# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM32/fasta_for_each_cluster/cluster_311.txt # target HMM database: merged_hmms/CBM32.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM32/CBM32_cluster_311.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: XEO17785.1|CBM32|GH29 [L=1453] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-32 99.1 6.2 1.4e-22 66.6 0.6 3.9 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.1 0.1 0.029 0.029 37 87 .. 163 212 .. 141 248 .. 0.70 2 ! 31.1 0.1 1.5e-11 1.5e-11 19 112 .. 675 773 .. 667 790 .. 0.68 3 ? -2.4 0.0 0.34 0.34 57 82 .. 849 881 .. 814 898 .. 0.69 4 ! 66.6 0.6 1.4e-22 1.4e-22 3 122 .. 923 1055 .. 920 1057 .. 0.74 Alignments for each domain: == domain 1 score: 1.1 bits; conditional E-value: 0.029 CBM32.hmm 37 wltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekgnttd.g 87 ++d ++ +++ +++ + + + ++ + S Dg + +t+ +++ t+ g XEO17785.1|CBM32|GH29 163 VKQIDVPAVNKLHLIQVAY--TWNGTQATMKLSLDGVEQETITATTPATNaG 212 3589999999999998884..26799**********9988886665333323 PP == domain 2 score: 31.1 bits; conditional E-value: 1.5e-11 CBM32.hmm 19 aenavDgdpntrWssag......qw...ltvdLgkpttvdkvvltwae..n..grikdykvevStDgktWttvaekgnttdgtteti. 92 + ++Dgd r+s+ + q ++vdLgk+++++++ + n +++ +ykve+ g tWt+va +g t g ++ XEO17785.1|CBM32|GH29 675 TAVLTDGD---RYSAPTapkptaQAplvYEVDLGKAQQITQLGYSE-DikNygQQVENYKVEALVEG-TWTQVA-VGPT-IGA-RRLd 754 56678885...444421122334223338****************4.25434699************.*****7.5432.244.4555 PP CBM32.hmm 93 tfdkpvtaryvRltvtkra.t 112 t+++pvta+++Rltv +a XEO17785.1|CBM32|GH29 755 TLANPVTATKLRLTV--SAaR 773 999************..3322 PP == domain 3 score: -2.4 bits; conditional E-value: 0.34 CBM32.hmm 57 e.n.grikdykvevSt.....DgktWttvaekg 82 + + +++ ++k+++S gkt+t++++++ XEO17785.1|CBM32|GH29 849 YgTaTKPVTIKFYGSGpeptaGGKTFTQIVAEN 881 233577888888888755655689999997653 PP == domain 4 score: 66.6 bits; conditional E-value: 1.4e-22 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw.ae...n.grikdykvevS.tDgk 73 tass+e ++ ++g+a++++Dgdp+t+W+s++ ++lt+dLgk+++vd++++t a+ + ++ikdy+v+vS g+ XEO17785.1|CBM32|GH29 923 TASSEE---TTREQGQATKVLDGDPDTHWHSKWssapigvppNTLTFDLGKNYNVDALRYTGrAQggtEnSQIKDYEVYVSdVQGE 1005 444443...3344478***************7445677788889*****************772245536***********44576 PP CBM32.hmm 74 tWttvaekgnttdgtte.titfdkpvtaryvRltv.tkra.tnawgasiaEl 122 t++++g + +g++e ++tf+ pv +ryv l++ t+++ n +s+aE+ XEO17785.1|CBM32|GH29 1006 R-GTLVASGVFAVGSEEqRVTFP-PVLGRYVTLVAkTSQStRNGSFSSAAEI 1055 6.778778777666644377**9.8999*******43333333355999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1453 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 116.86 // Query: XEO19264.1|CBM32|GH29 [L=1445] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-32 98.9 6.3 1.4e-22 66.6 0.6 3.9 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.1 0.1 0.029 0.029 37 87 .. 