# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM32/fasta_for_each_cluster/cluster_328.txt # target HMM database: merged_hmms/CBM32.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM32/CBM32_cluster_328.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: XPA99428.1|CBM32|CBM5 [L=1068] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-18 51.9 0.1 2.1e-15 43.5 0.1 2.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.2 0.0 0.0015 0.0015 94 122 .. 504 533 .. 454 535 .. 0.75 2 ! 43.5 0.1 2.1e-15 2.1e-15 9 88 .. 553 642 .. 547 671 .. 0.75 Alignments for each domain: == domain 1 score: 5.2 bits; conditional E-value: 0.0015 CBM32.hmm 94 fd.kpvtaryvRltvtkratnawgasiaEl 122 ++ +++++ry+++++t+ a ++ +as+aEl XPA99428.1|CBM32|CBM5 504 LTqDTAQGRYLKFVATSAADGKDNASVAEL 533 44345679*******99886665599*998 PP == domain 2 score: 43.5 bits; conditional E-value: 2.1e-15 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd 86 +ss+ +g + a+Dg+pn++Ws+a g +++ +dLg+ +++++++ + + g+ik y+v++S+ + Wt +a+ +++ XPA99428.1|CBM32|CBM5 553 TSSAVPGAAVGNHAIDGNPNSYWSTAaGarypHEILIDLGADSRFSQLHYLPrqDAgLsGNIKGYQVYGSSSvNGGWTLLADG-EFSA 639 345566768899*************74256799******************98522325***********754448**99976.4433 PP CBM32.hmm 87 .gt 88 ++ XPA99428.1|CBM32|CBM5 640 dNE 642 233 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1068 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.32 // Query: XGX19023.1|CBM32|CBM5 [L=1063] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-17 49.9 0.1 2.3e-15 43.3 0.0 2.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.4 0.0 0.0053 0.0053 95 122 .. 500 528 .. 459 530 .. 0.74 2 ! 43.3 0.0 2.3e-15 2.3e-15 10 92 .. 549 638 .. 543 663 .. 0.76 Alignments for each domain: == domain 1 score: 3.4 bits; conditional E-value: 0.0053 CBM32.hmm 95 d.kpvtaryvRltvtkratnawgasiaEl 122 + +++++ry++l++t+ ++ +as+aEl XGX19023.1|CBM32|CBM5 500 TqDTAQGRYLKLVATSAVDGQDTASVAEL 528 3345679*******775555666999997 PP == domain 2 score: 43.3 bits; conditional E-value: 2.3e-15 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd. 86 ss+ +g + a+Dg+pn++Ws+a g +++++dLg+ +++++++ + + g+ik y+v++S+ + W+ +a+ + ++ XGX19023.1|CBM32|CBM5 549 SSAVPGAAVGNHAIDGNPNSYWSTAaGarypHEMVIDLGADSRFSQLHYLPrqDAgLsGNIKGYQVYGSSSvNGGWNLLADGE-FNAd 635 45556667899*************74256799******************98522325***********754448**999764.3332 PP CBM32.hmm 87 gtteti 92 ++ i XGX19023.1|CBM32|CBM5 636 ND---I 638 33...3 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1063 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 128.40 // Query: WAF87581.1|CBM32|CBM5 [L=974] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-19 56.2 0.1 5e-17 48.7 0.0 3.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.7 0.0 0.0044 0.0044 95 123 .. 508 536 .. 475 537 .. 0.68 2 ! 48.7 0.0 5e-17 5e-17 12 89 .. 558 651 .. 551 698 .. 0.69 Alignments for each domain: == domain 1 score: 3.7 bits; conditional E-value: 0.0044 CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 +++++ary++l+++++ ++ as+aEl+ WAF87581.1|CBM32|CBM5 508 QDTAQARYLKLVAESSIDGKERASAAELH 536 345689*******5544556669999987 PP == domain 2 score: 48.7 bits; conditional E-value: 5e-17 CBM32.hmm 12 saaggggaenavDgdpntrWss..ag...qwltvdLgkpttvdkvvltw.ae..n.grikdykvevStD.gktWttvaekgnttd.gt 88 + +++ + + a+Dg+++++Ws+ ++ +++++dLg+++ ++++++ + + g+ik y++++S++ + +Wt + +g+++ ++ WAF87581.1|CBM32|CBM5 558 AVPASASGAHAIDGNTSSYWSTvpGDrypHQMVIDLGGEQHFSSLNYLPqQVrdMeGNIKGYRIYGSDNpNGNWTLLG-QGEFSAsNE 644 334447899*************652256899*****************96324435***********87667***997.445544344 PP CBM32.hmm 89 ......t 89 + WAF87581.1|CBM32|CBM5 645 aqaaplK 651 4444330 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (974 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.25 // Query: XFD49265.1|CBM32|CBM5 [L=955] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-20 60.6 0.1 2.7e-16 46.4 0.0 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 7.5 0.0 0.0003 0.0003 91 123 .. 493 526 .. 469 527 .. 0.73 2 ! 46.4 0.0 2.7e-16 2.7e-16 10 88 .. 544 632 .. 540 680 .. 0.76 3 ? 2.1 0.0 0.014 0.014 58 109 .. 760 826 .. 700 847 .. 0.66 Alignments for each domain: == domain 1 score: 7.5 bits; conditional E-value: 0.0003 CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + t+d++v+ ry+Rl+++++ ++ +asiaEl+ XFD49265.1|CBM32|CBM5 493 AFaTLDETVKPRYLRLVANSSVDGKESASIAELH 526 44488888999*******554455677*****97 PP == domain 2 score: 46.4 bits; conditional E-value: 2.7e-16 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..aen..grikdykvevSt..DgktWttvaekgnttd 86 +ss+++g++ +n++Dg+p+++W+sa g ++l++dLg++ +++++++ + +++ g+ik y+v++ Dg Wt +a+ + ++ XFD49265.1|CBM32|CBM5 544 ASSTQAGSPGSNIIDGNPKSYWASAaGagypHQLVIDLGTESRFSQLHYLPrqDQGlsGNIKGYQVYGGIgpDG-PWTLLADGE-FSA 629 33445559****************742457999*****************98533246*********8854488.9**998764.433 PP CBM32.hmm 87 .gt 88 ++ XFD49265.1|CBM32|CBM5 630 dNE 632 243 PP == domain 3 score: 2.1 bits; conditional E-value: 0.014 CBM32.hmm 58 n.grikdykvevSt...........DgktWttvaekgnttdgt.........te.titfdkpvta.ryvRltvtk 109 + +++ ++ v++S+ gk W+++ ++ +i+ +++++a vRl +++ XFD49265.1|CBM32|CBM5 760 GrQYMARWWVQGSEpgnpnftgadgSGKVWKDLG--------PcdndtpvepPVaSIKGTSQAKAgEQVRLDASG 826 2477889999999844444444422245666665........233222323223477666445555999999843 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (955 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 111.85 // Query: UXY53242.1|CBM32|CBM5 [L=1042] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-18 51.5 0.3 5.8e-16 45.3 0.0 2.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.0 0.0 0.0072 0.0072 96 122 .. 481 507 .. 437 509 .. 0.75 2 ! 45.3 0.0 5.8e-16 5.8e-16 10 88 .. 528 616 .. 522 639 .. 0.76 3 ? -3.5 0.0 0.75 0.75 96 108 .. 872 884 .. 856 903 .. 0.52 Alignments for each domain: == domain 1 score: 3.0 bits; conditional E-value: 0.0072 CBM32.hmm 96 kpvtaryvRltvtkratnawgasiaEl 122 +++++ry+++++t+ ++ +as+aEl UXY53242.1|CBM32|CBM5 481 DTAQGRYLKFVATSAVDGQDTASVAEL 507 45679*******775555666999997 PP == domain 2 score: 45.3 bits; conditional E-value: 5.8e-16 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevSt..DgktWttvaekgnttd 86 ss+ +g + a+Dg+pn++Wssa g ++l++dLg+ +++++++ + + g+ik y+v++S+ Dg W +a+ + ++ UXY53242.1|CBM32|CBM5 528 SSAVPGAAVGSHAIDGNPNSYWSSAaGarypHELVIDLGADSRFSQLHYLPrqDAgLsGNIKGYQVYGSSsvDG-GWSLLADGE-FSA 613 4555666789**************74256799******************98522325*********9964488.9**998764.433 PP CBM32.hmm 87 .gt 88 ++ UXY53242.1|CBM32|CBM5 614 dND 616 344 PP == domain 3 score: -3.5 bits; conditional E-value: 0.75 CBM32.hmm 96 kpvtaryvRltvt 108 +++++ v+++++ UXY53242.1|CBM32|CBM5 872 SATRVHQVKVQAE 884 2333344444442 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1042 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 135.94 // Query: XGX17589.1|CBM32|CBM5 [L=970] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-17 50.8 0.1 4.1e-15 42.6 0.1 2.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.1 0.0 0.0017 0.0017 96 122 .. 503 529 .. 453 531 .. 0.78 2 ! 42.6 0.1 4.1e-15 4.1e-15 9 86 .. 549 635 .. 543 664 .. 0.77 Alignments for each domain: == domain 1 score: 5.1 bits; conditional E-value: 0.0017 CBM32.hmm 96 kpvtaryvRltvtkratnawgasiaEl 122 +++++ry++l++t+++ ++ +as+aEl XGX17589.1|CBM32|CBM5 503 DTAQGRYLKLVATSSQDGKDNASVAEL 529 45579*******88876665599*998 PP == domain 2 score: 42.6 bits; conditional E-value: 4.1e-15 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekg.ntt 85 +ss+ +g+ +a+ a+Dg+p ++Wssa g +++++dLg+ +++++++ + + + g ik y+v++ + + Wt +a+ + n XGX17589.1|CBM32|CBM5 549 TSSAITGSAPAAHAIDGNPASYWSSAaGarypHQIVIDLGTDSRFSQLHYLPrqDAgQsGIIKGYQVYGGDSpNGGWTLLADGQfN-- 634 3455566699***************742567999*****************98633567**********9644558**99876423.. PP CBM32.hmm 86 d 86 XGX17589.1|CBM32|CBM5 635 A 635 2 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (970 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 137.83 // Query: WDH46724.1|CBM32|CBM5 [L=955] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-22 66.1 0.3 1.4e-16 47.3 0.0 3.