************8776533244.45 PP CBM32.hmm 92 itfdkpvtaryvRltvtkratnawgasiaEla 123 t++ t+ry+Rl++t+rat +g+s++El+ WFE35134.1|CBM32|GH3 296 LTVS--GTGRYLRLYGTARAT-GYGYSLWELQ 324 5666..568*******88776.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1050 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 128.87 // Query: WXB08352.1|CBM32|GH3 [L=1026] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-56 174.2 15.2 3.1e-30 91.4 5.4 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.4 5.4 3.1e-30 3.1e-30 8 123 .. 55 168 .. 48 169 .. 0.82 2 ! 87.8 2.2 4.1e-29 4.1e-29 11 123 .. 189 299 .. 185 300 .. 0.83 Alignments for each domain: == domain 1 score: 91.4 bits; conditional E-value: 3.1e-30 CBM32.hmm 8 essssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttet 91 +sss+++ +++a +a+Dg+++trWssa + qwl+vdL +++++ +++l+w a +++ y++++S+Dg +W+tv+++++ gt + WXB08352.1|CBM32|GH3 55 TSSSQENDTFSAGAATDGNAGTRWSSAfSdpQWLQVDLASNQSICGIQLNWeaA---YARAYQIQTSSDGVNWNTVYNTTTGAGGT--E 138 4455556669****************85379********************744...5******************9876644355..4 PP CBM32.hmm 92 i.tfdkpvtaryvRltvtkratnawgasiaEla 123 + t++ ++ryvR+++t+r t a+g+s++ ++ WXB08352.1|CBM32|GH3 139 VlTVS--GNGRYVRMYGTARGT-AYGYSLWDFQ 168 55777..458*******66654.79*****986 PP == domain 2 score: 87.8 bits; conditional E-value: 4.1e-29 CBM32.hmm 11 ssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitf 94 ss++gg+++ +a+Dg ++trWss+ + qw+ vdLg++ t+++v+l+w a +++ y++evS+D tW++++++++ + g ++ WXB08352.1|CBM32|GH3 189 SSWEGGNAPGAALDGRATTRWSSQfSdpQWISVDLGGNATITGVTLNWetA---YATGYRIEVSNDAVTWNPIHSTTTGK-GG--VENL 271 5567889*********9******85379********************644...5******************9876643.33..2366 PP CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 + t+ryvR+ +t+rat a+g+s++E++ WXB08352.1|CBM32|GH3 272 AVSGTGRYVRMLGTARAT-AYGYSLWEFE 299 644679*******77766.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1026 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 158.47 // Query: XTZ60278.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-60 188.9 11.4 2.5e-33 101.4 2.0 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 101.4 2.0 2.5e-33 2.5e-33 9 123 .. 49 160 .. 42 161 .. 0.83 2 ! 91.5 2.2 2.8e-30 2.8e-30 4 123 .. 184 304 .. 181 305 .. 0.80 3 ? -2.8 0.0 0.46 0.46 83 105 .. 553 575 .. 548 576 .. 0.67 Alignments for each domain: == domain 1 score: 101.4 bits; conditional E-value: 2.5e-33 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 +ss++++ ++a navDgdp+trWssa + qw+ +dLg++t v ++vl+w a ++k y++e S Dg++Wttv+++++ t gt XTZ60278.1|CBM32|GH16_3 49 ASSAEGP-FTAPNAVDGDPGTRWSSAfSddQWIRIDLGTNTAVGQIVLNWeaA---YAKGYRIELSADGQQWTTVHSTTTGTGGT- 129 3444455.*****************85369********************744...5******************9887654344. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+r++Rl++t+rat wg+s++E++ XTZ60278.1|CBM32|GH16_3 130 ETLTVS--GTGRHIRLVGTERAT-PWGYSLYEFQ 160 455666..579*******88876.8*******96 PP == domain 2 score: 91.5 bits; conditional E-value: 2.8e-30 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekg 82 as++++ s+ ++ ++++a+D dp +rW+++ + w+ vdLg+p t+++vvl+w+ +++ y++evS++g++W+t+++++ XTZ60278.1|CBM32|GH16_3 184 ASTSQHDSTCWQ-CTPDKAFDRDPASRWATSpeggWtdpGWIAVDLGAPATINRVVLQWDP-AHARAYRIEVSDNGTDWRTIHQTT 267 455555566555.89***************5443326788*******************54.56******************9876 PP CBM32.hmm 83 nttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + t +et +++ t+r+vRl++t+r+ +++g+s++E++ XTZ60278.1|CBM32|GH16_3 268 TGTGF-KETLNVS--GTGRHVRLYATQRS-GEYGYSLWEFQ 304 64433.2456776..679*******7765.479******96 PP == domain 3 score: -2.8 bits; conditional E-value: 0.46 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRl 105 +++ ++ +t++f+++ ++ y+++ XTZ60278.1|CBM32|GH16_3 553 DWPGpPD-TTTRFPQKLSVDYIKV 575 5554343.3669998888999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.73 // Query: UPZ26592.1|CBM32|GH16_3 [L=572] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-57 178.3 19.1 4e-33 100.7 4.2 2.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.7 4.2 4e-33 4e-33 6 123 .. 41 155 .. 36 156 .. 0.82 2 ! 87.0 2.5 6.9e-29 6.9e-29 4 123 .. 179 299 .. 177 300 .. 0.80 3 ? -3.7 0.1 0.87 0.87 66 74 .. 507 515 .. 492 529 .. 0.55 Alignments for each domain: == domain 1 score: 100.7 bits; conditional E-value: 4e-33 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 +a ++ss++g+++a avDgdp+trWssa qw+++dLg+p ++++vvl+w a + + +++evS+D ++Wttv+++++ t UPZ26592.1|CBM32|GH16_3 41 TA-TASSTEGDFNARSAVDGDPGTRWSSAFadpQWIQIDLGTPAEISRVVLNWeaA---YGTAFRIEVSSDAQSWTTVHQTATGTG 122 33.45666788*****************84469********************744...5******************97666443 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 gt ++ t++ t+ryvR+++t+rat a+g+s++E++ UPZ26592.1|CBM32|GH16_3 123 GT-QNLTVS--GTGRYVRMYGTQRAT-AYGYSLWEFQ 155 44.333544..679*******99876.79******96 PP == domain 2 score: 87.0 bits; conditional E-value: 6.9e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass++s + ++ ++++a+D dp +rW+++ + w+ +dLg++ ++dkvvl+w a+ +k+++++vS +g++Wt++++ UPZ26592.1|CBM32|GH16_3 179 ASSSQSDGNCWE-CTPARAFDRDPASRWATSstTgwtdpGWISIDLGATAQIDKVVLQWdpAY---AKSFQIQVSPNGTDWTPIYS 260 455554555455.89***************5331456889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + +t t++ ++ryvR+++t+rat +g+s++E++ UPZ26592.1|CBM32|GH16_3 261 TTSGTGFK-QTLTVS--GSGRYVRMYGTERAT-PYGYSLWEFQ 299 87644332.456766..568*******88876.79******96 PP == domain 3 score: -3.7 bits; conditional E-value: 0.87 CBM32.hmm 66 vevStDgkt 74 + +S Dg t UPZ26592.1|CBM32|GH16_3 507 ITYSLDGRT 515 334555544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (572 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.69 // Query: XBV87549.1|CBM32 [L=144] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-33 100.9 1.9 4.6e-33 100.5 1.9 1.1 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.5 1.9 4.6e-33 4.6e-33 8 123 .. 