163 212 .. 141 248 .. 0.70 2 ! 31.1 0.1 1.5e-11 1.5e-11 19 112 .. 675 773 .. 667 790 .. 0.68 3 ? -2.4 0.0 0.33 0.33 57 82 .. 849 881 .. 814 898 .. 0.69 4 ! 66.6 0.6 1.4e-22 1.4e-22 3 122 .. 923 1055 .. 920 1057 .. 0.74 Alignments for each domain: == domain 1 score: 1.1 bits; conditional E-value: 0.029 CBM32.hmm 37 wltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekgnttd.g 87 ++d ++ +++ +++ + + + ++ + S Dg + +t+ +++ t+ g XEO19264.1|CBM32|GH29 163 VKQIDVPAVNKLHLIQVAY--TWNGTQATMKLSLDGVEQETITATTPATNaG 212 3589999999999998884..26799**********9988886665333323 PP == domain 2 score: 31.1 bits; conditional E-value: 1.5e-11 CBM32.hmm 19 aenavDgdpntrWssag......qw...ltvdLgkpttvdkvvltwae..n..grikdykvevStDgktWttvaekgnttdgtteti. 92 + ++Dgd r+s+ + q ++vdLgk+++++++ + n +++ +ykve+ g tWt+va +g t g ++ XEO19264.1|CBM32|GH29 675 TAVLTDGD---RYSAPTapkptaQAplvYEVDLGKAQQITQLGYSE-DikNygQQVENYKVEALVEG-TWTQVA-VGPT-IGA-RRLd 754 56678885...444421122334223338****************4.25434699************.*****7.5432.244.4555 PP CBM32.hmm 93 tfdkpvtaryvRltvtkra.t 112 t+++pvta+++Rltv +a XEO19264.1|CBM32|GH29 755 TLATPVTATKLRLTV--SAaR 773 8889***********..3322 PP == domain 3 score: -2.4 bits; conditional E-value: 0.33 CBM32.hmm 57 e.n.grikdykvevSt.....DgktWttvaekg 82 + + +++ ++k+++S gkt+t++++++ XEO19264.1|CBM32|GH29 849 YgTaTKPVTIKFYGSGpeptaGGKTFTQIVAEN 881 233577888888888755655689999997653 PP == domain 4 score: 66.6 bits; conditional E-value: 1.4e-22 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw.ae...n.grikdykvevS.tDgk 73 tass+e ++ ++g+a++++Dgdp+t+W+s++ ++lt+dLgk+++vd++++t a+ + ++ikdy+v+vS g+ XEO19264.1|CBM32|GH29 923 TASSEE---TTREQGQATKVLDGDPDTHWHSKWssapigvppNTLTFDLGKNYNVDALRYTGrAQggtEnSQIKDYEVYVSdVQGE 1005 444443...3344478***************7445677788889*****************772245536***********44576 PP CBM32.hmm 74 tWttvaekgnttdgtte.titfdkpvtaryvRltv.tkra.tnawgasiaEl 122 t++++g + +g++e ++tf+ pv +ryv l++ t+++ n +s+aE+ XEO19264.1|CBM32|GH29 1006 R-GTLVASGVFAVGSEEqRVTFP-PVLGRYVTLVAkTSQStRNGSFSSAAEI 1055 6.778778777666644377**9.8999*******43333333355999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1445 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 104.95 // Query: XEO22358.1|CBM32|GH29 [L=1445] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-32 98.9 6.3 1.4e-22 66.6 0.6 3.9 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.1 0.1 0.029 0.029 37 87 .. 163 212 .. 141 248 .. 0.70 2 ! 31.1 0.1 1.5e-11 1.5e-11 19 112 .. 675 773 .. 667 790 .. 0.68 3 ? -2.4 0.0 0.33 0.33 57 82 .. 849 881 .. 814 898 .. 0.69 4 ! 66.6 0.6 1.4e-22 1.4e-22 3 122 .. 923 1055 .. 920 1057 .. 