# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM32/fasta_for_each_cluster/cluster_229.txt # target HMM database: merged_hmms/CBM32.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM32/CBM32_cluster_229.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: ALO12214.1|AA5_2|CBM32 [L=770] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-47 145.5 10.3 1.2e-25 76.6 2.3 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.0 1.2 1.5e-24 1.5e-24 6 122 .. 11 138 .. 6 140 .. 0.75 2 ! 76.6 2.3 1.2e-25 1.2e-25 6 122 .. 162 290 .. 157 292 .. 0.81 Alignments for each domain: == domain 1 score: 73.0 bits; conditional E-value: 1.5e-24 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw....aengrikdykvevStDgktWttvae 80 ++ +++ ++ g a+n++Dg++ t W+s++ +++tvd+ ++t v+++v+++ a ngr+ +y+++vS Dg +W ++ ALO12214.1|AA5_2|CBM32 11 ASDEETVGEN-GRAANVLDGNTATAWHSKWtgtpaglpHSITVDMHRTTVVSALVYQPrtvgA-NGRVGEYSISVSADGRNWGSPVA 95 2222344444.88***************74467788999******************975433.3*****************99977 PP CBM32.hmm 81 kgnttd.gttetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 +g+ d +t f+ p ar+vRlt+ + a + +++s+aE+ ALO12214.1|AA5_2|CBM32 96 TGTLADdAGAKTLGFA-PQGARFVRLTAVTEAgNRGPWSSAAEI 138 7655432223466887.6679*******5544343443889987 PP == domain 2 score: 76.6 bits; conditional E-value: 1.2e-25 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw....aengrikdykvevStDgktWttvae 80 ++ +++ ++ g a+n++Dgd+ t W+s + +++t+d+ + v+++v+++ a ngr+ y++ vStDg+++ + ++ ALO12214.1|AA5_2|CBM32 162 ASDEETVREN-GRAANVLDGDAATIWHSRWsgtpaplpHSITIDMHRRAAVSALVYQPrrdvA-NGRVGAYTITVSTDGTHFGEPVA 246 3333455555.88***************53356788999******************976433.3********************99 PP CBM32.hmm 81 kgnttd.gtte.titfdkpvtaryvRltvtkra.tnawgasiaEl 122 +g++ d +t + t tf+ +++aryvRltvt a + +++s+aE+ ALO12214.1|AA5_2|CBM32 247 TGTWRDdDT-VkTATFTRAAKARYVRLTVTREAgNRGPWTSAAEI 290 99*998555.5366***999*********8877543444999997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (770 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.77 // Query: AZK97586.1|AA5_2|CBM32 [L=782] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-47 144.8 12.0 2.3e-26 78.9 5.9 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.9 0.3 2.9e-23 2.9e-23 4 122 .. 23 150 .. 19 152 .. 0.75 2 ! 78.9 5.9 2.3e-26 2.3e-26 7 122 .. 174 302 .. 169 304 .. 0.79 Alignments for each domain: == domain 1 score: 68.9 bits; conditional E-value: 2.9e-23 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttva 79 as +++aa++g a+n++Dg++ t W+s + +++t+d++++ v+++v+ + + + gr+ +y+++ S Dg++W + AZK97586.1|AA5_2|CBM32 23 AS---DEETAAENGRAANVLDGNAATIWHSRYagtsaplpHSITIDMNRTAVVSGLVYLPrNDgPnGRVGEYSISMSADGQNWGSPV 106 22...3345566689***************53335678999******************9843445*****************9998 PP CBM32.hmm 80 ekgnttd.gttetitfdkpvtaryvRltvtkra.tna.wgasiaEl 122 ++g+ d +t f+ p+ ar+vRlt+ + a + w + +aEl AZK97586.1|AA5_2|CBM32 107 ATGTLADdAAAKTLGFA-PTGARFVRLTAVTEAgNRGpW-TTAAEL 150 77766543333466776.8889*******4444233324.666665 PP == domain 2 score: 78.9 bits; conditional E-value: 2.3e-26 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekg 82 a+ +++aa++g a+n++Dg++ t W+s + +++t+d++++t v+++v+++ + + gr+ y+v +StDg+t+ t ++ g AZK97586.1|AA5_2|CBM32 174 ASDEETAAENGRAANVLDGNAATIWHSRYagtsaplpHSITIDMNRTTAVSALVYQPrNDgPnGRAGAYTVTTSTDGTTFGTPVAAG 260 233345556689***************53335678999******************9843445********************9999 PP CBM32.hmm 83 nttd.gtte.titfdkpvtaryvRltvtkra.tna.wgasiaEl 122 ++ d +t + t tf+ ++taryvRlt+t+ a + w + +aE+ AZK97586.1|AA5_2|CBM32 261 TWRDdDT-VkTATFTRTATARYVRLTATGEAgNRGpW-TTAAEI 302 9998555.5366***7789********9877433324.666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (782 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.99 // Query: AWZ10530.1|AA5_2|CBM32 [L=783] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-45 139.1 11.1 1.4e-24 73.2 1.3 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.2 1.3 1.4e-24 1.4e-24 6 122 .. 23 151 .. 18 153 .. 0.75 2 ! 70.1 2.7 1.2e-23 1.2e-23 6 122 .. 175 303 .. 170 305 .. 