26 139 .. 20 140 .. 0.82 Alignments for each domain: == domain 1 score: 100.5 bits; conditional E-value: 4.6e-33 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetitfd 95 ++ss++++g +a +a+Dg+++trW+sa+ qwl+vdLg +++ +v+l+w a + k +++e+S+D +tWt+++++++ t gt +t +++ XBV87549.1|CBM32 26 SASSTENSGTPAGAAFDGNTGTRWASAWsdpQWLQVDLGVSRKICRVTLQWeaA---YGKAFRLEASDDMNTWTPLYSTTTGTGGT-QTLNVS 114 33455566699***************8778*********************744...5******************9887654344.455776 PP CBM32.hmm 96 kpvtaryvRltvtkratnawgasiaEla 123 t+ryvR+t+t+r t +g+s++E++ XBV87549.1|CBM32 115 --GTGRYVRMTGTTRGT-GYGYSLFEVQ 139 ..679*******76655.599****986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (144 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 34.11 // Query: UII19961.1|CBM32|GH3 [L=1366] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-60 187.9 21.3 7.4e-27 80.5 0.4 4.6 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.4 1.9 6.1e-21 6.1e-21 8 122 .. 31 150 .. 25 152 .. 0.78 2 ! 57.4 0.7 1e-19 1e-19 10 123 .. 177 292 .. 170 293 .. 0.81 3 ? -0.4 0.4 0.08 0.08 48 83 .. 320 377 .. 314 397 .. 0.47 4 ! 80.5 0.4 7.4e-27 7.4e-27 4 123 .. 416 533 .. 412 534 .. 0.76 Alignments for each domain: == domain 1 score: 61.4 bits; conditional E-value: 6.1e-21 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevSt.....DgktWttvaekgnttd 86 + ss++++ + a+ avDg+++trW+sa+ w+ +dL++ ++++v l+w a + +y + +S+ D +tWt++a++++ UII19961.1|CBM32|GH3 31 T-SSTTQEPFVATSAVDGNATTRWASAYespSWIKIDLQESFNINRVLLNWerA---SAESYYILTSNsnsnpDPSTWTVLAQRTGMA- 114 3.4455666*****************856799*******************544...5*********9666666679****9988754. PP CBM32.hmm 87 gttetitfd.kpvtaryvRltvtkra.tnawgasiaEl 122 +t++t +++ + +ry+ +++ + wg+s +E+ UII19961.1|CBM32|GH3 115 DTERTDNLTgLAGAGRYIAVYG--YNkLHPWGYSFFEI 150 332355888644557*******..44333699*99998 PP == domain 2 score: 57.4 bits; conditional E-value: 1e-19 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStD.gktWttvaekgnttdgtteti 92 +ss +g ++a+ a+Dg+++trWss+ + qw+ vdLg+++++ +v+l w a g ++++ + StD g+ + +a+++n + gt +++ UII19961.1|CBM32|GH3 177 ASSMEGAFTASSAFDGSAQTRWSSEfSdnQWIRVDLGQARNICQVELVWeaAF-GSAYNILLGNSTDiGSA-QNIASVSNGDGGT-DQV 262 3344566*****************85369********************7444.889999999****7766.9999987754354.788 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 + ++ +++ry+ +++ +r t +g+s++E+ UII19961.1|CBM32|GH3 263 NTNSSISGRYLWMQGVSRGT-GYGYSLWEMR 292 8888899********55544.599*****85 PP == domain 3 score: -0.4 bits; conditional E-value: 0.08 CBM32.hmm 48 vdkvvltw....aengrik...................dykvevStDgktWttvaekgn 83 v +v+l+w + n ++ ++++++ + g+++t +++ ++ UII19961.1|CBM32|GH3 320 VYAVTLNWsaatD-NVGVSsytiyegsslkatvdgssnSMTISGLNPGTQYTYLVKAKD 377 5566666653221.112221112222222222222222666667777777877764433 PP == domain 4 score: 80.5 bits; conditional E-value: 7.4e-27 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd. 86 ass+ ++++ +g++ avDg++++rW+s+ + +w+ +dLg+ +++ +v l+w a +k+y+v+vS+D+ +W+ ++e n++ UII19961.1|CBM32|GH3 416 ASST----KEGSVNGPSQAVDGNIGSRWESEfTddEWIRIDLGQKYQIGRVILHWeaA---SAKHYQVQVSDDDASWQNLYEF-NENGl 496 3333....4556699***************853699*******************743...5******************964.33232 PP CBM32.hmm 87 gt.tetitfdkpvtaryvRltvtkratnawgasiaEla 123 + +t ++ +ry+R+++++r++ +w++s++E++ UII19961.1|CBM32|GH3 497 PVeSRTDDLLVSGAGRYIRMKGIERNS-QWSYSLFEFE 533 333123333333447*******77654.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1366 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 149.19 // Query: UIZ11152.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-58 181.6 11.4 1.4e-31 95.7 2.4 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 95.7 2.4 1.4e-31 1.4e-31 7 123 .. 47 160 .. 41 161 .. 0.83 2 ! 89.7 2.1 1e-29 1e-29 4 123 .. 184 304 .. 180 305 .. 0.78 3 ? -3.7 0.0 0.86 0.86 83 105 .. 553 575 .. 547 576 .. 0.62 Alignments for each domain: == domain 1 score: 95.7 bits; conditional E-value: 1.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++++ ++a avDgd++trWss+ + +w+ +dLg+ t++ +vvl w a ++k y++evS +g++Wtt++++++ + g UIZ11152.1|CBM32|GH16_3 47 ATASSTEEP-FTAPSAVDGDTSTRWSSGfTddEWIRIDLGASTSIGQVVLAWeaA---YAKGYRLEVSGNGSDWTTIHSTTTGSGG 128 445566677.