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 12.1 0.0 1.1e-05 1.1e-05 95 123 .. 498 526 .. 471 527 .. 0.77 2 ! 47.3 0.0 1.4e-16 1.4e-16 10 88 .. 544 632 .. 540 680 .. 0.78 3 ? 2.4 0.0 0.011 0.011 48 109 .. 753 826 .. 702 846 .. 0.64 Alignments for each domain: == domain 1 score: 12.1 bits; conditional E-value: 1.1e-05 CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 +++v+aryvRl+++++ ++ gasiaEl+ WDH46724.1|CBM32|CBM5 498 NETVKARYVRLVANSSVDGKEGASIAELH 526 37899********554466799*****97 PP == domain 2 score: 47.3 bits; conditional E-value: 1.4e-16 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltw..aen..grikdykvevSt..DgktWttvaekgnttd 86 +ss+++g++ +n++Dg+p+++W+sa+ ++l++dLg++ +++++++ + +++ g+ikdy+v++ Dg Wt +a+ + ++ WDH46724.1|CBM32|CBM5 544 ASSTQAGSPGSNILDGNPKSYWASATgagypHQLVIDLGTESRFSQLHYLPrqDQGlsGNIKDYQVYGGAgpDG-PWTLLADGE-FSA 629 33445559****************74456799******************98533246*********9965578.9**998764.433 PP CBM32.hmm 87 .gt 88 ++ WDH46724.1|CBM32|CBM5 630 dNE 632 243 PP == domain 3 score: 2.4 bits; conditional E-value: 0.011 CBM32.hmm 48 vdkvvltwaen.grikdykvevSt...........DgktWttvaekgnttdgt........te..titfdkpvta.ryvRltvtk 109 ++v+ + + +++ ++ v++S+ gk W+++ + +i+ +++++a vRl +++ WDH46724.1|CBM32|CBM5 753 RNQVQHK---GrQYMARWWVQGSEpgnpnftgadgSGKVWKDLG--------PcdndtqvePPlpSINGATQAKAgEQVRLDASG 826 4555555...3478999999999944444444422245566664........233222222112366555445555999998833 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (955 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 113.74 // Query: XPB46505.1|CBM32|CBM5 [L=1068] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-18 51.9 0.1 2.1e-15 43.5 0.1 2.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.2 0.0 0.0015 0.0015 94 122 .. 504 533 .. 454 535 .. 0.75 2 ! 43.5 0.1 2.1e-15 2.1e-15 9 88 .. 553 642 .. 547 671 .. 0.75 Alignments for each domain: == domain 1 score: 5.2 bits; conditional E-value: 0.0015 CBM32.hmm 94 fd.kpvtaryvRltvtkratnawgasiaEl 122 ++ +++++ry+++++t+ a ++ +as+aEl XPB46505.1|CBM32|CBM5 504 LTqDTAQGRYLKFVATSAADGKDNASVAEL 533 44345679*******99886665599*998 PP == domain 2 score: 43.5 bits; conditional E-value: 2.1e-15 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd 86 +ss+ +g + a+Dg+pn++Ws+a g +++ +dLg+ +++++++ + + g+ik y+v++S+ + Wt +a+ +++ XPB46505.1|CBM32|CBM5 553 TSSAVPGAAVGNHAIDGNPNSYWSTAaGarypHEILIDLGADSRFSQLHYLPrqDAgLsGNIKGYQVYGSSSvNGGWTLLADG-EFSA 639 345566768899*************74256799******************98522325***********754448**99976.4433 PP CBM32.hmm 87 .gt 88 ++ XPB46505.1|CBM32|CBM5 640 dNE 642 233 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1068 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.21 // Query: WDH40775.1|CBM32|CBM5 [L=955] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-22 65.8 0.7 1.2e-16 47.5 0.0 3.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 12.1 0.0 1.1e-05 1.1e-05 95 123 .. 498 526 .. 471 527 .. 0.77 2 ! 47.5 0.0 1.2e-16 1.2e-16 10 88 .. 544 632 .. 540 684 .. 0.75 3 ? 2.3 0.0 0.012 0.012 49 109 .. 754 826 .. 702 849 .. 0.64 Alignments for each domain: == domain 1 score: 12.1 bits; conditional E-value: 1.1e-05 CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 +++v+aryvRl+++++ ++ gasiaEl+ WDH40775.1|CBM32|CBM5 498 NETVKARYVRLVANSSVDGKEGASIAELH 526 37899********554466799*****97 PP == domain 2 score: 47.5 bits; conditional E-value: 1.2e-16 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltw..aen..grikdykvevSt..DgktWttvaekgnttd 86 +ss+++g++ +n++Dg+p+++W+sa+ ++l++dLg++ +++++++ + +++ g+ikdy+v++ Dg Wt +a+ + ++ WDH40775.1|CBM32|CBM5 544 ASSTQAGSPGSNILDGNPKSYWASATgagypHQLVIDLGTESRFSQLHYLPrqDQGlsGNIKDYQVYGGAgpDG-PWTLLADGE-FSA 629 33445559****************74456799******************98533246*********9965578.9**998764.433 PP CBM32.hmm 87 .gt 88 ++ WDH40775.1|CBM32|CBM5 630 dNE 632 243 PP == domain 3 score: 2.3 bits; conditional E-value: 0.012 CBM32.hmm 49 dkvvltwaen.grikdykvevSt...........DgktWttvaekgnttdgt........te..titfdkpvta.ryvRltvtk 109 ++v+ + + +++ ++ v++S+ gk W+++ + +i+ +++++a vRl +++ WDH40775.1|CBM32|CBM5 754 NQVQHK---GrQYMARWWVQGSEpgnpnftgadgSGKVWKDLG--------PcdndtqvePPlpSINGATQAKAgEQVRLDASG 826 344444...3478999999999944444444422245566664........233222222112366555445555999998843 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (955 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 111.42 // Query: WCD79382.1|CBM32|CBM5 [L=983] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-18 52.6 0.1 9.9e-16 44.5 0.1 2.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 4.6 0.0 0.0023 0.0023 96 122 .. 509 535 .. 486 537 .. 0.79 2 ! 44.5 0.1 9.9e-16 9.9e-16 9 88 .. 555 642 .. 549 671 .. 0.77 Alignments for each domain: == domain 1 score: 4.6 bits; conditional E-value: 0.0023 CBM32.hmm 96 kpvtaryvRltvtkratnawgasiaEl 122 +++++ry++l++t+++ ++ +as+aEl WCD79382.1|CBM32|CBM5 509 DTAQGRYLKLVATSSQDGKDNASVAEL 535 34579*******88876665599*998 PP == domain 2 score: 44.5 bits; conditional E-value: 9.9e-16 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd 86 +ss+ ag+ +a+ a+Dg+p ++Wssa g +++++dLg+ +++++++ + + + g ik y+v++ + + Wt +a+ + ++ WCD79382.1|CBM32|CBM5 555 TSSAIAGSAPAAHAIDGNPASYWSSAaGarypHQIVIDLGTDSRFSQLHYLPrqDAgQsGMIKGYQVYGGDSpNGGWTLLADGQ-FS- 640 3566778899***************742567999*****************98633567**********9644558**998764.33. PP CBM32.hmm 87 gt 88 g+ WCD79382.1|CBM32|CBM5 641 GD 642 22 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (983 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 144.56 // Query: WXL27087.1|CBM32|CBM5 [L=962] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-18 53.7 8.2 2.8e-15 43.1 0.9 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 11.0 0.0 2.4e-05 2.4e-05 93 123 .. 500 533 .. 438 534 .. 0.79 2 ! 43.1 0.9 2.8e-15 2.8e-15 9 89 .. 551 649 .. 545 692 .. 0.66 3 ? 1.9 0.3 0.016 0.016 24 74 .. 839 886 .. 803 917 .. 0.71 Alignments for each domain: == domain 1 score: 11.0 bits; conditional E-value: 2.4e-05 CBM32.hmm 93 tfd...kpvtaryvRltvtkratnawgasiaEla 123 f+ ++++ary+R++++++ ++++asiaEl+ WXL27087.1|CBM32|CBM5 500 AFAqkeETAKARYIRFVANSSIDGTPTASIAELH 533 4444456779********664466788*****97 PP == domain 2 score: 43.1 bits; conditional E-value: 2.8e-15 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd 86 ++s+aa+ ++ n++Dg+++++Ws+a + ++l++dLg++ +++++++ + ++ + g+ik y+v + + Wt +a +g+++ WXL27087.1|CBM32|CBM5 551 ATSAAAN-FPVGNILDGNTKSYWSTApEakypHQLIIDLGQESQFSQLHYLPrqDQgQnGNIKAYQVFTGNSaEGPWTLAA-EGEFNA 636 2455556.*****************752456999*****************98633556*********99763238*9655.556554 PP CBM32.hmm 87 .gt.........t 89 ++ + WXL27087.1|CBM32|CBM5 637 sNEvkstavkpaE 649 4445554443330 PP == domain 3 score: 1.9 bits; conditional E-value: 0.016 CBM32.hmm 24 DgdpntrWssagqwltvdLgkp.ttvdkvvltwaengrikdykvevStDgkt 74 D++ + rWs + +l ++ ++ ++++ ++t +++ +++k+evS+ +t WXL27087.1|CBM32|CBM5 839 DKSLSYRWSVSP-TLNFKASSEqLSFTAPTVT---QDTSYRFKLEVSNGQQT 886 555555776652.3666666442466666666...37799*******65533 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (962 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 63.57 // Query: WDH58571.1|CBM32|CBM5 [L=955] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-22 66.1 0.3 1.4e-16 47.3 0.0 3.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 12.1 0.0 1.1e-05 1.1e-05 95 123 .. 498 526 .. 471 527 .. 0.77 2 ! 