0.78 Alignments for each domain: == domain 1 score: 73.2 bits; conditional E-value: 1.4e-24 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw...aen.grikdykvevStDgktWttvae 80 ++ +++a+++g a n++Dgd nt W+s + +++t+d+ ++ v+++v+ + a+ gri +y+++vStDg++W ++ AWZ10530.1|AA5_2|CBM32 23 AS-DEETAGENGRAVNVLDGDVNTMWHSRWtapaaplpHTITIDMHRTAVVSALVYVPrtiAWAnGRIGEYSISVSTDGQNWGNPVA 108 22.2333444477***************54456778999******************98653224*****************99987 PP CBM32.hmm 81 kgnttd.gttetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 +g+ d t+t f+ p+ ar++Rlt+ + a + +++s+aE+ AWZ10530.1|AA5_2|CBM32 109 TGTLADdAATKTLGFA-PTGARFIRLTAATEAgNRGPWTSAAEI 151 7766543333355665.888********4444333443999997 PP == domain 2 score: 70.1 bits; conditional E-value: 1.2e-23 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae..ngrikdykvevStDgktWttvaek 81 ++ +++a+++g a n++Dgd+nt W+s + +++t+d+ ++ v+++v++ a+ ngr+ y++ +St+g+t+ +++ AWZ10530.1|AA5_2|CBM32 175 AS-DEETAGENGRAVNVLDGDANTMWHSRYagtpaplpHTITIDMHRTAAVSALVYHSrASgvNGRAGGYTITTSTNGTTFGSPVAV 260 22.2333444477***************53345678999******************7633445********************99* PP CBM32.hmm 82 gnttd.gtte.titfdkpvtaryvRltvtkra.tnawgasiaEl 122 g+++d +t + t tf + ++r+vRltvt+ a + +++s+aE+ AWZ10530.1|AA5_2|CBM32 261 GTWKDdNT-VkTATFIRTENVRFVRLTVTSEAgNRGPWTSAAEI 303 ***99887.435688855578*******9988544444999997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (783 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.03 // Query: AVZ77038.1|AA5_2|CBM32 [L=722] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-25 74.7 0.1 1.2e-24 73.3 0.1 1.7 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.3 0.1 1.2e-24 1.2e-24 10 123 .. 115 242 .. 108 243 .. 0.82 Alignments for each domain: == domain 1 score: 73.3 bits; conditional E-value: 1.2e-24 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStDgktWttvaekgnt 84 +++aa++g a a+Dg+p+t+W+s++ +++t+d+ ++ v+++++++ + gri y++ +StDg t+ +++g++ AVZ77038.1|AA5_2|CBM32 115 EETAAEEGRAHLALDGNPSTFWHSKWsngpaslpHSITIDMHRTAVVSGLTYQPrpTDiPnGRIGAYSIATSTDGLTFGAPVATGTW 201 344566688***************74467788999******************97533645******************999999*9 PP CBM32.hmm 85 td.gttetitfdkpvtaryvRltvtkra.tnawgasiaEla 123 +d g ++ tf+ p tar+vRlt+t+ a +++s+aEl+ AVZ77038.1|AA5_2|CBM32 202 KDdGFVKSATFARPETARFVRLTATSEAgGRGPWSSAAELH 242 9766534669999999********99875334449999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (722 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 120.03 // Query: AUZ88908.1|AA5_2|CBM32 [L=752] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-46 141.6 2.8 4e-24 71.7 0.2 2.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.3 0.0 2.1e-23 2.1e-23 13 121 .. 6 127 .. 1 130 [. 0.80 2 ! 71.7 0.2 4e-24 4e-24 5 122 .. 150 278 .. 146 280 .. 0.79 3 ? -2.4 0.0 0.35 0.35 37 68 .. 506 537 .. 483 546 .. 0.71 Alignments for each domain: == domain 1 score: 69.3 bits; conditional E-value: 2.1e-23 CBM32.hmm 13 aaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw..aen.grikdykvevStDgktWttvaekgnttd. 86 a++g+a+n++Dg+++t W+s + ++lt+d ++++++ ++++ + ++ gri ++++ vS Dg W + ++ g+ +d AUZ88908.1|AA5_2|CBM32 6 MAADGKAANVLDGSATTIWHSRYspapaallpHTLTIDTKGTQSIGGLRYLPrpTGSnGRIGSFEIRVSADGVAWSKPVAYGTLPDs 92 345589***************533456679999******************9862234********************999988775 PP CBM32.hmm 87 gttetitfdkpvtaryvRltvtkra.tnawgasiaE 121 t++t++f+ +v+aryvRl +t+ a + +++ +aE AUZ88908.1|AA5_2|CBM32 93 ATEKTVSFT-AVSARYVRLIATSEAgNRGPWSTAAE 127 554488998.89*********987743333255555 PP == domain 2 score: 71.7 bits; conditional E-value: 4e-24 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw..ae.ngrikdykvevStDgktWttva 79 s++ +++a ++g a n++Dg++ t W+s + +++t+d +++++v ++++ + ++ ngri y++e+S Dg W va AUZ88908.1|AA5_2|CBM32 150 SAS-DEETARSNGRAGNILDGNTATIWHSRWspapaaplpHSITIDTKTARSVAGLRYRPrpDGgNGRIGVYSIEASPDGMVWSRVA 235 333.3444455589***************544556778999******************9863334********************8 PP CBM32.hmm 80 ekgnttd.gttetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 g+++d g ++t++f+ pv aryvRlt+ + a + +++s+aE+ AUZ88908.1|AA5_2|CBM32 236 -NGTWPDtGVEKTVSFA-PVVARYVRLTAGSEAgNRGPWSSAAEI 278 .5699877764488998.899********7766433444888887 PP == domain 3 score: -2.4 bits; conditional E-value: 0.35 CBM32.hmm 37 wltvdLgkpttvdkvvltw..aengrikdykvev 68 + +d gk tv + + ++ a +++ y++ + AUZ88908.1|AA5_2|CBM32 506 AVMYDVGKILTVGGATAYQkvA--ATARAYTIDI 537 4778888888888888885431..4577777765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (752 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.88 // Query: AQT77004.1|AA5_2|CBM32 [L=783] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.8e-46 141.8 11.8 1.2e-24 73.3 3.5 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.7 1.2 2e-24 2e-24 3 122 .. 