*****************853699*******************744...5******************987664324 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 et t++ t+ry+R+ +t+rat wg+s++E++ UIZ11152.1|CBM32|GH16_3 129 V-ETLTVS--GTGRYIRMHGTERAT-PWGYSLHEFQ 160 3.455666..579*******88876.8*******96 PP == domain 2 score: 89.7 bits; conditional E-value: 1e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as++++ + +g ++++a+D dp +rW+++ + w+ vdLg+ ++d+vvl+w a+ ++ y++evS++g++Wtt+++ UIZ11152.1|CBM32|GH16_3 184 ASTSQHDGTCWG-CSPDKAFDRDPASRWATSpeggWtdpGWIAVDLGARAEIDRVVLQWdpAY---ARAYRIEVSDNGTDWTTIHS 265 344444444444.88***************5443326788*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + et +++ t+r+vRl++t+r+ +++g+s++E++ UIZ11152.1|CBM32|GH16_3 266 TTTGTGFK-ETLDVS--GTGRHVRLYATQRS-GEYGYSLWEFQ 304 87644322.344555..679*******7765.479******96 PP == domain 3 score: -3.7 bits; conditional E-value: 0.86 CBM32.hmm 83 nttd.gtte.titfdkpvtaryvRl 105 +++ + + t++f+++ + y+++ UIZ11152.1|CBM32|GH16_3 553 DWPGpP--DaTTRFPQKMSIDYIKV 575 444323..33678887788888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 91.11 // Query: WEH26045.1|CBM32|GH16_3 [L=584] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-58 182.9 14.5 5.8e-33 100.2 5.0 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.2 5.0 5.8e-33 5.8e-33 7 123 .. 52 165 .. 46 166 .. 0.83 2 ! 87.4 1.9 5.4e-29 5.4e-29 4 123 .. 191 311 .. 187 312 .. 0.78 Alignments for each domain: == domain 1 score: 100.2 bits; conditional E-value: 5.8e-33 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd. 86 a++ss++++ ++a+ avDgd++trWss+ + qwl+vdLg+ t + +vvl w a ++k y+++vS +g++Wtt+ +++n t WEH26045.1|CBM32|GH16_3 52 ATASSQEGP-FTAASAVDGDNGTRWSSEfSdnQWLQVDLGSSTAIGQVVLRWeaA---YAKGYQIQVSANGQQWTTIRTTTNGTGg 133 444555555.*****************85369********************744...5******************988876653 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + et +++ t+ryvR+ +t+rat ++g+s++E++ WEH26045.1|CBM32|GH16_3 134 N--ETLDVS--GTGRYVRVLGTQRAT-QYGYSLWEFQ 165 3..345555..679*******99887.79******96 PP == domain 2 score: 87.4 bits; conditional E-value: 5.4e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as++++ + + ++++a+D dp +rW+++ + w+ vdLg++ +++vvl+w a+ +k+y++ vS++g++W+tv++ WEH26045.1|CBM32|GH16_3 191 ASTSQNDGTCWL-CTPDKAFDRDPASRWATSpeggWtdpGWIAVDLGANAAIHRVVLQWdpAY---AKSYRIDVSDNGTDWRTVYQ 272 344443333333.67***************5443326788*******************6555...******************97 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ + + e i++d +t+r+vR+++t+r+ +++g+s++E++ WEH26045.1|CBM32|GH16_3 273 TTTGKGFK-EIIPLD--TTGRHVRVYGTQRS-GEYGYSLWEFQ 311 76543333.456**9..679*******7765.479******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (584 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.68 // Query: XVT93188.1|CBM32|GH3 [L=1025] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-54 169.6 19.0 6.6e-30 90.3 3.3 2.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.1 2.3 1.6e-29 1.6e-29 8 123 .. 50 164 .. 45 165 .. 0.83 2 ! 90.3 3.3 6.6e-30 6.6e-30 9 123 .. 187 299 .. 181 300 .. 0.81 3 ? -2.6 0.3 0.4 0.4 52 52 .. 402 402 .. 340 434 .. 0.56 Alignments for each domain: == domain 1 score: 89.1 bits; conditional E-value: 1.6e-29 CBM32.hmm 8 essssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStD.gktWttvaekgnttdgtte 90 ++ss ++g +a++a+Dgdp+trWss+ + qwl+vdLg++ tvd+++l w a +++ ++++v tD W+t++++++ t gt + XVT93188.1|CBM32|GH3 50 TASSVEQGATPAAAATDGDPGTRWSSSfSdpQWLQVDLGGTATVDQIELVWeaA---YARAFQLQVATDpAGPWQTIHSTTTGTGGT-Q 134 4677889999****************85379********************744...5***********5348****9887654344.4 PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEla 123 t ++ t+ryvR+++t+rat +g+s++E++ XVT93188.1|CBM32|GH3 135 TLAVS--GTGRYVRVYGTARAT-GYGYSLWEFK 164 55665..679*******88776.699*****96 PP == domain 2 score: 90.3 bits; conditional E-value: 6.6e-30 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtteti 92 ++ss++gg+++++a+Dg ++trWss+ + qwl vd+g++ t++++vl+w a +++ y++e+S Dg+tW t++++++ g e+ XVT93188.1|CBM32|GH3 187 AASSWEGGNAPAAALDGRTTTRWSSQfSdpQWLSVDFGGVATISRIVLNWeaA---YATGYRLETSADGNTWATIYSTTTGR-GGVEQL 271 345667779*********9******85379********************744...5******************9876532.332344 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ry+Rl++t+rat +g+s++E++ XVT93188.1|CBM32|GH3 272 AVT--GSGRYLRLYGTARAT-GYGYSLWEFQ 299 444..678*******88776.699*****96 PP == domain 3 score: -2.6 bits; conditional E-value: 0.4 CBM32.hmm 52 v 52 + XVT93188.1|CBM32|GH3 402 T 402 1 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1025 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 120.47 // Query: UQA32527.1|CBM32|GH16_3 [L=577] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-60 189.4 10.9 2.2e-33 101.6 1.6 2.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 101.6 1.6 2.2e-33 2.2e-33 7 123 .. 47 160 .. 41 161 .. 0.83 2 ! 91.5 2.2 2.8e-30 2.8e-30 4 123 .. 184 304 .. 181 305 .. 0.80 3 ? -2.8 0.0 0.46 0.46 83 105 .. 553 575 .. 548 576 .. 0.67 Alignments for each domain: == domain 1 score: 101.6 bits; conditional E-value: 2.2e-33 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++++ ++a navDgdp+trWssa + qw+ +dLg+ t v +vvl+w a ++k y++e S Dg++Wtt++++++ t g UQA32527.1|CBM32|GH16_3 47 ATASSAEGP-FTAPNAVDGDPGTRWSSAfSdgQWIRIDLGTSTAVGQVVLNWeaA---YAKGYRIELSADGQQWTTIHSTTTGTGG 128 333444455.