0.74 Alignments for each domain: == domain 1 score: 1.1 bits; conditional E-value: 0.029 CBM32.hmm 37 wltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekgnttd.g 87 ++d ++ +++ +++ + + + ++ + S Dg + +t+ +++ t+ g XEO22358.1|CBM32|GH29 163 VKQIDVPAVNKLHLIQVAY--TWNGTQATMKLSLDGVEQETITATTPATNaG 212 3589999999999998884..26799**********9988886665333323 PP == domain 2 score: 31.1 bits; conditional E-value: 1.5e-11 CBM32.hmm 19 aenavDgdpntrWssag......qw...ltvdLgkpttvdkvvltwae..n..grikdykvevStDgktWttvaekgnttdgtteti. 92 + ++Dgd r+s+ + q ++vdLgk+++++++ + n +++ +ykve+ g tWt+va +g t g ++ XEO22358.1|CBM32|GH29 675 TAVLTDGD---RYSAPTapkptaQAplvYEVDLGKAQQITQLGYSE-DikNygQQVENYKVEALVEG-TWTQVA-VGPT-IGA-RRLd 754 56678885...444421122334223338****************4.25434699************.*****7.5432.244.4555 PP CBM32.hmm 93 tfdkpvtaryvRltvtkra.t 112 t+++pvta+++Rltv +a XEO22358.1|CBM32|GH29 755 TLATPVTATKLRLTV--SAaR 773 8889***********..3322 PP == domain 3 score: -2.4 bits; conditional E-value: 0.33 CBM32.hmm 57 e.n.grikdykvevSt.....DgktWttvaekg 82 + + +++ ++k+++S gkt+t++++++ XEO22358.1|CBM32|GH29 849 YgTaTKPVTIKFYGSGpeptaGGKTFTQIVAEN 881 233577888888888755655689999997653 PP == domain 4 score: 66.6 bits; conditional E-value: 1.4e-22 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw.ae...n.grikdykvevS.tDgk 73 tass+e ++ ++g+a++++Dgdp+t+W+s++ ++lt+dLgk+++vd++++t a+ + ++ikdy+v+vS g+ XEO22358.1|CBM32|GH29 923 TASSEE---TTREQGQATKVLDGDPDTHWHSKWssapigvppNTLTFDLGKNYNVDALRYTGrAQggtEnSQIKDYEVYVSdVQGE 1005 444443...3344478***************7445677788889*****************772245536***********44576 PP CBM32.hmm 74 tWttvaekgnttdgtte.titfdkpvtaryvRltv.tkra.tnawgasiaEl 122 t++++g + +g++e ++tf+ pv +ryv l++ t+++ n +s+aE+ XEO22358.1|CBM32|GH29 1006 R-GTLVASGVFAVGSEEqRVTFP-PVLGRYVTLVAkTSQStRNGSFSSAAEI 1055 6.778778777666644377**9.8999*******43333333355999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1445 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 121.74 // Query: BCX78346.1|CBM32|GH0|GH29 [L=1487] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-32 98.1 12.8 1e-23 70.3 1.5 3.5 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.1 0.39 0.39 68 89 .. 151 174 .. 132 212 .. 0.52 2 ! 33.7 0.7 2.2e-12 2.2e-12 9 109 .. 886 987 .. 879 1022 .. 0.74 3 ! 70.3 1.5 1e-23 1e-23 9 122 .. 1136 1262 .. 1130 1264 .. 0.76 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.39 CBM32.hmm 68 vStDgktWttvaekgnttdgt..t 89 + g+tW++ +++ + ++++ + BCX78346.1|CBM32|GH0|GH29 151 TNPSGNTWNDYKKSVTLPSNNvkH 174 333488999885433433333231 PP == domain 2 score: 33.7 bits; conditional E-value: 2.2e-12 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltwae..n..grikdykvevStDgktWttvaekgn 83 ++s++++ +a +++Dg ++ ss+ ++t+dLg++ vd+v++ n ++i + ++++ +g tWt +a+ ++ BCX78346.1|CBM32|GH0|GH29 886 AASANDTAVAAPKLTDG---SKLSSDkAvgntPTYTIDLGSAVAVDAVKISE-DvrNagQQIESATLQGRVNG-TWTNLATMTT 964 233344446799*****...66666321234567*****************4.2553479*************.