22 150 .. 18 152 .. 0.77 2 ! 73.3 3.5 1.2e-24 1.2e-24 3 122 .. 173 302 .. 169 304 .. 0.79 Alignments for each domain: == domain 1 score: 72.7 bits; conditional E-value: 2e-24 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttv 78 tas +++++++g a+n++Dgd+nt W+s++ ++lt+d+ ++ v+++v+ + a+ + gr+ +y ++vS Dg++W AQT77004.1|AA5_2|CBM32 22 TASD---EETTGENGRAANVLDGDANTIWHSKWtapaaalpHTLTIDMHRTAVVSALVYRPrAGsSnGRVGEYGISVSADGQNWGAP 105 2333...334455578***************75567789999******************9844435*****************999 PP CBM32.hmm 79 aekgnttd.gttetitfdkpvtaryvRltvtkra.tna.wgasiaEl 122 +++g+ d t +t f+ p+ ar+vRlt+ + a + w +s+aE+ AQT77004.1|AA5_2|CBM32 106 VATGTLADdATAKTLGFA-PTGARFVRLTAVTEAgNRGpW-TSAAEI 150 887776654443355776.888********5444343425.899987 PP == domain 2 score: 73.3 bits; conditional E-value: 1.2e-24 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttv 78 tas +++++++g a+n++Dgd+nt W+s++ +++t+d+ ++ v+++v+++ ++ + gr+ y+v++StDg ++ + AQT77004.1|AA5_2|CBM32 173 TASD---EETTGENGRAANVLDGDANTIWHSKWtapaaalpHTITIDMHRTAVVSALVYHPrGTgPnGRAGAYTVSTSTDGISFGAA 256 2333...334455578***************75567789999******************9743435******************** PP CBM32.hmm 79 aekgnttd.gtte.titfdkpvtaryvRltvtkra..tnawgasiaEl 122 +++g++ d +t + t tf+ ++++ryvRltvt+ a + w +s+ E+ AQT77004.1|AA5_2|CBM32 257 VASGTWRDdDT-VkTATFTRAAPTRYVRLTVTTEAggRGPW-TSAGEI 302 9999*998555.5366***77889*******7766422235.776665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (783 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.20 // Query: QPK50838.1|CBM32 [L=782] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-47 145.5 10.3 1.2e-25 76.6 2.3 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.0 1.2 1.5e-24 1.5e-24 6 122 .. 23 150 .. 18 152 .. 0.75 2 ! 76.6 2.3 1.2e-25 1.2e-25 6 122 .. 174 302 .. 169 304 .. 0.81 Alignments for each domain: == domain 1 score: 73.0 bits; conditional E-value: 1.5e-24 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw....aengrikdykvevStDgktWttvaekgnttd 86 ++ +++ ++ g a+n++Dg++ t W+s++ +++tvd+ ++t v+++v+++ a ngr+ +y+++vS Dg +W +++g+ d QPK50838.1|CBM32 23 ASDEETVGEN-GRAANVLDGNTATAWHSKWtgtpaglpHSITVDMHRTTVVSALVYQPrtvgA-NGRVGEYSISVSADGRNWGSPVATGTLAD 113 2222344444.88***************74467788999******************975433.3*****************99977765543 PP CBM32.hmm 87 .gttetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 +t f+ p ar+vRlt+ + a + +++s+aE+ QPK50838.1|CBM32 114 dAGAKTLGFA-PQGARFVRLTAVTEAgNRGPWSSAAEI 150 2223466887.6679*******5544343443889987 PP == domain 2 score: 76.6 bits; conditional E-value: 1.2e-25 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw....aengrikdykvevStDgktWttvaekgnttd 86 ++ +++ ++ g a+n++Dgd+ t W+s + +++t+d+ + v+++v+++ a ngr+ y++ vStDg+++ + +++g++ d QPK50838.1|CBM32 174 ASDEETVREN-GRAANVLDGDAATIWHSRWsgtpaplpHSITIDMHRRAAVSALVYQPrrdvA-NGRVGAYTITVSTDGTHFGEPVATGTWRD 264 3333455555.88***************53356788999******************976433.3********************9999*998 PP CBM32.hmm 87 .gtte.titfdkpvtaryvRltvtkra.tnawgasiaEl 122 +t + t tf+ +++aryvRltvt a + +++s+aE+ QPK50838.1|CBM32 265 dDT-VkTATFTRAAKARYVRLTVTREAgNRGPWTSAAEI 302 555.5366***999*********8877543444999997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (782 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.30 // Query: AEV83893.1|AA5_2|CBM32 [L=959] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-65 205.7 10.7 6.8e-25 74.1 0.1 3.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.8 1.5 2.1e-21 2.1e-21 13 121 .. 63 179 .. 57 182 .. 0.79 2 ! 73.5 0.2 1.1e-24 1.1e-24 6 122 .. 198 328 .. 194 330 .. 0.80 3 ! 74.1 0.1 6.8e-25 6.8e-25 7 122 .. 347 475 .. 343 477 .. 