47.3 0.0 1.4e-16 1.4e-16 10 88 .. 544 632 .. 540 680 .. 0.78 3 ? 2.4 0.0 0.011 0.011 48 109 .. 753 826 .. 702 846 .. 0.64 Alignments for each domain: == domain 1 score: 12.1 bits; conditional E-value: 1.1e-05 CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 +++v+aryvRl+++++ ++ gasiaEl+ WDH58571.1|CBM32|CBM5 498 NETVKARYVRLVANSSVDGKEGASIAELH 526 37899********554466799*****97 PP == domain 2 score: 47.3 bits; conditional E-value: 1.4e-16 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltw..aen..grikdykvevSt..DgktWttvaekgnttd 86 +ss+++g++ +n++Dg+p+++W+sa+ ++l++dLg++ +++++++ + +++ g+ikdy+v++ Dg Wt +a+ + ++ WDH58571.1|CBM32|CBM5 544 ASSTQAGSPGSNILDGNPKSYWASATgagypHQLVIDLGTESRFSQLHYLPrqDQGlsGNIKDYQVYGGAgpDG-PWTLLADGE-FSA 629 33445559****************74456799******************98533246*********9965578.9**998764.433 PP CBM32.hmm 87 .gt 88 ++ WDH58571.1|CBM32|CBM5 630 dNE 632 243 PP == domain 3 score: 2.4 bits; conditional E-value: 0.011 CBM32.hmm 48 vdkvvltwaen.grikdykvevSt...........DgktWttvaekgnttdgt........te..titfdkpvta.ryvRltvtk 109 ++v+ + + +++ ++ v++S+ gk W+++ + +i+ +++++a vRl +++ WDH58571.1|CBM32|CBM5 753 RNQVQHK---GrQYMARWWVQGSEpgnpnftgadgSGKVWKDLG--------PcdndtqvePPlpSINGATQAKAgEQVRLDASG 826 4555555...3478999999999944444444422245566664........233222222112366555445555999998833 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (955 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 112.48 // Query: XOB51250.1|CBM32|CBM5 [L=809] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-16 46.9 0.1 5.3e-13 35.7 0.0 2.7 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 8.3 0.0 0.00017 0.00017 96 122 .. 510 536 .. 481 538 .. 0.66 2 ! 35.7 0.0 5.3e-13 5.3e-13 20 94 .. 567 650 .. 553 668 .. 0.76 3 ? -3.3 0.0 0.63 0.63 62 79 .. 720 737 .. 694 749 .. 0.62 Alignments for each domain: == domain 1 score: 8.3 bits; conditional E-value: 0.00017 CBM32.hmm 96 kpvtaryvRltvtkratnawgasiaEl 122 ++ +ary+R+++t++ ++++ asiaEl XOB51250.1|CBM32|CBM5 510 ETSQARYLRFVATSSINGSNVASIAEL 536 44469*******7755666779***98 PP == domain 2 score: 35.7 bits; conditional E-value: 5.3e-13 CBM32.hmm 20 enavDgdpntrWssag....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd.gtte.titf 94 + vDg+p+++Wss++ +++++dLg+++ ++++++ + ++ g+ik y+v++ + + W +a kg+++ ++ + ++ + XOB51250.1|CBM32|CBM5 567 LWFVDGKPSSYWSSGSarypHEIIIDLGAERGFSSLNYLPrqNNdAaGNIKGYEVYGGDSpTSAWALLA-KGEFSAdNE-VkSVAL 650 568***********8456799*******************9534547***********763568*9997.555554343.223343 PP == domain 3 score: -3.3 bits; conditional E-value: 0.63 CBM32.hmm 62 kdykvevStDgktWttva 79 ++y++ S D+ + tt a XOB51250.1|CBM32|CBM5 720 TRYRFTLSVDNGQKTTTA 737 455555555544444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (809 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 120.21 // Query: WDH52630.1|CBM32|CBM5 [L=955] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-22 65.1 0.4 2.2e-16 46.7 0.0 3.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 12.1 0.0 1.1e-05 1.1e-05 95 123 .. 498 526 .. 471 527 .. 0.77 2 ! 46.7 0.0 2.2e-16 2.2e-16 10 88 .. 544 632 .. 540 684 .. 0.75 3 ? 2.2 0.0 0.012 0.012 49 109 .. 754 826 .. 702 846 .. 0.64 Alignments for each domain: == domain 1 score: 12.1 bits; conditional E-value: 1.1e-05 CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 +++v+aryvRl+++++ ++ gasiaEl+ WDH52630.1|CBM32|CBM5 498 NETVKARYVRLVANSSVDGKEGASIAELH 526 37899********554466799*****97 PP == domain 2 score: 46.7 bits; conditional E-value: 2.2e-16 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltw..aen..grikdykvevS..tDgktWttvaekgnttd 86 +ss+++g + +n++Dg+p+++W+sa+ ++l++dLg++ +++++++ + +++ g+ikdy+v++ Dg Wt +a+ + ++ WDH52630.1|CBM32|CBM5 544 ASSTQAGLPGSNILDGNPKSYWASATgagypHQLVIDLGTESRFSQLHYLPrqDQGlsGNIKDYQVYGGagLDG-PWTLLADGE-FSA 629 33445559****************74456799******************98533246*********8833599.9**999764.433 PP CBM32.hmm 87 .gt 88 ++ WDH52630.1|CBM32|CBM5 630 dNE 632 243 PP == domain 3 score: 2.2 bits; conditional E-value: 0.012 CBM32.hmm 49 dkvvltwaen.grikdykvevSt...........DgktWttvaekgnttdgt........te..titfdkpvta.ryvRltvtk 109 ++v+ + + +++ ++ v++S+ gk W+++ + +i+ +++++a vRl +++ WDH52630.1|CBM32|CBM5 754 NQVQHK---GrQYMARWWVQGSEpgnpnftgadgSGKVWKDLG--------PcdndtqvePPlpSINGATQAKAgEQVRLDASG 826 344444...3478999999999944444444422245566664........233222222112366555445555999998833 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (955 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 115.88 // Query: BCD84509.1|CBM32|CBM5 [L=975] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-19 55.1 0.0 1.7e-15 43.8 0.0 3.1 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 7.6 0.0 0.00028 0.00028 95 123 .. 507 538 .. 486 539 .. 0.68 2 ! 43.8 0.0 1.7e-15 1.7e-15 14 89 .. 558 648 .. 553 694 .. 0.72 3 ? -2.1 0.0 0.28 0.28 72 108 .. 796 843 .. 792 863 .. 0.56 Alignments for each domain: == domain 1 score: 7.6 bits; conditional E-value: 0.00028 CBM32.hmm 95 d...kpvtaryvRltvtkra.tnawgasiaEla 123 + ++v+ary+Rl++++ a + +asi+El+ BCD84509.1|CBM32|CBM5 507 SrkqDTVEARYLRLVAKS-AiDGGQAASISELH 538 33335789********44.3455677*****97 PP == domain 2 score: 43.8 bits; conditional E-value: 1.7e-15 CBM32.hmm 14 aggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltw..aen..grikdykvevSt..DgktWttvaekgnttd.gt. 88 +g +++ena+Dg +nt+W s++ ++++dLg+p +++++++ + a++ g+ikdy+v + + Dg +Wt +ae ++t + BCD84509.1|CBM32|CBM5 558 KG-YKPENAIDGGTNTYWYSSSkenypYDFVIDLGAPERFSQLHYLPrqASGlfGNIKDYEVHAGDrpDG-DWTLLAEG-QFTAdNLv 642 34.99*************99633445778*****************98533347***********86678.***99865.44432334 PP CBM32.hmm 89 .....t 89 + BCD84509.1|CBM32|CBM5 643 klaslK 648 333330 PP == domain 3 score: -2.1 bits; conditional E-value: 0.28 CBM32.hmm 72 gktWttvae.kgnttd.gt.......te.titfdkpvta.ryvRltvt 108 gk W+++ + +g+ t+ ++ ++ +i+ ++ +ta vRl + BCD84509.1|CBM32|CBM5 796 GKVWRDLGAcSGTGTEtPEnppavlpPVaRISGPSMATAgSEVRLSAA 843 788999965455444333345544432346655533344488998882 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (975 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 130.09 // Query: XHY65679.1|CBM32|CBM5 [L=810] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-17 48.2 0.0 1.9e-13 37.2 0.0 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 8.3 0.0 0.00017 0.00017 93 122 .. 507 536 .. 478 538 .. 0.66 2 ! 37.2 0.0 1.9e-13 1.9e-13 20 98 .. 567 653 .. 553 666 .. 0.76 Alignments for each domain: == domain 1 score: 8.3 bits; conditional E-value: 0.00017 CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEl 122 + +++ +ary+R+++t++ +++ asiaEl XHY65679.1|CBM32|CBM5 507 KTQETSQARYLRFVATSSINGSKVASIAEL 536 33345569*******7755666669***98 PP == domain 2 score: 37.2 bits; conditional E-value: 1.9e-13 CBM32.hmm 20 enavDgdpntrWssag....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd.gtte.titfdk 96 + vDg+pn++Wss++ +++++dLg+++ ++++++ + ++ g+ik y+v++ + + W +a kg+++ ++ + ++ ++ XHY65679.1|CBM32|CBM5 567 LWFVDGKPNSYWSSGSasypHEIIIDLGAERGFSSLNYLPrqNNdAaGNIKGYEVYGGDSpTSAWALLA-KGEFSAdNE-VkSVALK- 651 568***********7445799*******************9534547***********763568**998.556554343.2233433. PP CBM32.hmm 97 pv 98 pv XHY65679.1|CBM32|CBM5 652 PV 653 55 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (810 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 125.43 // Query: WQE17828.1|CBM32|CBM5 [L=955] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-22 66.1 0.3 1.4e-16 47.3 0.0 3.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 12.1 0.0 1.1e-05 1.1e-05 95 123 .. 498 526 .. 471 527 .. 0.77 2 ! 47.3 0.0 1.4e-16 1.4e-16 10 88 .. 544 632 .. 540 680 .. 0.78 3 ? 2.4 0.0 0.011 0.011 48 109 .. 753 826 .. 702 846 .. 