*****98765 PP CBM32.hmm 84 ttdgttetitfd.kpvtaryvRltvtk 109 g++++ +f+ ++ +Rl+v++ BCX78346.1|CBM32|GH0|GH29 965 V--GQQRDLRFTsQN--IDAIRLVVNS 987 4..554578999555..599***9954 PP == domain 3 score: 70.3 bits; conditional E-value: 1e-23 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag........qwltvdLgkp.ttvdkvvltw..ae.n.grikdykvevStDgktWtt 77 ++ss+++g +a++a+Dgd +t W+s++ +w+t+dLgk +v + + ++ n g +kdy+v+vS+D +++ BCX78346.1|CBM32|GH0|GH29 1136 AQSSQNSGAEAARALDGDSSTSWHSQYspttasapHWVTLDLGKSrENVAYFDYLAriDGnNnGAAKDYEVYVSDDPNDFGA 1217 2344445599***************633456789*********8857********77532456*****************99 PP CBM32.hmm 78 vaekgnttd.gttetitfdkpvtaryvRltvtkratnawgasiaEl 122 +++g+ ++ t++i+++ p ++ryv+++++++ ++++ s+aE+ BCX78346.1|CBM32|GH0|GH29 1218 PVASGTLKNvAYTQRIKLT-PKNGRYVKFVIKTDYSGSNFGSAAEM 1262 9877765533334677887.7789*******443355555888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1487 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.66 // Query: XTK09132.1|CBM32|GH0|GH29 [L=1487] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-33 101.1 10.2 4.9e-24 71.4 1.6 3.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.0 0.35 0.35 67 89 .. 150 174 .. 112 211 .. 0.56 2 ! 33.6 0.5 2.4e-12 2.4e-12 9 109 .. 886 987 .. 879 1022 .. 0.74 3 ! 71.4 1.6 4.9e-24 4.9e-24 9 122 .. 1136 1262 .. 1130 1264 .. 0.76 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.35 CBM32.hmm 67 evStDgktWttv.aekgnttdgt..t 89 ++ g+tW++ +++ + ++++ + XTK09132.1|CBM32|GH0|GH29 150 STNPSGNTWNDYtKSV-TLPSNNvkH 174 3333488888872223.333333231 PP == domain 2 score: 33.6 bits; conditional E-value: 2.4e-12 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltwae..n..grikdykvevStDgktWttvaekgn 83 ++s++++ +a +++Dg ++ ss++ ++t+dLg++ vd+v++ n ++i + ++++ +g tWt +a+ ++ XTK09132.1|CBM32|GH0|GH29 886 AASANGTAVAAPKLTDG---SKLSSDEavgntPTYTIDLGSAVAVDAVKISE-DvrNagQQIESATLQGRVNG-TWTNLATMTT 964 233333435799*****...66777422334567*****************4.2553479*************.*****98765 PP CBM32.hmm 84 ttdgttetitfd.kpvtaryvRltvtk 109 g++++ +f+ ++ +Rl+v++ XTK09132.1|CBM32|GH0|GH29 965 V--GQQRDLRFTsQN--IDAIRLVVNS 987 4..554578999555..599***9954 PP == domain 3 score: 71.4 bits; conditional E-value: 4.9e-24 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag........qwltvdLgkp.ttvdkvvltw..ae.n.grikdykvevStDgktWtt 77 ++ss+++g +a++a+Dgd +t W+s++ +w+t+dLgk +v + + ++ n g +kdy+v+vS+D +++ XTK09132.1|CBM32|GH0|GH29 1136 AQSSQNSGAEAAKALDGDSSTNWHSQYsptaasapHWVTLDLGKSrENVAYFDYLAriDGnNnGAAKDYEVYVSDDPNDFGA 1217 2344445599***************6334567899********8857********77532456*****************99 PP CBM32.hmm 78 vaekgnttd.gttetitfdkpvtaryvRltvtkratnawgasiaEl 122 +++g+ ++ t++i+++ p ++ryv+++++++ ++++ s+aE+ XTK09132.1|CBM32|GH0|GH29 1218 PVASGTLKNvAYTQRIKLT-PKNGRYVKFVIKTDYSGSNFGSAAEM 1262 9877765533334677887.7789*******443355555888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1487 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.61 // Query: XCB29344.1|CBM32|GH29 [L=1338] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-25 76.8 0.3 2.7e-16 46.4 0.2 3.