0.79 Alignments for each domain: == domain 1 score: 62.8 bits; conditional E-value: 2.1e-21 CBM32.hmm 13 aaggggaenavDgdpntrWssag....qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttet 91 ++g+ +a++a+Dg ++t W s++ + l +d g+ v+++++ + a+ gri +y+v++S++g+tW +++g++ d t +t AEV83893.1|AA5_2|CBM32 63 DSGQTSAAKAIDGAAGTAWLSGTtalpHRLAIDTGNRVAVSGLTYLPrAStAtGRIGRYRVQTSDNGTTWAAPVATGTFADdATLKT 149 345588***************85579999*****************9844445******************9998989876555348 PP CBM32.hmm 92 itfdkpvtaryvRltvtkra.tnawgasiaE 121 +tf + v +ryvRl++ + a + +++aE AEV83893.1|AA5_2|CBM32 150 VTFGT-VITRYVRLVAVTEAgNRGRQVAAAE 179 89984.558*******443322233355555 PP == domain 2 score: 73.5 bits; conditional E-value: 1.1e-24 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStDgktWttva 79 +a s+++aa++g+a+na+Dgd+++ W++a+ +++tvd+ + v+++++ + ++ + g i +y++e+S+Dg+tW ++a AEV83893.1|AA5_2|CBM32 198 TADSQETAAANGAAANALDGDTRSIWHTAYsvapaaplpHTFTVDMRVTNLVSGLSYLPrqDGgRnGLIGRYRIETSMDGTTWGPAA 284 3334455566699***************744567788999******************98633545********************9 PP CBM32.hmm 80 ekgnttd.gttetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 ++g + d + +t+tf+ p+ ar+vR+t+ + a + +++s+aE+ AEV83893.1|AA5_2|CBM32 285 ATGAFIDsQDAQTVTFA-PALARFVRITALSEAgNRGPWSSAAEI 328 99887764444588**9.778********7777433444889987 PP == domain 3 score: 74.1 bits; conditional E-value: 6.8e-25 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw..ae.ngrikdykvevStDgktWttvaek 81 a s+++aa++g a n++Dgdp t W+sa+ +++tvdL + v ++++ + a+ ngri +y++ +S+D +tWt+ ++ AEV83893.1|AA5_2|CBM32 347 ADSEETAAENGRAVNVLDGDPATIWHSAWsatpvpglpHSVTVDLHHAVPVGGLSYLPrpASpNGRIGRYRIATSSDATTWTDRVTD 433 333445666689***************744667888999******************9864434******************99988 PP CBM32.hmm 82 gnttd.gttetitfdkpvtaryvRltvtkra.tna.wgasiaEl 122 g + d + +t+ f+ p+taryvRlt+ + a t w +s+aEl AEV83893.1|AA5_2|CBM32 434 GVFADnPARQTVIFP-PATARYVRLTAVTEAgTRGpW-SSAAEL 475 776654444588999.889********4444455525.999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (959 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 103.35 // Query: AZM93955.1|AA5_2|CBM32 [L=783] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.2e-47 145.3 10.7 6.7e-26 77.4 3.8 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.5 0.6 4.4e-24 4.4e-24 3 122 .. 22 150 .. 18 152 .. 0.76 2 ! 77.4 3.8 6.7e-26 6.7e-26 3 122 .. 173 302 .. 169 304 .. 0.79 Alignments for each domain: == domain 1 score: 71.5 bits; conditional E-value: 4.4e-24 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae..ngrikdykvevStDgktWttv 78 tas +++++++g a+n++Dgd+ t W+s++ +++t+d+ ++ v+++v+++ a+ ngr+ +y++++S Dg++W AZM93955.1|AA5_2|CBM32 22 TASD---EETTGENGRAANVLDGDTATIWHSKWtgtpaplpHSITLDMHRTAVVSALVYQPrAGgaNGRVGEYSISASADGQNWGGP 105 2333...334455578***************75567889999******************9844434*****************988 PP CBM32.hmm 79 aekgnttd.gttetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 +++g+ d + +t f+ p ar+vRlt+++ a + +++s+aEl AZM93955.1|AA5_2|CBM32 106 VATGTLADdASAKTLGFA-PQGARFVRLTASTEAgNRGPWTSAAEL 150 777666554443466777.6679*******5555333444999997 PP == domain 2 score: 77.4 bits; conditional E-value: 6.7e-26 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttv 78 tas + ++++++g a+n++Dgdp t W+s + +++tvd+ ++ v+++v+++ + + gr+ y+v +StDg+t+ AZM93955.1|AA5_2|CBM32 173 TASDE---ETTGESGRAANVLDGDPATIWHSRWtgtpaplpHSITVDMHRTAAVSALVYQPrNDgPnGRAGAYTVTTSTDGTTFGAP 256 33333...34444478***************53356788999******************9843445******************99 PP CBM32.hmm 79 aekgnttd.gtte.titfdkpvtaryvRltvtkra.tnawgasiaEl 122 ++ g++ d +t + t tf+ + +aryvRltvt+ a + +++s+aE+ AZM93955.1|AA5_2|CBM32 257 VAAGTWRDdDT-VkTATFTRTENARYVRLTVTGEAgNRGPWTSAAEI 302 99999988555.536699976789*******9988544444999997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (783 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 89.10 // Query: CRK61066.1|AA5_2|CBM32 [L=1112] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-91 287.9 19.6 7e-27 80.6 0.9 4.4 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 70.4 0.9 1e-23 1e-23 7 122 .. 59 185 .. 55 187 .. 0.76 2 ! 68.1 0.1 5e-23 5e-23 5 121 .. 210 336 .. 204 339 .. 0.77 3 ! 80.6 0.9 7e-27 7e-27 10 123 .. 359 482 .. 353 483 .. 0.80 4 ! 79.4 1.4 1.6e-26 1.6e-26 11 122 .. 508 632 .. 500 634 .. 