0.64 Alignments for each domain: == domain 1 score: 12.1 bits; conditional E-value: 1.1e-05 CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 +++v+aryvRl+++++ ++ gasiaEl+ WQE17828.1|CBM32|CBM5 498 NETVKARYVRLVANSSVDGKEGASIAELH 526 37899********554466799*****97 PP == domain 2 score: 47.3 bits; conditional E-value: 1.4e-16 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltw..aen..grikdykvevSt..DgktWttvaekgnttd 86 +ss+++g++ +n++Dg+p+++W+sa+ ++l++dLg++ +++++++ + +++ g+ikdy+v++ Dg Wt +a+ + ++ WQE17828.1|CBM32|CBM5 544 ASSTQAGSPGSNILDGNPKSYWASATgagypHQLVIDLGTESRFSQLHYLPrqDQGlsGNIKDYQVYGGAgpDG-PWTLLADGE-FSA 629 33445559****************74456799******************98533246*********9965578.9**998764.433 PP CBM32.hmm 87 .gt 88 ++ WQE17828.1|CBM32|CBM5 630 dNE 632 243 PP == domain 3 score: 2.4 bits; conditional E-value: 0.011 CBM32.hmm 48 vdkvvltwaen.grikdykvevSt...........DgktWttvaekgnttdgt........te..titfdkpvta.ryvRltvtk 109 ++v+ + + +++ ++ v++S+ gk W+++ + +i+ +++++a vRl +++ WQE17828.1|CBM32|CBM5 753 RNQVQHK---GrQYMARWWVQGSEpgnpnftgadgSGKVWKDLG--------PcdndtqvePPlpSINGATQAKAgEQVRLDASG 826 4555555...3478999999999944444444422245566664........233222222112366555445555999998833 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (955 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 113.01 // Query: WYD96146.1|CBM32|CBM5 [L=1069] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-18 53.4 0.3 2.5e-16 46.5 0.1 2.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.6 0.0 0.0048 0.0048 94 122 .. 505 534 .. 458 536 .. 0.72 2 ! 46.5 0.1 2.5e-16 2.5e-16 9 92 .. 554 644 .. 548 670 .. 0.76 Alignments for each domain: == domain 1 score: 3.6 bits; conditional E-value: 0.0048 CBM32.hmm 94 fd.kpvtaryvRltvtkratnawgasiaEl 122 ++ +++++ry+++++t+ ++ +as+aEl WYD96146.1|CBM32|CBM5 505 LTqDTAQGRYLKFVATSAVDGKDTASVAEL 534 44345679*******774455555999997 PP == domain 2 score: 46.5 bits; conditional E-value: 2.5e-16 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd 86 +ss+ +g+ + a+Dg+pn++Ws++ g +++ +dLg+ +++++++ + + g+ik y+v++S+ + Wt +a+ +++ WYD96146.1|CBM32|CBM5 554 TSSAVPGTAVGNHAIDGNPNSYWSTTaGarypHEILIDLGADSRFSQLHYLPrqDAgLsGNIKGYQVYGSNSaNGAWTLLADG-EFSA 640 45666787889**************74256799******************98522325***********754569**99976.4433 PP CBM32.hmm 87 .gtteti 92 ++ i WYD96146.1|CBM32|CBM5 641 dND---I 644 244...2 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1069 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 58.78 // Query: XAY12894.1|CBM32|CBM5 [L=974] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-18 53.9 0.0 1.4e-16 47.3 0.0 2.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.3 0.0 0.0057 0.0057 96 123 .. 509 536 .. 480 537 .. 0.73 2 ! 47.3 0.0 1.4e-16 1.4e-16 14 89 .. 560 649 .. 551 698 .. 0.70 Alignments for each domain: == domain 1 score: 3.3 bits; conditional E-value: 0.0057 CBM32.hmm 96 kpvtaryvRltvtkratnawgasiaEla 123 ++++ary++l+++++ ++ as+aEl+ XAY12894.1|CBM32|CBM5 509 DTAQARYLKLVAESSIDGKERASAAELH 536 45679*******5544556669999987 PP == domain 2 score: 47.3 bits; conditional E-value: 1.4e-16 CBM32.hmm 14 aggggaenavDgdpntrWss..ag...qwltvdLgkpttvdkvvltw.ae..n.grikdykvevStD.gktWttvaekgnttd.gt.. 88 +++ + + a+Dg+++++W + ++ +++++dLg++++++++++ + + g+ik y++++S++ + +Wt + +g+++ ++ XAY12894.1|CBM32|CBM5 560 PASASGAHAIDGNTSSYWTTvpGDrypHQMVIDLGGEQRFSSLNYLPqQVrdMeGNIKGYRIYGSDNpNGNWTLLG-QGEFSAsNEaq 646 4447789************9652256899*****************96324435***********87667***997.44554434444 PP CBM32.hmm 89 ..t 89 + XAY12894.1|CBM32|CBM5 647 aaP 649 440 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (974 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 136.50 // Query: UVL71864.1|CBM32|CBM5 [L=966] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-18 52.2 1.1 1.4e-15 44.1 0.5 3.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.2 0.0 0.026 0.026 17 108 .. 321 438 .. 305 461 .. 0.62 2 ! 2.8 0.0 0.0084 0.0084 97 123 .. 510 536 .. 488 537 .. 0.79 3 ! 44.1 0.5 1.4e-15 1.4e-15 8 94 .. 554 650 .. 549 671 .. 0.77 Alignments for each domain: == domain 1 score: 1.2 bits; conditional E-value: 0.026 CBM32.hmm 17 ggaenavDgdpntrWss...........ag..........qwltvdLgkpttvdkvvltwae.n.grikdykvevS.tDgktWttvae 80 g + +Dg++n r+ ++ l v Lg ++t + +++ + n +i+ y +v D ++ t+ e UVL71864.1|CBM32|CBM5 321 IGGSHCNDGNDNYRFGHnngrvgtilcgNHvgyfsnpdlkDHLGVPLGDARTANMARVW--ReNaAKISAYAPSVVpLDSENLITILE 406 5567778887774433324333334333103334444555569999**********999..434577888888887789999999955 PP CBM32.hmm 81 kg.nttdgttetitfdkpvtaryvRltv...t 108 + n+ +g+t+++++d p+ ++ + +tv t UVL71864.1|CBM32|CBM5 407 ERvNQAKGQTRYFPLDVPAGTQRLAFTVvpgT 438 44366544434667776666688888885332 PP == domain 2 score: 2.8 bits; conditional E-value: 0.0084 CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEla 123 +++++y++l++t++ ++++asiaEl+ UVL71864.1|CBM32|CBM5 510 TAQGTYLKLVATSSVDGKNNASIAELM 536 45689******775566677*****85 PP == domain 3 score: 44.1 bits; conditional E-value: 1.4e-15 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgntt 85 ++ss a+g+ + +n++D++pn++Wssa +++++d+g++ +++++++ + ++ + g+ik y+v+ S + W +a+ +++ UVL71864.1|CBM32|CBM5 554 STSSVASGTTSGSNVLDDNPNSYWSSAAdarypHQIVIDMGSNNSFSQLRYLPrqDQgQaGNIKGYQVYSSHSfNGPWSLLADG-EFS 640 34677788899***************733567999*****************98533568***********644559**99876.443 PP CBM32.hmm 86 d.gtteti.tf 94 ++ +++ ++ UVL71864.1|CBM32|CBM5 641 AdNQ-VKVtSL 650 3243.222233 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (966 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 114.90 // Query: UZE34139.1|CBM32|CBM5 [L=810] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-17 48.2 0.0 1.9e-13 37.2 0.0 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 8.3 0.0 0.00017 0.00017 93 122 .. 507 536 .. 478 538 .. 0.66 2 ! 37.2 0.0 1.9e-13 1.9e-13 20 98 .. 567 653 .. 553 666 .. 0.76 Alignments for each domain: == domain 1 score: 8.3 bits; conditional E-value: 0.00017 CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEl 122 + +++ +ary+R+++t++ +++ asiaEl UZE34139.1|CBM32|CBM5 507 KTQETSQARYLRFVATSSINGSKVASIAEL 536 33345569*******7755666669***98 PP == domain 2 score: 37.2 bits; conditional E-value: 1.9e-13 CBM32.hmm 20 enavDgdpntrWssag....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd.gtte.titfdk 96 + vDg+pn++Wss++ +++++dLg+++ ++++++ + ++ g+ik y+v++ + + W +a kg+++ ++ + ++ ++ UZE34139.1|CBM32|CBM5 567 LWFVDGKPNSYWSSGSasypHEIIIDLGAERGFSSLNYLPrqNNdAaGNIKGYEVYGGDSpTSAWALLA-KGEFSAdNE-VkSVALK- 651 568***********7445799*******************9534547***********763568**998.556554343.2233433. PP CBM32.hmm 97 pv 98 pv UZE34139.1|CBM32|CBM5 652 PV 653 55 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (810 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 128.44 // Query: WDG56917.1|CBM32|CBM5 [L=955] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-22 65.9 0.3 1.4e-16 47.3 0.0 3.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 12.1 0.0 1.1e-05 1.1e-05 95 123 .. 498 526 .. 471 527 .. 0.77 2 ! 47.3 0.0 1.4e-16 1.4e-16 10 88 .. 544 632 .. 540 680 .. 0.78 3 ? 2.2 0.0 0.012 0.012 49 109 .. 754 826 .. 702 846 .. 