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.4 0.0 4e-10 4e-10 5 111 .. 752 859 .. 748 885 .. 0.72 2 ! 46.4 0.2 2.7e-16 2.7e-16 9 122 .. 1005 1130 .. 999 1132 .. 0.73 Alignments for each domain: == domain 1 score: 26.4 bits; conditional E-value: 4e-10 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssa.g....qwltvdLgkpttvdkvvltwae...n.grikdykvevStDgktWttvaekgn 83 ss ++s++aa+ +a +++Dg ++ s++ +tv++g+pt+vd+v l + +++ ++kv++ + W+++ + ++ XCB29344.1|CBM32|GH29 752 SSVAASAAAAA-VPAPKLTDG---SKLSADpAagntPIYTVKFGAPTKVDAVILGE-DvrsSgQQVERFKVQGRDSAGMWRDLTAGTT 834 55555555555.89*******...666663212345569****************4.2555479**********9888*****65433 PP CBM32.hmm 84 ttdgttetitfdkpvtaryvRltvtkra 111 g++++ +f++ + +Rl+vt++ XCB29344.1|CBM32|GH29 835 --IGQQRNLRFAES-LVSEIRLEVTSSR 859 ..254346699843.379*****96633 PP == domain 2 score: 46.4 bits; conditional E-value: 2.7e-16 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag........qwltvdLgkp.ttvdkvvltw...aen.grikdykvevStDgktWttvaek 81 +ss++a ae a+Dg+ +t W++++ ++lt+dLgk +++ v + a++ g++k+y++++ + ++ t +a++ XCB29344.1|CBM32|GH29 1005 ASSQNAD-AVAESAFDGKSDTIWHNQWepsaaagpHSLTIDLGKRyEDISYVDYLGrvtANRnGTAKNYRIYTGDSAENLT-LAQE 1088 3444444.89***************74456778899*******9956********65432236***********8888866.7766 PP CBM32.hmm 82 gnttd.gttetitfdkpvtaryvRltvtkratnawgasiaEl 122 g +d + t +i + +p+ +r+v++++ ++ ++ + s+aE+ XCB29344.1|CBM32|GH29 1089 GVLEDkPYTHRIALGAPAAGRFVKFEIVSSYGDNVSGSAAEI 1130 63333333347788899888*******443333444777776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1338 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 149.88 // Query: XEO21076.1|CBM32|GH29 [L=1445] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-32 97.8 6.1 1.4e-22 66.6 0.6 3.7 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.7 0.1 0.1 0.1 40 84 .. 166 208 .. 145 246 .. 0.65 2 ! 31.1 0.1 1.5e-11 1.5e-11 19 112 .. 675 773 .. 667 790 .. 0.68 3 ? -2.4 0.0 0.33 0.33 57 82 .. 849 881 .. 814 898 .. 0.69 4 ! 66.6 0.6 1.4e-22 1.4e-22 3 122 .. 923 1055 .. 920 1057 .. 0.74 Alignments for each domain: == domain 1 score: -0.7 bits; conditional E-value: 0.1 CBM32.hmm 40 vdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekgnt 84 d ++ +++ +++ + + + ++ + S Dg + +t+ +++ XEO21076.1|CBM32|GH29 166 TDVPAVNKLHLIQVAY--TWNGTQATMKLSLDGVEQETITATTPA 208 4555555555555552..256888999999999887777555532 PP == domain 2 score: 31.1 bits; conditional E-value: 1.5e-11 CBM32.hmm 19 aenavDgdpntrWssag......qw...ltvdLgkpttvdkvvltwae..n..grikdykvevStDgktWttvaekgnttdgtteti. 