0.80 Alignments for each domain: == domain 1 score: 70.4 bits; conditional E-value: 1e-23 CBM32.hmm 7 aessssaaggggaenavDgdpntrWss..ag.....qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgn 83 a+s++++a++g a+n++Dgdp t W+s ++ q++tvd+ ++++v+++++t+ + + g+i +y++ S Dg tW ++ g+ CRK61066.1|AA5_2|CBM32 59 ATSEATTASDGRAANVLDGDPATIWHSrfSTatalpQSITVDMRRTQRVSGLSYTPrTGgGnGTIGRYEIRLSVDGATWSAPVSAGT 145 344556677789***************55124579999*****************9833434******************9998776 PP CBM32.hmm 84 ttd.gttetitfdkpvtaryvRltvtkra..tnawgasiaEl 122 d t +t +f+ + ar+vRlt+ + a + w as+ E+ CRK61066.1|AA5_2|CBM32 146 AADdATAKTMSFA-VTGARFVRLTALSEAgdRGPW-ASAGEI 185 5543443366888.3448*******7766423235.777776 PP == domain 2 score: 68.1 bits; conditional E-value: 5e-23 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag.......qwltvdLgkpttvdkvvltw..ae..ngrikdykvevStDgktWttvae 80 s +++ ++g a+n++D +++t W+s + +++t+dL++p+ ++++ + + a+ ngri +y+++vStDg+++ ++ CRK61066.1|AA5_2|CBM32 210 S---DQETLRENGRASNVLDSNAGTIWHSRYvmatplpHSITLDLKAPKVLNGLIYRPrpASsaNGRIGEYRISVSTDGTNFGAPVA 293 2...2334445588***************64455689999*****************99733434******************9999 PP CBM32.hmm 81 kgnttd.gttetitfdkpvtaryvRltvtkra.tna.wgasiaE 121 +g + d t++ f+ pvtaryvRlt+ + a + w + +aE CRK61066.1|AA5_2|CBM32 294 SGVWADdALTKDAAFAGPVTARYVRLTALTEAgNRGpW-STAAE 336 9999863335577999************5545233314.55555 PP == domain 3 score: 80.6 bits; conditional E-value: 7e-27 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag.....qwltvdLgkpttvdkvvltw.ae..ngrikdykvevStDgktWttvaekgnttd.g 87 +s++++++ga+n+vDg+p+t W+s + +++t dL++++ v+++v+t+ ++ ngri +y++ vStDg+t+ +++g++ d g CRK61066.1|AA5_2|CBM32 359 ASDEQAEHGAANLVDGKPDTLWHSRYdtalpHSITADLKREQAVSAIVVTPrSSgvNGRIGQYSIAVSTDGSTFSAPVATGTWADdG 445 3455666*****************744579999*****************9843355********************9999**9988 PP CBM32.hmm 88 ttetitfd.kpvtaryvRltvtkra.tna.wgasiaEla 123 t++ ++ +p taryvRlt+t+ a + w +s+aE++ CRK61066.1|AA5_2|CBM32 446 TPKAALLTgSP-TARYVRLTATTEAgARGpW-SSAAEVH 482 84322333346.59*******7766544426.9999987 PP == domain 4 score: 79.4 bits; conditional E-value: 1.6e-26 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw..aen.grikdykvevStDgktWttvaekgnttd 86 ++++++gg++n++Dg+++t W+s++ +w+t+d+++ + v ++ +t+ +++ gri +y++ vS+Dg+++ ++ g++ d CRK61066.1|AA5_2|CBM32 508 EATGENGGPANVLDGSTGTIWHSKWtapaaplpHWITLDMKSSRAVAGLAVTPrgDSGnGRIGRYEIAVSDDGTNFGAPVAAGTWAD 594 34455589***************755678899********************9853334******************9999999998 PP CBM32.hmm 87 .gttetitfdkpvtaryvRltv.tkratna.wgasiaEl 122 + +t t+++pv+aryvRlt+ t+ + w +s+aE+ CRK61066.1|AA5_2|CBM32 595 sSAVQTATVATPVDARYVRLTAfTEVGNRGpW-SSAAEI 632 444336699999**********7665543425.888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1112 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.90 // Query: QNE29805.1|AA5_2|CBM32 [L=777] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-46 144.2 10.5 2.7e-25 75.4 1.1 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.4 1.1 2.7e-25 2.7e-25 3 122 .. 16 144 .. 12 146 .. 0.76 2 ! 73.0 2.5 1.6e-24 1.6e-24 3 122 .. 167 296 .. 163 298 .. 0.79 Alignments for each domain: == domain 1 score: 75.4 bits; conditional E-value: 2.7e-25 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttv 78 tas +++++++g a+n++Dgd+nt W+s++ ++lt+d+ ++ v+++v+ + a+ + gr+ +y + vS Dg++W t QNE29805.1|AA5_2|CBM32 16 TASD---EETTGENGRAANVLDGDNNTIWHSKWtataaplpHTLTIDMHRTAVVSALVYRPrANgPnGRVGEYAIHVSADGQNWGTP 99 2333...334455578***************75567889999******************9855545*****************999 PP CBM32.hmm 79 aekgnttd.gttetitfdkpvtaryvRltvtkra.tna.wgasiaEl 122 ++g+ d t +t f+ p+ ar+vRlt+ + a + w +s+aE+ QNE29805.1|AA5_2|CBM32 100 LATGTLADdATAKTLGFA-PTGARFVRLTAVTEAgNRGpW-TSAAEI 144 555555443442355776.888********5444343425.899987 PP == domain 2 score: 73.0 bits; conditional E-value: 1.6e-24 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw..aen.grikdykvevStDgktWttv 78 tas +++++++g a+n++Dg++nt W+s++ +++t+d+ ++ v+++v+++ +++ gr+ y+v +StDg t+ QNE29805.1|AA5_2|CBM32 167 TASD---EETTGENGRAANVLDGNANTIWHSKWsgtpaplpHSITIDMHRTAVVSALVYHPrgDGPnGRAGAYTVATSTDGITFGAS 250 2333...334455578***************75567889999******************9853334******************99 PP CBM32.hmm 79 aekgnttd.gttetitfdkpvtaryvRltvtkra..tnawgasiaEl 122 +++g++ d +t +t tf+ + aryvRltvt+ a + w +s+ E+ QNE29805.1|AA5_2|CBM32 251 VASGTWRDdDTAKTATFTRAEHARYVRLTVTSEAggRGPW-TSAGEI 296 999999885553477**977789*******8877422235.777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (777 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 93.52 // Query: QES24434.1|AA5_2|CBM32 [L=783] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-48 148.4 6.8 7.3e-26 77.3 2.9 2.4 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.4 0.1 2.3e-24 2.3e-24 6 122 .. 23 150 .. 18 152 .. 0.76 2 ! 77.3 2.9 7.3e-26 7.3e-26 5 122 .. 173 303 .. 169 305 .. 