0.64 Alignments for each domain: == domain 1 score: 12.1 bits; conditional E-value: 1.1e-05 CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 +++v+aryvRl+++++ ++ gasiaEl+ WDG56917.1|CBM32|CBM5 498 NETVKARYVRLVANSSVDGKEGASIAELH 526 37899********554466799*****97 PP == domain 2 score: 47.3 bits; conditional E-value: 1.4e-16 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltw..aen..grikdykvevSt..DgktWttvaekgnttd 86 +ss+++g++ +n++Dg+p+++W+sa+ ++l++dLg++ +++++++ + +++ g+ikdy+v++ Dg Wt +a+ + ++ WDG56917.1|CBM32|CBM5 544 ASSTQAGSPGSNILDGNPKSYWASATgagypHQLVIDLGTESRFSQLHYLPrqDQGlsGNIKDYQVYGGAgpDG-PWTLLADGE-FSA 629 33445559****************74456799******************98533246*********9965578.9**998764.433 PP CBM32.hmm 87 .gt 88 ++ WDG56917.1|CBM32|CBM5 630 dNE 632 243 PP == domain 3 score: 2.2 bits; conditional E-value: 0.012 CBM32.hmm 49 dkvvltwaen.grikdykvevSt...........DgktWttvaekgnttdgt........te..titfdkpvta.ryvRltvtk 109 ++v+ + + +++ ++ v++S+ gk W+++ + +i+ +++++a vRl +++ WDG56917.1|CBM32|CBM5 754 NQVQHK---GrQYMARWWVQGSEpgnpnftgadgSGKVWKDLG--------PcdndtqvePPlpSINGATQAKAgEQVRLDASG 826 344444...3478999999999944444444422245566664........233222222112366555445555999998833 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (955 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 131.62 // Query: XPA99427.1|CBM32|CBM5 [L=809] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-16 46.9 0.1 4.5e-13 36.0 0.0 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 8.3 0.0 0.00017 0.00017 96 122 .. 510 536 .. 481 538 .. 0.66 2 ! 36.0 0.0 4.5e-13 4.5e-13 20 98 .. 567 653 .. 553 666 .. 0.76 Alignments for each domain: == domain 1 score: 8.3 bits; conditional E-value: 0.00017 CBM32.hmm 96 kpvtaryvRltvtkratnawgasiaEl 122 ++ +ary+R+++t++ ++++ asiaEl XPA99427.1|CBM32|CBM5 510 ETSQARYLRFVATSSINGSNVASIAEL 536 44469*******7755666779***98 PP == domain 2 score: 36.0 bits; conditional E-value: 4.5e-13 CBM32.hmm 20 enavDgdpntrWssag....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd.gtte.titfdk 96 + vDg+p+++Wss++ +++++dLg+++ ++++++ + ++ g+ik y+v++ + + W +a kg+++ ++ + ++ ++ XPA99427.1|CBM32|CBM5 567 LWFVDGKPSSYWSSGSarypHEIIIDLGAERGFSSLNYLPrqNNdAaGNIKGYEVYGGDSpTSAWALLA-KGEFSAdNE-VkSVALK- 651 568***********8456799*******************9534547***********763568**998.556554343.2233433. PP CBM32.hmm 97 pv 98 pv XPA99427.1|CBM32|CBM5 652 PV 653 55 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (809 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.48 // Query: ULT71563.1|CBM32|CBM5 [L=809] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-16 47.3 0.1 5.3e-13 35.7 0.0 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 8.3 0.0 0.00017 0.00017 96 122 .. 510 536 .. 481 538 .. 0.66 2 ! 35.7 0.0 5.3e-13 5.3e-13 20 94 .. 567 650 .. 553 670 .. 0.76 3 ? -2.0 0.0 0.26 0.26 46 80 .. 709 738 .. 684 751 .. 0.58 Alignments for each domain: == domain 1 score: 8.3 bits; conditional E-value: 0.00017 CBM32.hmm 96 kpvtaryvRltvtkratnawgasiaEl 122 ++ +ary+R+++t++ ++++ asiaEl ULT71563.1|CBM32|CBM5 510 ETSQARYLRFVATSSINGSNVASIAEL 536 44469*******7755666779***98 PP == domain 2 score: 35.7 bits; conditional E-value: 5.3e-13 CBM32.hmm 20 enavDgdpntrWssag....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd.gtte.titf 94 + vDg+p+++Wss++ +++++dLg+++ ++++++ + ++ g+ik y+v++ + + W +a kg+++ ++ + ++ + ULT71563.1|CBM32|CBM5 567 LWFVDGKPSSYWSSGSarypHEIIIDLGAERGFSSLNYLPrqNNdAaGNIKGYEVYGGDSpTSAWALLA-KGEFSAdNE-VkSVAL 650 568***********8456799*******************9534547***********763568*9998.556554343.223343 PP == domain 3 score: -2.0 bits; conditional E-value: 0.26 CBM32.hmm 46 ttvdkvvltwaengrikdykvevStDgktWttvae 80 ++++ +l+ + ++y++ S D+ + tt ae ULT71563.1|CBM32|CBM5 709 ISFSAPRLK--Q---DTRYRFTLSVDNGQKTTTAE 738 444444444..2...34666666666555555543 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (809 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 136.59 // Query: WYD96145.1|CBM32|CBM5 [L=809] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-17 48.3 0.0 1.9e-13 37.2 0.0 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 8.3 0.0 0.00017 0.00017 93 122 .. 507 536 .. 477 538 .. 0.66 2 ! 37.2 0.0 1.9e-13 1.9e-13 20 98 .. 567 653 .. 553 666 .. 0.76 Alignments for each domain: == domain 1 score: 8.3 bits; conditional E-value: 0.00017 CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEl 122 + +++ +ary+R+++t++ +++ asiaEl WYD96145.1|CBM32|CBM5 507 KTQETSQARYLRFVATSSINGSKVASIAEL 536 33345569*******7755666669***98 PP == domain 2 score: 37.2 bits; conditional E-value: 1.9e-13 CBM32.hmm 20 enavDgdpntrWssag....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd.gtte.titfdk 96 + vDg+pn++Wss++ +++++dLg+++ ++++++ + ++ g+ik y+v++ + + W +a kg+++ ++ + ++ ++ WYD96145.1|CBM32|CBM5 567 LWFVDGKPNSYWSSGSasypHEIIIDLGAERGFSSLNYLPrqNNdAaGNIKGYEVYGGDSpTSAWALLA-KGEFSAdNE-VkSVALK- 651 568***********7445799*******************9534547***********763568**998.556554343.2233433. PP CBM32.hmm 97 pv 98 pv WYD96145.1|CBM32|CBM5 652 PV 653 55 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (809 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 148.28 // Query: ULT71562.1|CBM32|CBM5 [L=1068] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-18 52.4 0.1 6.7e-16 45.1 0.1 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 4.3 0.0 0.0029 0.0029 93 122 .. 503 533 .. 442 535 .. 0.70 2 ! 45.1 0.1 6.7e-16 6.7e-16 9 88 .. 553 642 .. 546 671 .. 0.76 Alignments for each domain: == domain 1 score: 4.3 bits; conditional E-value: 0.0029 CBM32.hmm 93 tfd.kpvtaryvRltvtkratnawgasiaEl 122 ++ +++++ry+++++t+ ++ +as+aEl ULT71562.1|CBM32|CBM5 503 GLTqDTAQGRYLKFVATSAVDGKDNASVAEL 533 344345679*******775455555999997 PP == domain 2 score: 45.1 bits; conditional E-value: 6.7e-16 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd 86 +ss+ +g + a+Dg+pn++Ws+a g +++ +dLg+ +++++++ + + g+ik y+v++S+ + Wt +a+ +++ ULT71562.1|CBM32|CBM5 553 TSSAVPGAAVGNHAIDGNPNSYWSTAaGarypHEILIDLGADSRFSQLHYLPrqDAgLsGNIKGYQVYGSSSaNGAWTLLADG-EFSA 639 45566777889**************74256799******************98522325***********54366***99976.4433 PP CBM32.hmm 87 .gt 88 ++ ULT71562.1|CBM32|CBM5 640 dNE 642 233 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1068 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 158.51 // Query: XKL26808.1|CBM32|CBM5 [L=1048] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-18 52.3 0.0 1.8e-15 43.7 0.0 2.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.4 0.0 0.0013 0.0013 95 122 .. 488 515 .. 460 517 .. 0.74 2 ! 43.7 0.0 1.8e-15 1.8e-15 10 87 .. 535 621 .. 529 640 .. 0.76 Alignments for each domain: == domain 1 score: 5.4 bits; conditional E-value: 0.0013 CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEl 122 ++ v+ary++l++t+ ++ gas+aEl XKL26808.1|CBM32|CBM5 488 NESVQARYLKLVATSAVDGKDGASVAEL 515 46789********7755667889**998 PP == domain 2 score: 43.7 bits; conditional E-value: 1.8e-15 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd. 86 +ssa + g+ + a+Dg+p+++W sa g +++++dLg+ +++++++ + ++ + g+ik y+v++S+ W +a+ + ++ XKL26808.1|CBM32|CBM5 535 TSSAVA-GSGAHAIDGNPKSYWNSAaGarypHEIVIDLGADSRFSQLHYLPrqDGgQaGNIKGYQVYGSNSpSGVWSLLADGE-FSAd 620 333334.789**************74256799******************98534668***********874449*9998664.3332 PP CBM32.hmm 87 g 87 + XKL26808.1|CBM32|CBM5 621 N 621 3 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1048 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 165.79 // Query: XBY63135.1|CBM32|CBM5 [L=975] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-19 54.5 0.1 2.2e-15 43.4 0.0 3.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 7.6 0.0 0.00028 0.00028 95 123 .. 507 538 .. 486 539 .. 0.68 2 ! 43.4 0.0 2.2e-15 2.2e-15 14 87 .. 558 640 .. 553 693 .. 0.75 3 ? -2.3 0.0 0.31 0.31 72 109 .. 796 844 .. 793 906 .. 0.57 Alignments for each domain: == domain 1 score: 7.6 bits; conditional E-value: 0.00028 CBM32.hmm 95 d...kpvtaryvRltvtkra.tnawgasiaEla 123 + ++v+ary+Rl++++ a + +asi+El+ XBY63135.1|CBM32|CBM5 507 SrkqDTVEARYLRLVAKS-AiDGGQAASISELH 538 33335789********44.3455677*****97 PP == domain 2 score: 43.4 bits; conditional E-value: 2.2e-15 CBM32.hmm 14 aggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltw..aen..grikdykvevSt..DgktWttvaekgnttd.g 87 +g +++ena+Dg +nt+W s++ ++++dLg+p +++++++ + a + g+ikdy+v + + Dg +Wt +ae ++t + XBY63135.1|CBM32|CBM5 558 KG-YKPENAIDGGTNTYWYSSSkenypYDFVIDLGAPERFSQLHYLPrqAAGlfGNIKDYEVHAGDrpDG-DWTLLAEG-QFTAdN 640 34.99*************99633445778*****************98533347***********86678.