92 + ++Dgd r+s+ + q ++vdLgk+++++++ + n +++ +ykve+ g tWt+va +g t g ++ XEO21076.1|CBM32|GH29 675 TAVLTDGD---RYSAPTapkptaQAplvYEVDLGKAQQITQLGYSE-DikNygQQVENYKVEALVEG-TWTQVA-VGPT-IGA-RRLd 754 56678885...444421122334223338****************4.25434699************.*****7.5432.244.4555 PP CBM32.hmm 93 tfdkpvtaryvRltvtkra.t 112 t+++pvta+++Rltv +a XEO21076.1|CBM32|GH29 755 TLANPVTATKLRLTV--SAaR 773 999************..3322 PP == domain 3 score: -2.4 bits; conditional E-value: 0.33 CBM32.hmm 57 e.n.grikdykvevSt.....DgktWttvaekg 82 + + +++ ++k+++S gkt+t++++++ XEO21076.1|CBM32|GH29 849 YgTaTKPVTIKFYGSGpeptaGGKTFTQIVAEN 881 233577888888888755655689999997653 PP == domain 4 score: 66.6 bits; conditional E-value: 1.4e-22 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw.ae...n.grikdykvevS.tDgk 73 tass+e ++ ++g+a++++Dgdp+t+W+s++ ++lt+dLgk+++vd++++t a+ + ++ikdy+v+vS g+ XEO21076.1|CBM32|GH29 923 TASSEE---TTREQGQATKVLDGDPDTHWHSKWssapigvppNTLTFDLGKNYNVDALRYTGrAQggtEnSQIKDYEVYVSdVQGE 1005 444443...3344478***************7445677788889*****************772245536***********44576 PP CBM32.hmm 74 tWttvaekgnttdgtte.titfdkpvtaryvRltv.tkra.tnawgasiaEl 122 t++++g + +g++e ++tf+ pv +ryv l++ t+++ n +s+aE+ XEO21076.1|CBM32|GH29 1006 R-GTLVASGVFAVGSEEqRVTFP-PVLGRYVTLVAkTSQStRNGSFSSAAEI 1055 6.778778777666644377**9.8999*******43333333355999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1445 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.18 // Query: XNW51034.1|CBM32|GH29 [L=489] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-19 55.0 0.3 1.2e-18 54.0 0.3 1.4 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 54.0 0.3 1.2e-18 1.2e-18 14 110 .. 367 469 .. 359 482 .. 0.81 Alignments for each domain: == domain 1 score: 54.0 bits; conditional E-value: 1.2e-18 CBM32.hmm 14 aggggaenavDgdpntrWssag....qwltvdLgkpttvdkvvltwae..n..grikdykvevStDgktWttvaekgnttd.gtteti 92 +g+++++n+vD ++nt++++++ ++t++Lgk +t+d + l+ e + r++ ++v +S++gk+W+++ e +++++ g + + XNW51034.1|CBM32|GH29 367 GGNYKPANMVDTNENTYYATSDnavtDTITFNLGKKKTFDVLMLQ--EviElgHRTTGWSVDYSSNGKDWVPIPEATGKQSiGYKWLV 452 56799***************73356668****************9..44533599******************877765555664577 PP CBM32.hmm 93 tfdkpvtaryvRltvtkr 110 +f+ pvta +vRl+vt+ XNW51034.1|CBM32|GH29 453 KFK-PVTASKVRLKVTSG 469 998.9**********763 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (489 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.98 // Query: WHY78136.1|CBM32|CBM6|CBM91|GH43_10 [L=1129] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-26 77.4 0.4 6.8e-26 77.4 0.4 4.1 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.8 0.0 0.034 0.034 62 80 .. 484 502 .. 471 533 .. 0.77 2 ? -2.4 0.3 0.34 0.34 18 39 .. 