0.81 Alignments for each domain: == domain 1 score: 72.4 bits; conditional E-value: 2.3e-24 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae..ngrikdykvevStDgktWttvaek 81 ++ ++s +++g a+n++Dg+p t W+s++ +++tvd+ ++ v+++v+ + + ngr+ +y+++vS Dg +W +++ QES24434.1|AA5_2|CBM32 23 ASDEESV-GEDGRAANVLDGNPATIWHSKWtgtpaplpHSITVDMHRTAVVSALVYRPrSVgvNGRVGEYRISVSADGRNWGSPVAT 108 3333444.44478***************75567889999******************9732344*****************999877 PP CBM32.hmm 82 gnttd.gttetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 g+ d g +t f+ p ar+vRlt+ + a + +++s+aEl QES24434.1|AA5_2|CBM32 109 GTLADdGGAKTLGFA-PQGARFVRLTAVTEAgNRGPWSSAAEL 150 766554543467887.6679*******5544343443889887 PP == domain 2 score: 77.3 bits; conditional E-value: 7.3e-26 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw..ae.ngrikdykvevStDgktWttva 79 +++ +++ +++ g a+n++Dgd++t W+s + +++t+d+ ++t v+++v+++ ++ ngr+ y+v +StDg+t+ + QES24434.1|AA5_2|CBM32 173 TASDEETVKEN-GRAANVLDGDATTIWHSRWsgtppaplpHSITIDMHRTTAVSALVYQPrrDGmNGRAGAYTVTTSTDGTTFGAPV 258 33333455555.89***************533567788999******************9863345********************* PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtkra.tnawgasiaEl 122 ++g++ d +t + t tf+ + +ary+Rltvt+ a + ++as+aE+ QES24434.1|AA5_2|CBM32 259 SVGTWRDdDT-VkTATFTRTGSARYIRLTVTGEAgNRGPWASAAEI 303 *****98555.53669*98889********9988544444999997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (783 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.34 // Query: QQD12443.1|CBM32 [L=585] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-23 69.7 3.8 1.6e-23 69.7 3.8 2.2 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.47 0.47 93 107 .. 386 401 .. 369 424 .. 0.46 2 ! 69.7 3.8 1.6e-23 1.6e-23 9 122 .. 460 582 .. 454 584 .. 0.74 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.47 CBM32.hmm 93 tfd.kpvtaryvRltv 107 +++ + + ry+ l++ QQD12443.1|CBM32 386 NVTtRAQKMRYFMLKA 401 2222233456666666 PP == domain 2 score: 69.7 bits; conditional E-value: 1.6e-23 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.aen.grikdykvevStDgktWttvaekg.nttdgt.t 89 ++++ a++g a+n++Dg++nt+W+s + +tvd+++ +tv++++lt+ + + +++++++++vS+++++Wt + + + ++ ++ + QQD12443.1|CBM32 460 NQETGAENGRAANIIDGNANTFWHSRWssnpetypYFITVDMKSSKTVSGFTLTQrN-GsRKVREIEIQVSQNNTNWTNLGTFTlQE--NSvP 549 3444556689***************533445444445*****************642.3499******************8766332..4434 PP CBM32.hmm 90 etitfdkpvtaryvRltvtkra..tnawgasiaEl 122 ++i+++++ + ry++l++++ a + +a++aE+ QQD12443.1|CBM32 550 QNIDLPSTQSFRYFKLVFKS-AfdF-TQNAAMAEV 582 58899966678*******33.2322.333667776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (585 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 38.96 // Query: AXE27502.1|AA5_2|CBM32 [L=783] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-44 138.0 10.0 2.9e-24 72.1 3.4 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.5 0.5 1.9e-23 1.9e-23 6 122 .. 23 150 .. 18 152 .. 0.77 2 ! 72.1 3.4 2.9e-24 2.9e-24 6 122 .. 174 302 .. 169 304 .. 0.81 Alignments for each domain: == domain 1 score: 69.5 bits; conditional E-value: 1.9e-23 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaek 81 ++ +++++++g a+n++Dg++ t W+s++ +++t+d+ ++ v++vv+++ + + gr+ +y v+ StDg +W +++ AXE27502.1|AA5_2|CBM32 23 AS-DEETTGENGRAANVLDGSAATIWHSKWsgtpvplpHSITLDMHRTAVVSAVVYQPrSDgGnGRVGEYAVSLSTDGRNWDSPVAT 108 22.2334445578***************75567899999******************9843334*****************999888 PP CBM32.hmm 82 gnttd.gttetitfdkpvtaryvRltvtkra..tnawgasiaEl 122 g+ d g+t+t f+ p +r+vRlt+ + a + w +s+aE+ AXE27502.1|AA5_2|CBM32 109 GTLADdGSTKTLGFA-PQGTRFVRLTALTEAggRGPW-TSAAEV 150 777776774466776.5557*******5544333346.899987 PP == domain 2 score: 72.1 bits; conditional E-value: 2.9e-24 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw..ae.ngrikdykvevStDgktWttvaek 81 ++ +++++++g a+n++Dg ++t W+s++ +++t+d+ ++ +v+++v+++ ++ ngr+ y+v +StDg+++ +++ AXE27502.1|AA5_2|CBM32 174 AS-DEETTGENGRAANVLDGEASTIWHSKWsgtpsplpHSITLDMHRTAEVSALVYQPrqDYgNGRAGAYTVTTSTDGSSFGAPVAS 259 22.2334445578***************74567889999******************9854544******************99999 PP CBM32.hmm 82 gnttd.gtte.titfdkpvtaryvRltvtkra.tna.wgasiaEl 122 g++ d +t + t tf+ +++ar+vRltvt+ a + w +s+aE+ AXE27502.1|AA5_2|CBM32 260 GTWRDdDT-VkTATFTRTASARFVRLTVTSEAgARGpW-TSAAEI 302 9*998555.5366***8889********9877644425.999997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (783 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.10 // Query: ANZ13601.1|AA5_2|CBM32 [L=851] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-30 91.2 1.0 7.7e-16 44.9 0.4 2.