***99865.444323 PP == domain 3 score: -2.3 bits; conditional E-value: 0.31 CBM32.hmm 72 gktWttvae.kgnttd.gt.......te.titfdkpvta.ryvRltvtk 109 gk W+++ + +g t+ ++ ++ +i+ ++ +ta vRl + + XBY63135.1|CBM32|CBM5 796 GKVWRDLGAcSGAGTEtPEnppavlpPVaRISGPSMATAgSEVRLSAAA 844 5667766543443222222344333212345444223333777776622 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (975 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 147.38 // Query: XKL45185.1|CBM32|CBM5 [L=810] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-17 48.2 0.0 1.9e-13 37.2 0.0 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 8.3 0.0 0.00017 0.00017 93 122 .. 507 536 .. 478 538 .. 0.66 2 ! 37.2 0.0 1.9e-13 1.9e-13 20 98 .. 567 653 .. 553 666 .. 0.76 Alignments for each domain: == domain 1 score: 8.3 bits; conditional E-value: 0.00017 CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEl 122 + +++ +ary+R+++t++ +++ asiaEl XKL45185.1|CBM32|CBM5 507 KTQETSQARYLRFVATSSINGSKVASIAEL 536 33345569*******7755666669***98 PP == domain 2 score: 37.2 bits; conditional E-value: 1.9e-13 CBM32.hmm 20 enavDgdpntrWssag....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd.gtte.titfdk 96 + vDg+pn++Wss++ +++++dLg+++ ++++++ + ++ g+ik y+v++ + + W +a kg+++ ++ + ++ ++ XKL45185.1|CBM32|CBM5 567 LWFVDGKPNSYWSSGSasypHEIIIDLGAERGFSSLNYLPrqNNdAaGNIKGYEVYGGDSpTSAWALLA-KGEFSAdNE-VkSVALK- 651 568***********7445799*******************9534547***********763568**998.556554343.2233433. PP CBM32.hmm 97 pv 98 pv XKL45185.1|CBM32|CBM5 652 PV 653 55 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (810 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 149.03 // Query: WPO46780.1|CBM32|CBM5 [L=955] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-22 66.3 0.3 1.4e-16 47.3 0.0 3.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 12.1 0.0 1.1e-05 1.1e-05 95 123 .. 498 526 .. 471 527 .. 0.77 2 ! 47.3 0.0 1.4e-16 1.4e-16 10 88 .. 544 632 .. 540 680 .. 0.78 3 ! 2.7 0.0 0.0087 0.0087 49 109 .. 754 826 .. 702 846 .. 0.65 Alignments for each domain: == domain 1 score: 12.1 bits; conditional E-value: 1.1e-05 CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 +++v+aryvRl+++++ ++ gasiaEl+ WPO46780.1|CBM32|CBM5 498 NETVKARYVRLVANSSVDGKEGASIAELH 526 37899********554466799*****97 PP == domain 2 score: 47.3 bits; conditional E-value: 1.4e-16 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltw..aen..grikdykvevSt..DgktWttvaekgnttd 86 +ss+++g++ +n++Dg+p+++W+sa+ ++l++dLg++ +++++++ + +++ g+ikdy+v++ Dg Wt +a+ + ++ WPO46780.1|CBM32|CBM5 544 ASSTQAGSPGSNILDGNPKSYWASATgagypHQLVIDLGTESRFSQLHYLPrqDQGlsGNIKDYQVYGGAgpDG-PWTLLADGE-FSA 629 33445559****************74456799******************98533246*********9965578.9**998764.433 PP CBM32.hmm 87 .gt 88 ++ WPO46780.1|CBM32|CBM5 630 dNE 632 243 PP == domain 3 score: 2.7 bits; conditional E-value: 0.0087 CBM32.hmm 49 dkvvltwaen.grikdykvevSt...........DgktWttvaekgnttdgt........te..titfd.kpvtaryvRltvtk 109 +kv+ + + +++ ++ v++S+ gk W+++ + +i+ + ++ t+ vRl +++ WPO46780.1|CBM32|CBM5 754 NKVQHK---GrQYMARWWVQGSEpgnpnftgadgSGKVWKDLG--------PcdndtqvePPlpSINGAtQAKTGEQVRLDASG 826 445555...3478999999999944444444422245566664........233222222112366555577778999999843 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (955 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 139.52 // Query: UZE34140.1|CBM32|CBM5 [L=1069] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-18 53.6 0.1 3.9e-16 45.9 0.0 2.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 4.5 0.0 0.0024 0.0024 93 122 .. 504 534 .. 458 536 .. 0.72 2 ! 45.9 0.0 3.9e-16 3.9e-16 9 92 .. 554 644 .. 548 676 .. 0.76 Alignments for each domain: == domain 1 score: 4.5 bits; conditional E-value: 0.0024 CBM32.hmm 93 tfd.kpvtaryvRltvtkratnawgasiaEl 122 ++ +++++ry+++++t+ ++ +as+aEl UZE34140.1|CBM32|CBM5 504 GLTqDTTQGRYLKFVATSAVDGKDNASVAEL 534 444345569*******775455555999997 PP == domain 2 score: 45.9 bits; conditional E-value: 3.9e-16 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd 86 +ss+ +g + a+Dg+pn++Ws+a g +++ +dLg+ +++++++ + + g+ik y+v++S+ + Wt +a+ +++ UZE34140.1|CBM32|CBM5 554 TSSAVPGAAVGNHAIDGNPNSYWSTAaGarypHEILIDLGADSRFSQLHYLPrqDAgLsGNIKGYQVYGSNSaNGAWTLLADG-EFSA 640 345566768899*************74256799******************98522325***********754569**99976.4433 PP CBM32.hmm 87 .gtteti 92 ++ i UZE34140.1|CBM32|CBM5 641 dND---I 644 244...2 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1069 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 63.39 // Query: WAG80136.1|CBM32|CBM5 [L=976] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-17 50.1 0.0 3.4e-15 42.8 0.0 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 4.3 0.0 0.0029 0.0029 97 122 .. 510 535 .. 492 537 .. 0.76 2 ! 42.8 0.0 3.4e-15 3.4e-15 10 87 .. 556 643 .. 551 666 .. 0.74 Alignments for each domain: == domain 1 score: 4.3 bits; conditional E-value: 0.0029 CBM32.hmm 97 pvtaryvRltvtkratnawgasiaEl 122 ++ary+Rl++t++ ++ as+aEl WAG80136.1|CBM32|CBM5 510 HAKARYLRLVATSSIDGKALASAAEL 535 4689*******775555555888887 PP == domain 2 score: 42.8 bits; conditional E-value: 3.4e-15 CBM32.hmm 10 sssaaggggaenavDgdpntrWss...ag..qwltvdLgkpttvdkvvltw.ae.n..grikdykvevStD.gktWttvaekgnttd. 86 ss++a+++g + a+Dg +n++W + a +++++dLg++++++++++ + + + g+ik y++++S+ +W + e ++ WAG80136.1|CBM32|CBM5 556 SSANAASEGGSHAIDGRANSYWTTvpgAAypHEMVIDLGAEQRFSQLHYLPqQVrGleGNIKGYRIYGSDSpTGDWSLLGEG-EFAAt 642 333445599**************9654115999*****************96324246***********764349*999754.44332 PP CBM32.hmm 87 g 87 + WAG80136.1|CBM32|CBM5 643 N 643 3 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (976 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 145.89 // Query: XPB46504.1|CBM32|CBM5 [L=809] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-16 46.9 0.1 4.5e-13 36.0 0.0 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 8.3 0.0 0.00017 0.00017 96 122 .. 510 536 .. 481 538 .. 0.66 2 ! 36.0 0.0 4.5e-13 4.5e-13 20 98 .. 567 653 .. 553 666 .. 0.76 Alignments for each domain: == domain 1 score: 8.3 bits; conditional E-value: 0.00017 CBM32.hmm 96 kpvtaryvRltvtkratnawgasiaEl 122 ++ +ary+R+++t++ ++++ asiaEl XPB46504.1|CBM32|CBM5 510 ETSQARYLRFVATSSINGSNVASIAEL 536 44469*******7755666779***98 PP == domain 2 score: 36.0 bits; conditional E-value: 4.5e-13 CBM32.hmm 20 enavDgdpntrWssag....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd.gtte.titfdk 96 + vDg+p+++Wss++ +++++dLg+++ ++++++ + ++ g+ik y+v++ + + W +a kg+++ ++ + ++ ++ XPB46504.1|CBM32|CBM5 567 LWFVDGKPSSYWSSGSarypHEIIIDLGAERGFSSLNYLPrqNNdAaGNIKGYEVYGGDSpTSAWALLA-KGEFSAdNE-VkSVALK- 651 568***********8456799*******************9534547***********763568**998.556554343.2233433. PP CBM32.hmm 97 pv 98 pv XPB46504.1|CBM32|CBM5 652 PV 653 55 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (809 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.80 // Query: WOE78845.1|CBM32|CBM5 [L=1073] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-16 47.7 0.1 8.6e-15 41.5 0.0 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.1 0.0 0.0069 0.0069 95 122 .. 511 538 .. 484 540 .. 0.73 2 ! 41.5 0.0 8.6e-15 8.6e-15 10 94 .. 559 653 .. 554 682 .. 0.75 Alignments for each domain: == domain 1 score: 3.1 bits; conditional E-value: 0.0069 CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEl 122 +++++ary++l++++ ++ +as+aEl WOE78845.1|CBM32|CBM5 511 SETAQARYLKLVAISAVDGKDTASVAEL 538 356789*******774454555999997 PP == domain 2 score: 41.5 bits; conditional E-value: 8.6e-15 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..aen..grikdykvevStD.gktWttvaekgnttd. 