560 603 .. 548 627 .. 0.56 3 ! 77.4 0.4 6.8e-26 6.8e-26 3 122 .. 795 920 .. 791 922 .. 0.80 4 ? -1.1 1.5 0.13 0.13 49 76 .. 1042 1075 .. 996 1102 .. 0.52 Alignments for each domain: == domain 1 score: 0.8 bits; conditional E-value: 0.034 CBM32.hmm 62 kdykvevStDgktWttvae 80 ++ ++++S Dg ++t + WHY78136.1|CBM32|CBM6|CBM91|GH43_10 484 YRTEFSYSLDGVNFTRLGG 502 677899*********9953 PP == domain 2 score: -2.4 bits; conditional E-value: 0.34 CBM32.hmm 18 gaenavDgdpn....trWss.....ag..........qwl...t 39 + ++++D++ + t W + ++ wl + WHY78136.1|CBM32|CBM6|CBM91|GH43_10 560 DQNYVTDKNLTinakTEWTNddvydGYdqsmanikngDWLrfdQ 603 45566777632223477877444330133333344444553334 PP == domain 3 score: 77.4 bits; conditional E-value: 6.8e-26 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag.......qwltvdLgkpttvdkvvltw..ae.n.grikdyk 65 t a+s++++a++++a+n++Dg+++t W++++ ++l ++Lg++++v k+++ + ++ g +++++ WHY78136.1|CBM32|CBM6|CBM91|GH43_10 795 T---ASSEETQAEDNKAANVIDGNIDTIWHTQWsggnrppHTLDFNLGETYDVYKLKYIPrqSGgDnGIVTKFN 865 3...334456677799***************7446788999*******************9633535******* PP CBM32.hmm 66 vevStDgktWttvaekgnttdgt..tetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 +++S+Dg ++t v+e g++ ++ ++t+tf p++a y+R+++ a n + s+aE+ WHY78136.1|CBM32|CBM6|CBM91|GH43_10 866 IYTSMDGVNYTLVKENGTFV-NDsmPKTVTFR-PTQANYLRFEI--LAgHNGF-GSAAEI 920 ***********998887766.55445689998.899********..5544445.677776 PP == domain 4 score: -1.1 bits; conditional E-value: 0.13 CBM32.hmm 49 dkvvltwae.....n..grikdykvevStDgktWt 76 ++++++ + + g+i++ykv + + ++++t WHY78136.1|CBM32|CBM6|CBM91|GH43_10 1042 TSYKIYK-NgselvTlaGDITSYKVKGLSSDTKYT 1075 2222222.112233123455555555443333443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1129 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 43.07 // Query: USK36753.1|CBM32|CBM6|CBM91|GH43_10 [L=1129] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-26 78.3 1.1 3.5e-26 78.3 1.1 4.0 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.7 0.2 0.019 0.019 60 81 .. 482 503 .. 447 581 .. 0.78 2 ? -2.4 0.1 0.34 0.34 18 43 .. 560 607 .. 548 618 .. 0.56 3 ! 78.3 1.1 3.5e-26 3.5e-26 3 122 .. 795 920 .. 792 924 .. 0.80 4 ? -0.1 0.7 0.067 0.067 59 82 .. 1058 1081 .. 1020 1104 .. 0.53 Alignments for each domain: == domain 1 score: 1.7 bits; conditional E-value: 0.019 CBM32.hmm 60 rikdykvevStDgktWttvaek 81 ++ ++++S Dg ++t + + USK36753.1|CBM32|CBM6|CBM91|GH43_10 482 FEYRTEFSYSLDGVNFTRLGGR 503 4567889999******998533 PP == domain 2 score: -2.4 bits; conditional E-value: 0.34 CBM32.hmm 18 gaenavDgdpn....trWss.....ag..........qwl...tvdLg 43 + ++++D++ + t W + ++ wl +vd+g USK36753.1|CBM32|CBM6|CBM91|GH43_10 560 DQNYVTDKNLTinakTVWTNddvydGYdqsmanikngDWLrydQVDFG 607 456677776322234888875444401333334444546533466665 PP == domain 3 score: 