*****************85369********************744...5******************988765434 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t et t++ t+r++Rl++t+rat wg+s++E++ UQA32527.1|CBM32|GH16_3 129 T-ETLTVS--GTGRHIRLVGTERAT-PWGYSLYEFQ 160 4.455666..579*******88876.8*******96 PP == domain 2 score: 91.5 bits; conditional E-value: 2.8e-30 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekg 82 as++++ s+ ++ ++++a+D dp +rW+++ + w+ vdLg+p t+++vvl+w+ +++ y++evS++g++W+t+++++ UQA32527.1|CBM32|GH16_3 184 ASTSQHDSTCWQ-CTPDKAFDRDPASRWATSpeggWtdpGWIAVDLGAPATINRVVLQWDP-AHARAYRIEVSDNGTDWRTIHQTT 267 455555566555.89***************5443326788*******************54.56******************9876 PP CBM32.hmm 83 nttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + t +et +++ t+r+vRl++t+r+ +++g+s++E++ UQA32527.1|CBM32|GH16_3 268 TGTGF-KETLNVS--GTGRHVRLYATQRS-GEYGYSLWEFQ 304 64433.2456776..679*******7765.479******96 PP == domain 3 score: -2.8 bits; conditional E-value: 0.46 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRl 105 +++ ++ +t++f+++ ++ y+++ UQA32527.1|CBM32|GH16_3 553 DWPGpPD-TTTRFPQKLSVDYIKV 575 5554343.3669998888999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (577 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.28 // Query: XDQ07465.1|CBM32|GH16_3 [L=532] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-56 174.7 13.3 9.9e-31 93.0 2.2 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.0 2.2 9.9e-31 9.9e-31 10 123 .. 3 114 .. 1 115 [. 0.83 2 ! 86.5 3.6 9.9e-29 9.9e-29 4 123 .. 139 259 .. 135 260 .. 0.79 Alignments for each domain: == domain 1 score: 93.0 bits; conditional E-value: 9.9e-31 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 +ss++g ++a navDgdp+trWssa qw+++dLg+ t++++v l+w a + k +++evSt+ ++Wt ++e+++ t g XDQ07465.1|CBM32|GH16_3 3 ASSTEGAFDARNAVDGDPGTRWSSAFadpQWIEIDLGASTQISRVALNWeaA---YGKAFRIEVSTNAQDWTAIHETATGT-GG-- 82 3444566*****************84469********************744...5******************9876643.33.. PP CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 i +++ + t+ryvR+++t+r t ++g+s++E++ XDQ07465.1|CBM32|GH16_3 83 -IqSLTVAGTGRYVRMYGTQRGT-QYGFSLWEFQ 114 .4466656789*******88766.799*****96 PP == domain 2 score: 86.5 bits; conditional E-value: 9.9e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass++ s+++ + ++++a+D dp +rW+++ + w+ vdLg++ +++kvvl+w a+ +k+++++vS +g++Wt +++ XDQ07465.1|CBM32|GH16_3 139 ASSSQ-SDQNCWECTPARAFDRDPASRWATSstTgwtdpGWISVDLGAAAQINKVVLQWdpAY---AKSFQIQVSPNGQDWTSIYS 220 45554.444555599***************5331456889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + +t ++ t+ryvR+++t+rat +g+s++E++ XDQ07465.1|CBM32|GH16_3 221 TTSGTGFK-QTLAIT--GTGRYVRMYGTERAT-PYGYSLWEFQ 259 87644322.344555..679*******88876.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (532 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.20 // Query: BFE68977.1|CBM32 [L=425] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-31 96.0 2.7 2.2e-31 95.1 2.7 1.4 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 95.1 2.7 2.2e-31 2.2e-31 7 123 .. 41 154 .. 36 155 .. 0.80 Alignments for each domain: == domain 1 score: 95.1 bits; conditional E-value: 2.2e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae.kgnttdgttetit 93 ++ss+++a+ ++a+navDg+p+trWssa + qwl+vdLg++ tv++vvl w a + ++++v+vS +g+tWtt+++ +++t g +++ BFE68977.1|CBM32 41 TASSTESAA-FPASNAVDGNPGTRWSSAfSdpQWLQVDLGGTATVSSVVLAWetA---YSRTFSVQVSPNGSTWTTIKAnVAGTG-GR-QSVA 127 223334555.*****************85379********************644...5******************64143332.32.3556 PP CBM32.hmm 94 fdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ryvR+ t+rat +wg+s++E++ BFE68977.1|CBM32 128 VA--GSGRYVRMLSTARAT-QWGVSLTEFE 154 65..678*******77766.8*******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (425 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 83.50 // Query: UBU12275.1|CBM32|GH16_3 [L=563] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-57 177.3 14.1 4.6e-32 97.3 4.3 2.4 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 97.3 4.3 4.6e-32 4.6e-32 6 123 .. 38 152 .. 33 153 .. 0.82 2 ! 85.0 2.2 3e-28 3e-28 4 123 .. 173 290 .. 171 291 .. 0.81 Alignments for each domain: == domain 1 score: 97.3 bits; conditional E-value: 4.6e-32 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekgnttdgt 88 +a+s++ +a+ ++a++avDgdp+trWssa + qw++vdLg++ t+++v+l w++ +++ ++v++StDg++W +++++ t g+ UBU12275.1|CBM32|GH16_3 38 TASSTE-SAAAFPASAAVDGDPGTRWSSAfSdpQWIQVDLGATATISQVELSWET-AHATAFQVQASTDGSSWSNLYSTAAGTGGN 121 333334.4555*****************85379********************54.67******************9887655433 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEla 123 ++ ++ ++ryvR+ +t+rat awg+s++E++ UBU12275.1|CBM32|GH16_3 122 -QSLAVS--GSGRYVRVLGTQRAT-AWGYSLWEFK 152 .355665..568*******99876.7*******96 PP == domain 2 score: 85.0 bits; conditional E-value: 3e-28 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa.g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgn 83 ass+++ + ++ ++++a+D dp +rW++a + w++vdLg++ ++++vvl+w a+ ++++++++S D +tWttv+++++ UBU12275.1|CBM32|GH16_3 173 ASSSQHDGNCWE-CTPARAFDLDPASRWATAaWadpGWIYVDLGATARISRVVLQWdpAY---ARSFQLQTSPDANTWTTVYSTTT 254 455555555555.89***************7436788*******************6555...