86 ss+ +g+ + + a+Dg+p+++Wssa g +++ +dLg+ +++++++ + + + g+ik y+v++S+ W+ +a+ + ++ WOE78845.1|CBM32|CBM5 559 SSAGTGSVTGAQAIDGNPKSYWSSAvGarypHEMLIDLGADSRFSQLHYLPrqDAGlaGNIKGYQVYGSDSqSGAWNLLADGE-FNAd 645 3444455779**************752467999*****************98522336***********653449**999764.3332 PP CBM32.hmm 87 gtteti.tf 94 ++ +++ ++ WOE78845.1|CBM32|CBM5 646 NQ-VKVaSL 653 33.233343 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1073 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 134.38 // Query: WDH34691.1|CBM32|CBM5 [L=955] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-22 65.8 0.7 1.2e-16 47.5 0.0 3.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 12.1 0.0 1.1e-05 1.1e-05 95 123 .. 498 526 .. 471 527 .. 0.77 2 ! 47.5 0.0 1.2e-16 1.2e-16 10 88 .. 544 632 .. 540 684 .. 0.75 3 ? 2.3 0.0 0.012 0.012 49 109 .. 754 826 .. 702 849 .. 0.64 Alignments for each domain: == domain 1 score: 12.1 bits; conditional E-value: 1.1e-05 CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 +++v+aryvRl+++++ ++ gasiaEl+ WDH34691.1|CBM32|CBM5 498 NETVKARYVRLVANSSVDGKEGASIAELH 526 37899********554466799*****97 PP == domain 2 score: 47.5 bits; conditional E-value: 1.2e-16 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltw..aen..grikdykvevSt..DgktWttvaekgnttd 86 +ss+++g++ +n++Dg+p+++W+sa+ ++l++dLg++ +++++++ + +++ g+ikdy+v++ Dg Wt +a+ + ++ WDH34691.1|CBM32|CBM5 544 ASSTQAGSPGSNILDGNPKSYWASATgagypHQLVIDLGTESRFSQLHYLPrqDQGlsGNIKDYQVYGGAgpDG-PWTLLADGE-FSA 629 33445559****************74456799******************98533246*********9965578.9**998764.433 PP CBM32.hmm 87 .gt 88 ++ WDH34691.1|CBM32|CBM5 630 dNE 632 243 PP == domain 3 score: 2.3 bits; conditional E-value: 0.012 CBM32.hmm 49 dkvvltwaen.grikdykvevSt...........DgktWttvaekgnttdgt........te..titfdkpvta.ryvRltvtk 109 ++v+ + + +++ ++ v++S+ gk W+++ + +i+ +++++a vRl +++ WDH34691.1|CBM32|CBM5 754 NQVQHK---GrQYMARWWVQGSEpgnpnftgadgSGKVWKDLG--------PcdndtqvePPlpSINGATQAKAgEQVRLDASG 826 344444...3478999999999944444444422245566664........233222222112366555445555999998843 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (955 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 112.10 // Query: WDH87878.1|CBM32|CBM5 [L=955] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-22 65.9 0.3 1.4e-16 47.3 0.0 3.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 12.1 0.0 1.1e-05 1.1e-05 95 123 .. 498 526 .. 471 527 .. 0.77 2 ! 47.3 0.0 1.4e-16 1.4e-16 10 88 .. 544 632 .. 540 680 .. 0.78 3 ? 2.2 0.0 0.012 0.012 49 109 .. 754 826 .. 702 846 .. 0.64 Alignments for each domain: == domain 1 score: 12.1 bits; conditional E-value: 1.1e-05 CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 +++v+aryvRl+++++ ++ gasiaEl+ WDH87878.1|CBM32|CBM5 498 NETVKARYVRLVANSSVDGKEGASIAELH 526 37899********554466799*****97 PP == domain 2 score: 47.3 bits; conditional E-value: 1.4e-16 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltw..aen..grikdykvevSt..DgktWttvaekgnttd 86 +ss+++g++ +n++Dg+p+++W+sa+ ++l++dLg++ +++++++ + +++ g+ikdy+v++ Dg Wt +a+ + ++ WDH87878.1|CBM32|CBM5 544 ASSTQAGSPGSNILDGNPKSYWASATgagypHQLVIDLGTESRFSQLHYLPrqDQGlsGNIKDYQVYGGAgpDG-PWTLLADGE-FSA 629 33445559****************74456799******************98533246*********9965578.9**998764.433 PP CBM32.hmm 87 .gt 88 ++ WDH87878.1|CBM32|CBM5 630 dNE 632 243 PP == domain 3 score: 2.2 bits; conditional E-value: 0.012 CBM32.hmm 49 dkvvltwaen.grikdykvevSt...........DgktWttvaekgnttdgt........te..titfdkpvta.ryvRltvtk 109 ++v+ + + +++ ++ v++S+ gk W+++ + +i+ +++++a vRl +++ WDH87878.1|CBM32|CBM5 754 NQVQHK---GrQYMARWWVQGSEpgnpnftgadgSGKVWKDLG--------PcdndtqvePPlpSINGATQAKAgEQVRLDASG 826 344444...3478999999999944444444422245566664........233222222112366555445555999998833 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (955 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 116.96 // Query: XKL45184.1|CBM32|CBM5 [L=1069] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-18 53.3 0.3 2.4e-16 46.5 0.1 2.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.8 0.0 0.004 0.004 94 122 .. 505 534 .. 459 536 .. 0.72 2 ! 46.5 0.1 2.4e-16 2.4e-16 9 92 .. 554 644 .. 548 729 .. 0.82 Alignments for each domain: == domain 1 score: 3.8 bits; conditional E-value: 0.004 CBM32.hmm 94 fd.kpvtaryvRltvtkratnawgasiaEl 122 ++ +++++ry+++++t+ ++ +as+aEl XKL45184.1|CBM32|CBM5 505 LTqDTAQGRYLKFVATSAVDGKDNASVAEL 534 44345679*******775455555999997 PP == domain 2 score: 46.5 bits; conditional E-value: 2.4e-16 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd 86 +ss+ +g+ + a+Dg+pn++Ws+a g +++ +dLg+ +++++++ + + g+ik y+v++S+ + Wt +a+ +++ XKL45184.1|CBM32|CBM5 554 TSSAVPGTAVGNHAIDGNPNSYWSTAaGarypHEILIDLGADSRFSQLHYLPrqDAgLsGNIKGYQVYGSNSaNGAWTLLADG-EFSA 640 45666787889**************74256799******************98522325***********754569**99976.4443 PP CBM32.hmm 87 .gtteti 92 ++ i XKL45184.1|CBM32|CBM5 641 dND---I 644 244...2 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1069 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.64 // Query: XBY64427.1|CBM32|CBM5 [L=1063] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-17 50.1 0.0 1.5e-15 44.0 0.0 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 2.8 0.0 0.0081 0.0081 95 122 .. 500 528 .. 458 530 .. 0.73 2 ! 44.0 0.0 1.5e-15 1.5e-15 10 88 .. 549 637 .. 543 654 .. 0.74 Alignments for each domain: == domain 1 score: 2.8 bits; conditional E-value: 0.0081 CBM32.hmm 95 d.kpvtaryvRltvtkratnawgasiaEl 122 + + +++ry+++++t+ ++ +as+aEl XBY64427.1|CBM32|CBM5 500 TqDSAQGRYLKFVATSAVDGKDTASVAEL 528 3344579*******774455555999997 PP == domain 2 score: 44.0 bits; conditional E-value: 1.5e-15 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd. 86 ss+ +g + a+Dg+pn++Ws+a g +++++dLg++ +++++++ + + g+ik y+v++S+ + W+ +a+ +++ XBY64427.1|CBM32|CBM5 549 SSAVPGAAVGNHAIDGNPNSYWSTAaGarypHEMVIDLGAASRFSQLHYLPrqDAgLsGNIKGYQVYGSSSvNGGWNLLADG-EFSAd 635 45556667899*************74256799******************98522325***********754448**99876.44332 PP CBM32.hmm 87 gt 88 ++ XBY64427.1|CBM32|CBM5 636 ND 637 44 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1063 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 152.29 // Query: WZW89749.1|CBM32|CBM5 [L=955] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-22 65.6 1.1 1.1e-16 47.7 0.1 3.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 12.1 0.0 1.1e-05 1.1e-05 95 123 .. 498 526 .. 471 527 .. 0.77 2 ! 47.7 0.1 1.1e-16 1.1e-16 10 88 .. 544 632 .. 538 684 .. 0.75 3 ? 2.3 0.0 0.012 0.012 49 109 .. 754 826 .. 702 846 .. 0.64 Alignments for each domain: == domain 1 score: 12.1 bits; conditional E-value: 1.1e-05 CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 +++v+aryvRl+++++ ++ gasiaEl+ WZW89749.1|CBM32|CBM5 498 NETVKARYVRLVANSSVDGKEGASIAELH 526 37899********554466799*****97 PP == domain 2 score: 47.7 bits; conditional E-value: 1.1e-16 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltw..aen..grikdykvevSt..DgktWttvaekgnttd 86 +ss+++g++ +n++Dg+p+++W+sa+ ++l++dLg++ +++++++ + +++ g+ikdy+v++ Dg Wt +a+ + ++ WZW89749.1|CBM32|CBM5 544 ASSTQAGSPGSNILDGNPKSYWASATgagypHQLVIDLGTESRFSQLHYLPrqDQGlsGNIKDYQVYGGAgpDG-PWTLLADGE-FSA 629 33445559****************74456799******************98533246*********9965578.9**998764.433 PP CBM32.hmm 87 .gt 88 ++ WZW89749.1|CBM32|CBM5 630 dNE 632 243 PP == domain 3 score: 2.3 bits; conditional E-value: 0.012 CBM32.hmm 49 dkvvltwaen.grikdykvevSt...........DgktWttvaekgnttdgt........te..titfdkpvta.ryvRltvtk 109 ++v+ + + +++ ++ v++S+ gk W+++ + +i+ +++++a vRl +++ WZW89749.1|CBM32|CBM5 754 NQVQHK---GrQYMARWWVQGSEpgnpnftgadgSGKVWKDLG--------PcdndtqvePPlpSINGATQAKAgEQVRLDASG 826 344444...3478999999999944444444422245566664........233222222112366555445555999998843 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (955 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 111.86 // Query: XOB51249.1|CBM32|CBM5 [L=1068] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-18 52.4 0.1 6.7e-16 45.1 0.1 2.