78.3 bits; conditional E-value: 3.5e-26 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag.......qwltvdLgkpttvdkvvltw..ae.n.grikdyk 65 tas s++++a++++a+n++Dg+++t W++++ ++l ++Lg++++v k+++ + ++ g +++y+ USK36753.1|CBM32|CBM6|CBM91|GH43_10 795 TAS---SEETQAEDNKAANVIDGNIDTIWHTKWnggntppHTLDFNLGETYDVYKLKYIPrqSGgDnGIVTEYN 865 333...3456677799***************7445678999*******************9633535******* PP CBM32.hmm 66 vevStDgktWttvaekgnttdgt.tetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 +++S+Dg ++t v+ekg++ +++ ++t+tf p++a y+R++v a +n + s+aE+ USK36753.1|CBM32|CBM6|CBM91|GH43_10 866 IYTSMDGVNYTLVKEKGTFVSDSmPKTVTFR-PTQANYLRFEV--LAgKNGF-GSAAEI 920 *************999988654445699998.899********..5544445.677776 PP == domain 4 score: -0.1 bits; conditional E-value: 0.067 CBM32.hmm 59 grikdykvevStDgktWttvaekg 82 g+i++ykv + + ++++t +e g USK36753.1|CBM32|CBM6|CBM91|GH43_10 1058 GDITSYKVKGLSSDTKYTFKVEAG 1081 555555555554444444222222 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1129 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 45.76 // Query: XLF01386.1|CBM32|CBM6|CBM91|GH43_10 [L=1306] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-23 69.6 0.5 2.9e-22 65.7 0.0 3.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.0 0.096 0.096 59 79 .. 504 524 .. 484 562 .. 0.74 2 ? -1.4 0.2 0.16 0.16 36 72 .. 618 657 .. 575 699 .. 0.56 3 ! 65.7 0.0 2.9e-22 2.9e-22 5 122 .. 828 959 .. 824 961 .. 0.78 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.096 CBM32.hmm 59 grikdykvevStDgktWttva 79 + ++ ++++S Dg+++ + XLF01386.1|CBM32|CBM6|CBM91|GH43_10 504 RFEYRTEFSYSLDGENFIRLG 524 456788999*******98775 PP == domain 2 score: -1.4 bits; conditional E-value: 0.16 CBM32.hmm 36 qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDg 72 + + + Lg+ ++ + v+++ + ++ ++++++ Dg XLF01386.1|CBM32|CBM6|CBM91|GH43_10 618 EAYDLALGNLREGNWVSYNRvDFkDgADWFNFRISGTADG 657 4455555555554445444221122355555555555555 PP == domain 3 score: 65.7 bits; conditional E-value: 2.9e-22 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw...ae..n.grikdy 64 ss+e++ + + +g +++++Dgd+nt+W+s + +w+++dLg+ ++++++++ + ++ + g i+++ XLF01386.1|CBM32|CBM6|CBM91|GH43_10 828 SSEEAGGEGPKSGYISAILDGDANTFWHSRWsyevakppHWFILDLGGSYDINQITILPrqgSGdrPnGLIQKF 901 56666777777777***************5335678899********************965226536****** PP CBM32.hmm 65 kvevStDg...ktWttvaekgnttd.gt.tetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 ++++St g +++tt+ +k+ ++ +ti+fd v ary+++++ ++ n++ as+aE+ XLF01386.1|CBM32|CBM6|CBM91|GH43_10 902 TLSYSTTGmkdEDFTTIGQKEL--PlNEkLQTIDFD-IVHARYLKVYI--DEsWNDF-ASLAEI 959 ******8765579****87653..324423599**9.4789*******..4423345.999998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1306 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 103.65 // [ok]