******************98876 PP CBM32.hmm 84 ttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t + +t +++ t+ryvR+++t+r+ +a+g+s++E++ UBU12275.1|CBM32|GH16_3 255 GTGFK-QTLSVS--GTGRYVRMYGTQRS-GAYGYSLWEFQ 290 44322.355666..579*******7765.479******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (563 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 115.78 // Query: WFF05913.1|CBM32|GH3 [L=1029] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-54 169.8 15.6 4.1e-30 91.0 4.1 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.8 3.7 7e-28 7e-28 7 123 .. 53 167 .. 48 168 .. 0.79 2 ! 91.0 4.1 4.1e-30 4.1e-30 9 123 .. 190 303 .. 184 304 .. 0.82 Alignments for each domain: == domain 1 score: 83.8 bits; conditional E-value: 7e-28 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStD.gktWttvaekgnttdgtt 89 ++sss+ a+ +a +a+Dgd++trWssa qwl+vdLg++ tvd+v+l w a+ ++ ++++v + Wttv++++ + gt WFF05913.1|CBM32|GH3 53 TASSSEGAA-TPAPAATDGDAGTRWSSAFadpQWLQVDLGATATVDQVQLVWeaAY---ATAFQIQVASApSGPWTTVHTTTAGSGGT- 136 344555555.99***************84469********************7445...*******99653559****9887643244. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 +t ++ t+ryvR+++t+rat +g+s++E++ WFF05913.1|CBM32|GH3 137 QTLAVT--GTGRYVRMYGTTRAT-GYGYSLWEFK 167 344555..679*******88776.699*****96 PP == domain 2 score: 91.0 bits; conditional E-value: 4.1e-30 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttet 91 ++ss++gg+++++a+Dg +trWss+ g qw+ +d+g++ t+++vvl w a +++ y++e+S Dg+tWtt++++++ g t WFF05913.1|CBM32|GH3 190 TASSWEGGNAPAAALDGRSTTRWSSQfGsdpQWFSIDFGGVATINRVVLVWeaA---YATGYRLETSADGSTWTTIYATTTGR-GG--T 272 345667779********999*****752579********************744...5******************8776533.33..3 PP CBM32.hmm 92 itfdkpvtaryvRltvtkratnawgasiaEla 123 +++ + t+ry+Rl++t+rat +g+s++El+ WFF05913.1|CBM32|GH3 273 EQLTVAGTGRYLRLYGTTRAT-GYGYSLWELQ 303 455545789*******88776.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1029 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 152.72 // Query: XQE79468.1|CBM32|GH16_3 [L=572] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-57 177.6 10.6 3.4e-31 94.5 1.1 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.5 1.1 3.4e-31 3.4e-31 7 123 .. 42 155 .. 36 156 .. 0.82 2 ! 87.1 2.7 6.5e-29 6.5e-29 4 123 .. 179 299 .. 176 300 .. 0.80 Alignments for each domain: == domain 1 score: 94.5 bits; conditional E-value: 3.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a+ sss++g ++a avDgdp+trWssa qw+++dLg+ +++vvl+w a + + +k+evS+D + Wt+v+ ++ t g XQE79468.1|CBM32|GH16_3 42 AT-SSSTEGPFSARSAVDGDPGTRWSSAFadpQWIQIDLGASAGISRVVLNWeaA---YGTAFKIEVSSDAERWTVVHRTAAGTGG 123 44.4445555*****************84469********************744...5*****************9976654434 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t ++ ++ t+ryvR+++t+rat a+g+s++E++ XQE79468.1|CBM32|GH16_3 124 T-QDLAVS--GTGRYVRMYGTQRAT-AYGYSLWEFQ 155 4.344555..579*******99876.79******96 PP == domain 2 score: 87.1 bits; conditional E-value: 6.5e-29 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 ass++s ++ + ++++a+D dp +rWs++ + w+ vdLg++ ++dkvvl+w a+ +k+++++vS++g +Wt++++ XQE79468.1|CBM32|GH16_3 179 ASSSQSDQN-CWECTPDRAFDRDPASRWSTSstTgwtdpGWISVDLGATAQIDKVVLQWdpAY---AKSFQIQVSSNGADWTPIYS 260 455554444.45599***************5331456889*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t + t++ + t+r+vR+++t+rat +g+s++E++ XQE79468.1|CBM32|GH16_3 261 TTSGTGF---KQTLAVAGTGRFVRMYGTQRAT-PYGYSLWEFQ 299 8764432...2255555789*******88876.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (572 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.27 // Query: WNV82795.1|CBM32|GH3 [L=1056] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-56 176.2 26.8 1.3e-31 95.9 6.5 3.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.2 6.6 7.3e-30 7.3e-30 8 123 .. 78 191 .. 72 192 .. 0.83 2 ! 95.9 6.5 1.3e-31 1.3e-31 9 123 .. 215 328 .. 209 329 .. 0.83 3 ? -1.5 0.3 0.18 0.18 63 89 .. 396 427 .. 382 486 .. 0.60 Alignments for each domain: == domain 1 score: 90.2 bits; conditional E-value: 7.3e-30 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttet 91 ++ss ++gg a +a+Dgd +trWssa qwl+vdLg++ t+d+vvl+w a + + ++ve+S + +tWt+v+++++ t g +t WNV82795.1|CBM32|GH3 78 TASSVENGGTLAPAATDGDLGTRWSSAAadpQWLQVDLGTTATIDRVVLNWetA---YGTAFRVETSANASTWTQVYATTTSTGGA-QT 162 45666777788***************84579********************644...5******************8876654444.45 PP CBM32.hmm 92 itfdkpvtaryvRltvtkratnawgasiaEla 123 t++ ++ryvRlt+t+rat +g+s++E++ WNV82795.1|CBM32|GH3 163 LTVT--GSGRYVRLTGTARAT-GYGYSLWEFQ 191 5666..568*******88776.699*****96 PP == domain 2 score: 95.9 bits; conditional E-value: 1.3e-31 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttet 91 s+ss++gg+++++a+Dg +trWss++ qwl +dLg++ t++kv l w a +++ y+vevS+Dg +Wt ++++++ t g+ et WNV82795.1|CBM32|GH3 215 SASSWEGGNAPAAALDGRSSTRWSSQHgvdaQWLRIDLGNTSTITKVALAWesA---YATGYRVEVSNDGANWTSIYSTTTGTGGN-ET 299 346677779********999*****845789********************644...5******************9887755433.46 PP CBM32.hmm 92 itfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t+ryvRl++t+rat +g+s++E++ WNV82795.1|CBM32|GH3 300 LNVT--GTGRYVRLYGTARAT-GYGYSLWEFQ 328 6776..679*******88776.699*****96 PP == domain 3 score: -1.5 bits; conditional E-value: 0.18 CBM32.hmm 63 dykvevStDgk.tWttvaekgnttd.gt...t 89 dy++ +S + +t+vae+++tt +t + WNV82795.1|CBM32|GH3 396 DYDFAASGNLIdLYTKVAETTGTTYtPTwdiP 427 56666664432147777766554433333221 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1056 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 121.84 // Query: URM94059.1|CBM32|GH3 [L=1017] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-57 177.8 16.8 4e-31 94.3 3.2 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.3 3.2 4e-31 4e-31 7 123 .. 