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 4.3 0.0 0.0029 0.0029 93 122 .. 503 533 .. 442 535 .. 0.70 2 ! 45.1 0.1 6.7e-16 6.7e-16 9 88 .. 553 642 .. 546 671 .. 0.76 Alignments for each domain: == domain 1 score: 4.3 bits; conditional E-value: 0.0029 CBM32.hmm 93 tfd.kpvtaryvRltvtkratnawgasiaEl 122 ++ +++++ry+++++t+ ++ +as+aEl XOB51249.1|CBM32|CBM5 503 GLTqDTAQGRYLKFVATSAVDGKDNASVAEL 533 344345679*******775455555999997 PP == domain 2 score: 45.1 bits; conditional E-value: 6.7e-16 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd 86 +ss+ +g + a+Dg+pn++Ws+a g +++ +dLg+ +++++++ + + g+ik y+v++S+ + Wt +a+ +++ XOB51249.1|CBM32|CBM5 553 TSSAVPGAAVGNHAIDGNPNSYWSTAaGarypHEILIDLGADSRFSQLHYLPrqDAgLsGNIKGYQVYGSSSaNGAWTLLADG-EFSA 639 45566777889**************74256799******************98522325***********54366***99976.4433 PP CBM32.hmm 87 .gt 88 ++ XOB51249.1|CBM32|CBM5 640 dNE 642 233 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1068 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 140.15 // Query: WIF69270.1|CBM32|CBM5 [L=1068] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-19 55.7 0.0 3.7e-17 49.1 0.0 2.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.2 0.0 0.0062 0.0062 96 123 .. 509 536 .. 480 537 .. 0.72 2 ! 49.1 0.0 3.7e-17 3.7e-17 12 89 .. 558 651 .. 551 698 .. 0.69 Alignments for each domain: == domain 1 score: 3.2 bits; conditional E-value: 0.0062 CBM32.hmm 96 kpvtaryvRltvtkratnawgasiaEla 123 ++++ary++l+++++ ++ as+aEl+ WIF69270.1|CBM32|CBM5 509 DTAQARYLKLVAESSIDGKERASAAELH 536 45679*******5544556669999987 PP == domain 2 score: 49.1 bits; conditional E-value: 3.7e-17 CBM32.hmm 12 saaggggaenavDgdpntrWss..ag...qwltvdLgkpttvdkvvltw.ae..n.grikdykvevStD.gktWttvaekgnttd.gt 88 + +++ + + a+Dg+++++Ws+ ++ +++++dLg++++++++++ + + g+ik y++++S++ + +Wt + +g+++ ++ WIF69270.1|CBM32|CBM5 558 AVPASASGAHAIDGNTSSYWSTvpGDrypHQMVIDLGGEQRFSSLNYLPqQVrdMeGNIKGYRIYGSDNpNGNWTLLG-QGEFSAsNE 644 334447899*************652256899*****************96324435***********87667***997.445544344 PP CBM32.hmm 89 ......t 89 + WIF69270.1|CBM32|CBM5 645 aqaaplK 651 4444330 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1068 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.53 // Query: XHY65680.1|CBM32|CBM5 [L=1069] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-18 53.0 0.1 3.9e-16 45.9 0.0 2.9 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 3.8 0.0 0.004 0.004 94 122 .. 505 534 .. 459 536 .. 0.72 2 ! 45.9 0.0 3.9e-16 3.9e-16 9 92 .. 554 644 .. 548 676 .. 0.76 Alignments for each domain: == domain 1 score: 3.8 bits; conditional E-value: 0.004 CBM32.hmm 94 fd.kpvtaryvRltvtkratnawgasiaEl 122 ++ +++++ry+++++t+ ++ +as+aEl XHY65680.1|CBM32|CBM5 505 LTqDTAQGRYLKFVATSAVDGKDNASVAEL 534 44345679*******775455555999997 PP == domain 2 score: 45.9 bits; conditional E-value: 3.9e-16 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd 86 +ss+ +g + a+Dg+pn++Ws+a g +++ +dLg+ +++++++ + + g+ik y+v++S+ + Wt +a+ +++ XHY65680.1|CBM32|CBM5 554 TSSAVPGAAVGNHAIDGNPNSYWSTAaGarypHEILIDLGADSRFSQLHYLPrqDAgLsGNIKGYQVYGSNSaNGAWTLLADG-EFSA 640 345566768899*************74256799******************98522325***********754569**99976.4433 PP CBM32.hmm 87 .gtteti 92 ++ i XHY65680.1|CBM32|CBM5 641 dND---I 644 244...2 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1069 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 63.14 // Query: WMR32621.1|CBM32|CBM5 [L=972] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-19 55.5 0.0 3.4e-17 49.3 0.0 3.0 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 2.8 0.0 0.0084 0.0084 95 123 .. 508 536 .. 461 537 .. 0.70 2 ! 49.3 0.0 3.4e-17 3.4e-17 12 89 .. 558 651 .. 551 698 .. 0.69 Alignments for each domain: == domain 1 score: 2.8 bits; conditional E-value: 0.0084 CBM32.hmm 95 dkpvtaryvRltvtkratnawgasiaEla 123 +++++ary++l+++++ ++ as++El+ WMR32621.1|CBM32|CBM5 508 QDTAQARYLKLVAESSIDGKERASASELH 536 345679*******5543555558888876 PP == domain 2 score: 49.3 bits; conditional E-value: 3.4e-17 CBM32.hmm 12 saaggggaenavDgdpntrWss..ag...qwltvdLgkpttvdkvvltw.ae..n.grikdykvevStD.gktWttvaekgnttd.gt 88 + +++ + + a+Dg+++++Ws+ ++ +++++dLg++++++++++ + + g+ik y++++S++ + +Wt + +g+++ ++ WMR32621.1|CBM32|CBM5 558 AVPASASGAHAIDGNTSSYWSTvpGDrypHQMVIDLGGEQRFSSLNYLPqQVrdMeGNIKGYRIYGSDNpNGNWTLLG-QGEFSAsNE 644 334447899*************652256899*****************96324435***********87667***997.445544344 PP CBM32.hmm 89 ......t 89 + WMR32621.1|CBM32|CBM5 645 aqaaplK 651 4444330 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (972 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 130.16 // Query: XKY30227.1|CBM32|CBM5 [L=955] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-20 60.6 0.1 2.7e-16 46.4 0.0 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 7.5 0.0 0.0003 0.0003 91 123 .. 493 526 .. 469 527 .. 0.73 2 ! 46.4 0.0 2.7e-16 2.7e-16 10 88 .. 544 632 .. 540 680 .. 0.76 3 ? 2.1 0.0 0.014 0.014 58 109 .. 760 826 .. 700 847 .. 0.66 Alignments for each domain: == domain 1 score: 7.5 bits; conditional E-value: 0.0003 CBM32.hmm 91 ti.tfdkpvtaryvRltvtkratnawgasiaEla 123 + t+d++v+ ry+Rl+++++ ++ +asiaEl+ XKY30227.1|CBM32|CBM5 493 AFaTLDETVKPRYLRLVANSSVDGKESASIAELH 526 44488888999*******554455677*****97 PP == domain 2 score: 46.4 bits; conditional E-value: 2.7e-16 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..aen..grikdykvevSt..DgktWttvaekgnttd 86 +ss+++g++ +n++Dg+p+++W+sa g ++l++dLg++ +++++++ + +++ g+ik y+v++ Dg Wt +a+ + ++ XKY30227.1|CBM32|CBM5 544 ASSTQAGSPGSNIIDGNPKSYWASAaGagypHQLVIDLGTESRFSQLHYLPrqDQGlsGNIKGYQVYGGIgpDG-PWTLLADGE-FSA 629 33445559****************742457999*****************98533246*********8854488.9**998764.433 PP CBM32.hmm 87 .gt 88 ++ XKY30227.1|CBM32|CBM5 630 dNE 632 243 PP == domain 3 score: 2.1 bits; conditional E-value: 0.014 CBM32.hmm 58 n.grikdykvevSt...........DgktWttvaekgnttdgt.........te.titfdkpvta.ryvRltvtk 109 + +++ ++ v++S+ gk W+++ ++ +i+ +++++a vRl +++ XKY30227.1|CBM32|CBM5 760 GrQYMARWWVQGSEpgnpnftgadgSGKVWKDLG--------PcdndtpvepPVaSIKGTSQAKAgEQVRLDASG 826 2477889999999844444444422245666665........233222323223477666445555999999843 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (955 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 113.53 // Query: BCD85864.1|CBM32|CBM5 [L=1063] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-17 50.0 0.0 1.5e-15 44.0 0.0 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 2.8 0.0 0.0081 0.0081 95 122 .. 500 528 .. 458 530 .. 0.73 2 ! 44.0 0.0 1.5e-15 1.5e-15 10 88 .. 549 637 .. 543 654 .. 0.74 Alignments for each domain: == domain 1 score: 2.8 bits; conditional E-value: 0.0081 CBM32.hmm 95 d.kpvtaryvRltvtkratnawgasiaEl 122 + + +++ry+++++t+ ++ +as+aEl BCD85864.1|CBM32|CBM5 500 TqDSAQGRYLKFVATSAVDGKDTASVAEL 528 3344579*******774455555999997 PP == domain 2 score: 44.0 bits; conditional E-value: 1.5e-15 CBM32.hmm 10 sssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStD.gktWttvaekgnttd. 86 ss+ +g + a+Dg+pn++Ws+a g +++++dLg++ +++++++ + + g+ik y+v++S+ + W+ +a+ +++ BCD85864.1|CBM32|CBM5 549 SSAVPGAAVGNHAIDGNPNSYWSTAaGarypHEMVIDLGAASRFSQLHYLPrqDAgLsGNIKGYQVYGSSSvNGGWNLLADG-EFSAd 635 45556667899*************74256799******************98522325***********754448**99876.44332 PP CBM32.hmm 87 gt 88 ++ BCD85864.1|CBM32|CBM5 636 ND 637 44 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1063 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.05 // [ok]