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.4 0.0 2.2e-15 2.2e-15 28 121 .. 108 206 .. 99 222 .. 0.76 2 ! 44.9 0.4 7.7e-16 7.7e-16 29 111 .. 256 346 .. 227 362 .. 0.73 3 ? -3.6 0.0 0.81 0.81 64 80 .. 760 778 .. 754 802 .. 0.63 Alignments for each domain: == domain 1 score: 43.4 bits; conditional E-value: 2.2e-15 CBM32.hmm 28 ntrWssa..g......qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWttvaekgnttd.gtte.titfdkpvtary 102 nt W + + +++t+d+ ++ v+++++ + ++ gr++dy + S+Dgk W ++++g+ + +t + t +f+ p+ +r+ ANZ13601.1|AA5_2|CBM32 108 NTAWPDKrpTtftqrsHSITIDMHNVAVVSGLTYRPlrSG-GRMSDYAIHLSQDGKGWGRAVATGTLANdPT-VkTLSFA-PTGTRF 191 566666433134456789*****************87655.9*****************9988777654344.3255666.7778** PP CBM32.hmm 103 vRltvtkratnawgasiaE 121 vR+t+t+ g s+ E ANZ13601.1|AA5_2|CBM32 192 VRVTATAG----AGISAEE 206 *****552....3455544 PP == domain 2 score: 44.9 bits; conditional E-value: 7.7e-16 CBM32.hmm 29 trWssa.g...qwltvdLgkpttvdkvvltw..ae.ngrikdykvevStDgktWttvaekgnttdgtteti.tfdkpvtaryvRltv 107 rW ++t+d+ +t v+++++++ ++ ng++++y v++StDg+ + +++g+++ g+ ++ tf+ pv aryvRlt+ ANZ13601.1|AA5_2|CBM32 256 DRWPGHlAqqrRSITIDMHHTTVVSGISYQPhlSSaNGQVSQYVVSTSTDGTAFGHPVAVGSWEAGSSVKGaTFTRPVLARYVRLTA 342 2665533134567*****************9763334********************99****8855354459999999******** PP CBM32.hmm 108 tkra 111 t+ + ANZ13601.1|AA5_2|CBM32 343 TNAS 346 6644 PP == domain 3 score: -3.6 bits; conditional E-value: 0.81 CBM32.hmm 64 ykvevStDgk..tWttvae 80 k+++S Dg+ ++ + + ANZ13601.1|AA5_2|CBM32 760 TKLQISADGSiiSFALIRA 778 5899999996445665544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (851 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.17 // Query: BCJ46567.1|AA5_2|CBM32 [L=892] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-64 199.7 6.4 1.3e-25 76.5 0.0 3.6 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.3 0.1 2e-18 2e-18 23 121 .. 2 107 .. 1 110 [. 0.76 2 ! 71.2 0.7 5.6e-24 5.6e-24 8 122 .. 128 256 .. 123 258 .. 0.80 3 ! 76.5 0.0 1.3e-25 1.3e-25 7 122 .. 275 404 .. 270 406 .. 0.80 Alignments for each domain: == domain 1 score: 53.3 bits; conditional E-value: 2e-18 CBM32.hmm 23 vDgdpntrWssag....qwltvdLgkpttvdkvvltw....aengrikdykvevStDgktWttvaekgnttd.gttetitfdkpvta 100 +Dgd t W s++ + + +d g+ v+++++ + a+ gri +y+ve+S+Dg+tW +a +g++ d t +t+tf++ v + BCJ46567.1|AA5_2|CBM32 2 LDGDSATAWLSGTgalpHRVALDTGNRVAVSGLTYLPrpgvAN-GRIGQYRVEISDDGTTWSAAA-TGTFADdATLKTVTFTT-VIT 85 7**********85579999*****************9764333.******************776.55666545435889994.558 PP CBM32.hmm 101 ryvRltv.tkra.tnawgasiaE 121 r+vRl++ t+ a ++ +++aE BCJ46567.1|AA5_2|CBM32 86 RFVRLVAvTE-AgGRSTRSAAAE 107 *******433.212123344555 PP == domain 2 score: 71.2 bits; conditional E-value: 5.6e-24 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStDgktWttvaek 81 s+++aa++g+a+na+Dg++ + W++a+ +++tvd++ + v+++++ + ++ + g i +y++e+StDg tW + a++ BCJ46567.1|AA5_2|CBM32 128 DSEETAAENGAAANALDGNTASIWHTAWsvapaaplpHTFTVDMKVTNLVSGLSYLPrqDGtRnGLIGQYRIETSTDGVTWGPSAAT 214 33455667799***************755677889999******************98533545*******************9999 PP CBM32.hmm 82 gnttd.gttetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 g + d + +t+tf+ p+ ar++Rlt+ + a + +++s+aE+ BCJ46567.1|AA5_2|CBM32 215 GAFIDsQDAQTVTFA-PALARFIRLTALSEAgNRGPWSSAAEI 256 887764444588**9.778********7777433444899987 PP == domain 3 score: 76.5 bits; conditional E-value: 1.3e-25 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStDgktWttvae 80 + s+++aa++g +n++Dgdp t W+sa+ +++t+dL + v ++ + + a + gri +y++ +StDg+tWt+ + BCJ46567.1|AA5_2|CBM32 275 TDSEETAAENGRVANVLDGDPATIWHSAWsvapvpalpHTVTIDLHGSALVGGLAYLPrpAAsGnGRIGRYQIATSTDGTTWTDRLT 361 334455666689***************755678889999******************99733435******************9988 PP CBM32.hmm 81 kgnttd.gttetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 g++ d + +t+ f+ p++aryvRlt+ + a + +++s+aEl BCJ46567.1|AA5_2|CBM32 362 GGTFADsPARQTVIFP-PAPARYVRLTALSEAgNRGPWSSAAEL 404 8888765554588999.7899*******7777433444888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (892 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 105.49 // Query: ALG14969.1|AA5_2|CBM32 [L=777] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-39 121.6 3.9 3e-24 72.0 0.2 2.