41 154 .. 35 155 .. 0.81 2 ! 88.6 5.7 2.2e-29 2.2e-29 9 123 .. 177 289 .. 171 290 .. 0.83 Alignments for each domain: == domain 1 score: 94.3 bits; conditional E-value: 4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 ++sss+ ++ ++a+++vDgd++trWssa + qw+ +dLg+ +++++vvl+w a +++ ++++vS +g++Wt ++++++ + g+ + URM94059.1|CBM32|GH3 41 TASSSEGDA-YPASAVVDGDAGTRWSSAfSdpQWVRIDLGESRDISQVVLNWeaA---YATAFQIQVSGNGSDWTSIYSTTTGSGGN-Q 124 334455555.*****************85379********************744...5******************9887655433.3 PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ry+R+++t+rat +g+s++E++ URM94059.1|CBM32|GH3 125 TLDVT--GRGRYIRMYGTARAT-GYGYSLWEFS 154 44555..679*******88776.699*****96 PP == domain 2 score: 88.6 bits; conditional E-value: 2.2e-29 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtteti 92 ++ss++gg+++++a+Dg ++trWss+ qwl vdLg++ t+++v+l+w a +++ y++ vS Dg++Wtt++++++ + g URM94059.1|CBM32|GH3 177 TASSWEGGNAPAAALDGRTTTRWSSEAgddQWLRVDLGGTATITGVTLDWeaA---YATGYRLDVSGDGTSWTTLYSTTTGK-GG--VE 259 345567779*********9******84479********************744...5******************9876643.33..34 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 ++d + ++ry+R+ +t+rat +g+s +E++ URM94059.1|CBM32|GH3 260 NLDVTGKGRYIRFSGTDRAT-GYGYSFWEFQ 289 77766789*******88877.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1017 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.12 // Query: XNL79781.1|CBM32|GH3 [L=1017] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-58 180.5 15.9 1.4e-31 95.7 2.7 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 95.7 2.7 1.4e-31 1.4e-31 7 123 .. 41 154 .. 35 155 .. 0.81 2 ! 89.7 5.6 1e-29 1e-29 9 123 .. 177 289 .. 170 290 .. 0.83 Alignments for each domain: == domain 1 score: 95.7 bits; conditional E-value: 1.4e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 ++sss+ ++ ++a++avDg+++trWssa g qw+ +dLg+ +++++vvl+w a ++ ++++vS +g++Wt ++++++ + g+ + XNL79781.1|CBM32|GH3 41 TASSSEGDA-YPASAAVDGNAGTRWSSAfGdpQWVRIDLGESRDISQVVLNWeaA---YAAAFQIQVSGNGSDWTSIYSTTTGSGGN-Q 124 334455555.*****************85379********************744...5******************9887655433.3 PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEla 123 t +++ ++ry+R+++t+rat +g+s++E++ XNL79781.1|CBM32|GH3 125 TLDVT--GRGRYIRMYGTARAT-GYGYSLWEFS 154 44555..679*******88776.699*****96 PP == domain 2 score: 89.7 bits; conditional E-value: 1e-29 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtteti 92 ++ss++gg+++++a+Dg ++trWss+ qwl vdLg++ t+++v+l+w a +++ y++ vS Dg++Wtt++++++ + g XNL79781.1|CBM32|GH3 177 TASSWEGGNAPAAALDGRTTTRWSSEAgddQWLRVDLGGTATITGVTLNWeaA---YATGYRLDVSGDGTSWTTLYSTTTGK-GG--VE 259 345667779*********9******84479********************744...5******************9876643.33..34 PP CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 ++d + ++ry+R+ +t+rat +g+s +E++ XNL79781.1|CBM32|GH3 260 NLDVTGKGRYIRFSGTDRAT-GYGYSFWEFQ 289 77766789*******88877.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1017 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 149.96 // Query: XUZ94083.1|CBM32|GH16_3 [L=576] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-60 189.4 10.0 2e-33 101.7 1.1 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 101.7 1.1 2e-33 2e-33 7 123 .. 47 160 .. 41 161 .. 0.83 2 ! 91.2 2.1 3.7e-30 3.7e-30 4 123 .. 183 303 .. 180 304 .. 0.80 3 ? -2.8 0.0 0.46 0.46 83 105 .. 552 574 .. 547 575 .. 0.67 Alignments for each domain: == domain 1 score: 101.7 bits; conditional E-value: 2e-33 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 a++ss++++ ++a navDgdp+trWssa + qw+ +dLg+ t v +vvl+w a ++k y++e S Dg+ Wtt++++++ t g XUZ94083.1|CBM32|GH16_3 47 ATASSAEGP-FAAPNAVDGDPGTRWSSAfSddQWIRIDLGASTAVGQVVLNWeaA---YAKGYRIELSADGQRWTTIHSTATGTGG 128 333444455.*****************85369********************744...5******************987765434 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 t et t++ t+ry+Rl++t+rat wg+s++E++ XUZ94083.1|CBM32|GH16_3 129 T-ETLTVS--GTGRYIRLVGTERAT-PWGYSLYEFQ 160 4.455666..579*******88876.8*******96 PP == domain 2 score: 91.2 bits; conditional E-value: 3.7e-30 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa....g...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as++++ s+ ++ ++ +a+D dp +rW+++ + w+ vdLg+p t+++vvl+w a+ ++ y++evS++g++W+t+++ XUZ94083.1|CBM32|GH16_3 183 ASTSQHDSTCWQ-CTPGKAFDRDPASRWATSpeggWtdpGWIAVDLGAPATINRVVLQWdpAY---ARAYRIEVSDNGTDWRTIHQ 264 455555566555.89***************5443326788*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t +et +++ t+r+vRl++t+r+ +++g+s++E++ XUZ94083.1|CBM32|GH16_3 265 TTTGTGF-KETLNVS--GTGRHVRLYATQRS-GEYGYSLWEFQ 303 7664433.2456776..679*******7765.479******96 PP == domain 3 score: -2.8 bits; conditional E-value: 0.46 CBM32.hmm 83 nttd.gttetitfdkpvtaryvRl 105 +++ ++ +t++f+++ ++ y+++ XUZ94083.1|CBM32|GH16_3 552 DWPGpPD-TTTRFPQKLSVDYIKV 574 5554343.3669998888999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (576 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 80.33 // Query: XSC33064.1|CBM32|GH16_3 [L=730] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-84 266.3 41.9 4.7e-33 100.5 8.5 4.2 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 95.3 7.7 1.9e-31 1.9e-31 7 123 .. 65 179 .. 59 180 .. 0.82 2 ! 100.5 8.5 4.7e-33 4.7e-33 5 123 .. 200 316 .. 195 317 .. 0.82 3 ! 85.8 4.1 1.7e-28 1.7e-28 4 123 .. 355 475 .. 351 476 .. 0.78 4 ? 0.1 0.3 0.059 0.059 42 107 .. 508 579 .. 498 600 .. 0.56 Alignments for each domain: == domain 1 score: 95.3 bits; conditional E-value: 1.9e-31 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdg 87 ++sss++a+ +a+ a+Dg+++trWssa + qw++vdLg+p+ +++v l+w a +++ +++++S+D ++Wt v+++++ t g XSC33064.1|CBM32|GH16_3 65 TASSSESAA-TPASSATDGNAGTRWSSAfTvpQWIQVDLGSPQAISRVGLNWeaA---YATAFTIQTSNDATNWTNVYSTTTGTGG 146 445566666.9****************85479********************744...5******************988765545 PP CBM32.hmm 88 ttetitfdkpvtaryvRltvtkratnawgasiaEla 123 + +++++ ++ryvRl++t+++t ++g s++E++ XSC33064.1|CBM32|GH16_3 147 S--NVSLTVSGNGRYVRLNATAKST-QYGISLWEFQ 179 5..4455544678*******66544.7*******96 PP == domain 2 score: 100.5 bits; conditional E-value: 4.7e-33 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgntt 85 ++a++ss++++g +a+ avDg+++trWssa qwl+vdLg++++v +v+l+w a +++ +++++StDg+ Wtt++++++ t XSC33064.1|CBM32|GH16_3 200 KTATASSTENAGTPAASAVDGNAGTRWSSAAsdpQWLQVDLGSVQSVCGVTLNWetA---YATAFQIQTSTDGTAWTTIYTTTTGT 282 4555566666669****************84479********************644...5******************9887644 PP CBM32.hmm 86 dgtteti.tfdkpvtaryvRltvtkratnawgasiaEla 123 g + +++ + ++ryvR+++t+rat ++g+s++E++ XSC33064.1|CBM32|GH16_3 283 -GG---VqNLNVTGSGRYVRMNGTARAT-QYGYSLWEFQ 316 .33...3356544679*******77766.89******96 PP == domain 3 score: 85.8 bits; conditional E-value: 1.7e-28 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssa...g....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvae 80 as+++ ++++ + ++++a+D+dp +rW+++ g w++vdLg++ +++vvl+w a+ + y++++StD +Wt +++ XSC33064.1|CBM32|GH16_3 355 ASTSQ-NDTNCNPCTPDKAFDNDPASRWATSpdnGwvdpGWIYVDLGAQAHITQVVLQWdpAY---AVAYQIQTSTDAANWTSIYS 436 44444.444444478***************5443147788*******************6555...******************98 PP CBM32.hmm 81 kgnttdgttetitfdkpvtaryvRltvtkratnawgasiaEla 123 +++ + + et t++ ++ryvR+++t+r++ +g+s++E++ XSC33064.1|CBM32|GH16_3 437 TTTGKGFK-ETLTVN--GNGRYVRMYGTQRSN-GYGYSLWEFK 475 77643333.455666..568*******77754.799*****96 PP == domain 4 score: 0.1 bits; conditional E-value: 0.059 CBM32.hmm 42 LgkpttvdkvvltwaengrikdykvevStDgktWttva.......ekgnttd.gt..te.titfdkpvtaryvRltv 107 g++ + +k+++++ g+ ++ ++++ t+ ++ t + ++ ++t+ g t +i+ ++ +t++y R+++ XSC33064.1|CBM32|GH16_3 508 TGTNVDTSKWHVDP---GTGQNGEIQYYTNSEN-TSIQggslvieAR-KQTEgGRdyTSgRINTSTSFTTQYGRVEA 579 56666667777773...4577778887777766.5554333333211.11121222322344444556678888877 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (730 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 71.38 // Query: UOZ04793.1|CBM32|GH16_3 [L=572] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-58 180.4 18.4 2.5e-33 101.4 6.3 2.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 101.4 6.3 2.5e-33 2.5e-33 9 123 .. 46 158 .. 41 159 .. 0.83 2 ! 86.7 1.7 9e-29 9e-29 13 122 .. 189 300 .. 176 302 .. 0.76 3 ? -3.7 0.0 0.83 0.83 65 81 .. 508 522 .. 493 532 .. 0.63 Alignments for each domain: == domain 1 score: 101.4 bits; conditional E-value: 2.5e-33 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g..qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 +ss+++ g +a+navDgd +trWssa + qwl+vdLg+++++++vv++w a ++k +++++StDg tWt ++++++ t g+ UOZ04793.1|CBM32|GH16_3 46 ASSTENVGTPASNAVDGDGGTRWSSAfSdpQWLQVDLGSTQQLSQVVVNWeaA---YAKAFTIQASTDGATWTSLYSTTTATGGN- 127 3444555599***************85379********************744...5******************9887665533. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEla 123 +t +++ ++ryvRlt+t+rat ++g+s++E++ UOZ04793.1|CBM32|GH16_3 128 QTLSVT--GSGRYVRLTGTQRAT-QYGYSLWEFQ 158 355666..568*******99887.79******96 PP == domain 2 score: 86.7 bits; conditional E-value: 9e-29 CBM32.hmm 13 aaggggaenavDgdpntrWssa..g.....qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtt 89 a +g +++a+D dp trW+++ + w+tvdLg++ +v++vvl+w a + y+++vS+D+ +Wt ++++++ + + UOZ04793.1|CBM32|GH16_3 189 ACPGCLPAKAFDHDPATRWATSatTgwvdpGWITVDLGATANVHQVVLQWdpAF---AVAYQIQVSNDNANWTSLYSTTTGKGFK- 270 233345***************5431457889*******************6555...******************9887643333. PP CBM32.hmm 90 etitfdkpvtaryvRltvtkratnawgasiaEl 122 et t++ ++ryvR+++t+r +n +g+s++ + UOZ04793.1|CBM32|GH16_3 271 ETLTVN--GSGRYVRMYGTAR-SNGYGYSLWGF 300 455666..568*******665.55799**9977 PP == domain 3 score: -3.7 bits; conditional E-value: 0.83 CBM32.hmm 65 kvevStDgktWttvaek 81 +++ Dg+ ++t+ UOZ04793.1|CBM32|GH16_3 508 TFY--VDGTAFETINRD 522 444..478888887433 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (572 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.13 // Query: BEL02940.1|CBM32|GH16_3 [L=569] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-54 170.3 20.2 2.8e-30 91.5 8.5 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.5 8.5 2.8e-30 2.8e-30 6 123 .. 51 167 .. 46 168 .. 0.85 2 ! 83.7 3.7 7.5e-28 7.5e-28 15 123 .. 200 310 .. 188 311 .. 0.79 Alignments for each domain: == domain 1 score: 91.5 bits; conditional E-value: 2.8e-30 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd 86 +++ss++aag + a+ avDg+++trW+s++ qw++vdLg+ t v+++ ++w a +++ ++++ S +g+tWt+++++++ BEL02940.1|CBM32|GH16_3 51 ATASSTEAAGAYLAAEAVDGNNGTRWASTWsatQWFQVDLGASTAVSRIAINWeaA---YARGFNIQFSANGSTWTQAYATTTGA- 132 3445666778799***************86789********************744...5******************8776643. PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkratnawgasiaEla 123 g +++i ++ taryvR++ t+ra +a+g+s +E++ BEL02940.1|CBM32|GH16_3 133 GGQQSIAVS--GTARYVRINLTQRALDAYGYSFWEFQ 167 334688888..579*********99889*******96 PP == domain 2 score: 83.7 bits; conditional E-value: 7.5e-28 CBM32.hmm 15 ggggaenavDgdpntrWssa.g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttet 91 + ++++a+D+dp +rW+++ + w+ vdLg++ ++++vvl+w a+ +++y+++vS D+ +Wt ++++++ + g ++ BEL02940.1|CBM32|GH16_3 200 NPCSPDKAFDNDPASRWATSsTngwvdpGWISVDLGATAQISQVVLQWdpAY---ARSYQLQVSPDNVNWTNFYSTTTGD-GLKDV 281 4467***************6413457889*******************6555...******************9876633.33345 PP CBM32.hmm 92 itfdkpvtaryvRltvtkratnawgasiaEla 123 i+ + t+ryvR+++t+r++ a+g+s++E++ BEL02940.1|CBM32|GH16_3 282 INAT--GTGRYVRMYGTARSS-AYGYSLWEFS 310 5666..679*******77664.79******96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (569 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.71 // Query: XLD98242.1|CBM32 [L=386] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-12 33.9 0.0 4.1e-12 32.9 0.0 1.5 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.9 0.0 4.1e-12 4.1e-12 40 112 .. 40 109 .. 23 141 .. 0.79 Alignments for each domain: == domain 1 score: 32.9 bits; conditional E-value: 4.1e-12 CBM32.hmm 40 vdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekgnttdgttetitfdkpvtaryvRltvtkra.t 112 dLg+ t+vd+v l+w++ + + d+++++S Dg+ W+t+ +++ t g+ + +++ +r++R+ +t+ra + XLD98242.1|CBM32 40 ADLGGLTEVDRVALDWSG-DPVDDFQFQTSADGERWVTIRRVTGATGGE-QAYDVS--GIGRHLRVLATDRArQ 109 69**************65.77******************9887654333.233554..237*******886532 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (386 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.01 // Query: XIF75981.1|CBM32|GH3 [L=1161] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-86 272.8 29.6 2.1e-32 98.4 7.6 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.4 7.6 2.1e-32 2.1e-32 7 123 .. 48 161 .. 43 162 .. 0.83 2 ! 97.9 4.6 3e-32 3e-32 8 123 .. 182 295 .. 175 296 .. 0.81 3 ! 87.5 1.9 4.9e-29 4.9e-29 10 123 .. 321 432 .. 317 433 .. 0.82 Alignments for each domain: == domain 1 score: 98.4 bits; conditional E-value: 2.1e-32 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgtte 90 a++ss ++g ++a++avDgd++trW+sa+ qwl+vdLg++ ++++vvl+w a +k y++++StDg +Wt ++++++ + gt e XIF75981.1|CBM32|GH3 48 ATASSVNGG-NSAAAAVDGDTGTRWESAWsdpQWLQVDLGATASITQVVLQWetA---SAKAYQIQTSTDGANWTSIYSTTTGPGGT-E 131 444566566.9****************8778*********************644...5******************9887654354.4 PP CBM32.hmm 91 titfdkpvtaryvRltvtkratnawgasiaEla 123 t t++ ++ryvRl +t+r+t +g+s++E++ XIF75981.1|CBM32|GH3 132 TLTVT--GSGRYVRLSGTQRNT-GYGYSLWEFQ 161 55666..568*******88765.599*****96 PP == domain 2 score: 97.9 bits; conditional E-value: 3e-32 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttet 91 ++ss++++g +a++a+Dg+++trWssa qwl+vdLg+ +t+ +v+l+w a +++ ++++vS Dg +W v+++++ gt +t XIF75981.1|CBM32|GH3 182 TASSTENAGTPASAAFDGNTGTRWSSAAsdpQWLQVDLGSSQTLCQVSLNWetA---YASAFQIQVSADGANWSSVYTTTTGAGGT-QT 266 3344445559****************84479********************644...5******************9876644344.45 PP CBM32.hmm 92 itfdkpvtaryvRltvtkratnawgasiaEla 123 +++ t+ryvR+++t+r t +g+s++E+a XIF75981.1|CBM32|GH3 267 LNVS--GTGRYVRMYGTARGT-GYGYSLWEFA 295 5776..679*******66655.599*****96 PP == domain 3 score: 87.5 bits; conditional E-value: 4.9e-29 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttdgttetit 93 +ss+ag +++++a+Dg +trW+sa qwl+vdLg++ ++ vvltw a +++ y++evS D ++Wt +++++ + gt et + XIF75981.1|CBM32|GH3 321 ASSYAGANAPAAALDGRSTTRWESAAsdpQWLQVDLGGTAAISCVVLTWetA---YASAYRIEVSPDATNWTSIYSTTAGQGGT-ETLK 405 34456669********999*****84479********************644...5******************9887543244.4445 PP CBM32.hmm 94 fdkpvtaryvRltvtkratnawgasiaEla 123 ++ t+ry+Rl++t+rat +g+s++E++ XIF75981.1|CBM32|GH3 406 IT--GTGRYIRLYGTARAT-GYGYSLWEFQ 432 55..679*******88776.699*****96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1161 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.87 // [ok]