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 49.6 0.5 2.8e-17 2.8e-17 10 122 .. 25 143 .. 18 145 .. 0.78 2 ! 72.0 0.2 3e-24 3e-24 7 122 .. 163 293 .. 159 295 .. 0.80 Alignments for each domain: == domain 1 score: 49.6 bits; conditional E-value: 2.8e-17 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aen.grikdykvevStD...gktWttvaekgnttdgt 88 s+aag +a+n++D+++ t W sag q +t++++++++v+++++++ a++ g + +kv vS +W t ++ g+ g ALG14969.1|AA5_2|CBM32 25 DSTAAG-TAAANVLDENNATVWTSAGafpQRITINMQAAKSVSGLRYQPaASGaGAVGGFKVFVSATaptPANWGTQVAGGTLAAGA 110 344555.99***************8668999*****************96334599*********75233579*9998776655444 PP CBM32.hmm 89 .tetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 +++++f+ pvt++yv +++t + t+ ga +aEl ALG14969.1|AA5_2|CBM32 111 aEKYVPFP-PVTGQYVTFQAT--SaTGPGGATVAEL 143 34599**9.9**********4..4355566888886 PP == domain 2 score: 72.0 bits; conditional E-value: 3e-24 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssa.g.......qwltvdLgkpttvdkvvltw..ae..n.grikdykvevStDgktWttvae 80 + s+++ +gg++a+na+Dg p++ W+++ + +w+++d+++ + v+++++ + + + g+i y++ vS+D ++ +++ ALG14969.1|AA5_2|CBM32 163 TDSQETRQGGFKATNAIDGEPDSIWHTKfTppaaplpHWIQLDMKASKPVSGLRYLPrqHPtnPnGTIGGYQIFVSDDPNNLGAAVA 249 3445678888*****************7524567899*******************996335436******************9999 PP CBM32.hmm 81 kgnttd.gttetitfdkpvtaryvRltvtkra.tnawg.asiaEl 122 +g ++ ++t+tf+++ t+ryvRlt+t+ a ++ g +s+aE+ ALG14969.1|AA5_2|CBM32 250 VGAWPAtQAEKTVTFPQK-TGRYVRLTATSEAyGGTAGySSAAEI 293 9999853334499***64.69*******99776444442677776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (777 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 103.51 // Query: QEU77579.1|CBM32 [L=378] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-21 63.2 0.1 2.6e-21 62.6 0.1 1.2 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.6 0.1 2.6e-21 2.6e-21 9 95 .. 13 111 .. 6 122 .. 0.78 Alignments for each domain: == domain 1 score: 62.6 bits; conditional E-value: 2.6e-21 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttdgt.t 89 s+++a+++g+a+n++Dgd++t W++ + + lt+dLg++++v++++ + ++ + gri dy+v++StDg tW ++a++g++ dg QEU77579.1|CBM32 13 SEETAGENGSAANVLDGDASTLWHTRWyaatapmpHALTLDLGAAYDVSALRHPPrQTrGhGRIADYRVSTSTDGVTWGPAAATGTFADGAgG 105 3444556689***************533556789999*****************9744557********************998888764432 PP CBM32.hmm 90 etitfd 95 +++ f+ QEU77579.1|CBM32 106 QDVGFT 111 344444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (378 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.31 // Query: QES58657.1|CBM32 [L=783] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-45 141.0 3.5 5e-24 71.3 0.8 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.5 0.1 1.8e-23 1.8e-23 3 122 .. 22 150 .. 18 152 .. 0.77 2 ! 71.3 0.8 5e-24 5e-24 5 122 .. 173 302 .. 169 304 .. 0.79 Alignments for each domain: == domain 1 score: 69.5 bits; conditional E-value: 1.8e-23 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnt 84 tas +++ a++g a+n++Dg++ t W+s++ + +tvd+ +++ v+++v+ + + + gr+ +y+++ StDg W t +++g+ QES58657.1|CBM32 22 TASD---EETGAENGRAANVLDGNTATIWHSKWaptptplpHVITVDMHRTQVVSALVYRPrTNgPnGRVGEYSISLSTDGLGWATPVATGTL 111 2322...334455588***************755667789999*****************9843435*****************999887776 PP CBM32.hmm 85 td.gttetitfdkpvtaryvRltvtkra..tnawgasiaEl 122 d +++t f+ p ar+vRlt+ + a + w +s+aE+ QES58657.1|CBM32 112 ADdASPKTLGFA-PQGARFVRLTALTEAggRGPW-SSAAEI 150 654544577887.6679*******5544333345.889887 PP == domain 2 score: 71.3 bits; conditional E-value: 5e-24 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw..ae.ngrikdykvevStDgktWttvaekgnttd 86 +++ +++ a++g a+n++Dg+++t W+s++ +++t+d+ ++ v+++v+++ ++ ngr+ y+v +S Dg t+ +++g++ d QES58657.1|CBM32 173 AASD-EETGAENGRAANVLDGKDSTIWHSKYaptptplpHSITIDMHRTEVVSALVYHPrpDGpNGRAGAYTVATSADGVTYGAPVASGTWRD 264 3332.334445588***************74455779999******************9864434******************999999*998 PP CBM32.hmm 87 .gtte.titfdkpvtaryvRltvtkra..tnawgasiaEl 122 +t + t tf+ +++ar+vRlt+t+ a + w +s+ E+ QES58657.1|CBM32 265 dDT-VkTATFTRATSARFVRLTATGEAggRGPW-TSAGEI 302 555.5366***9999********8877422235.776665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (783 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 89.33 // Query: QSY52727.1|AA5_2|CBM32 [L=783] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.4e-46 141.5 7.2 1.5e-25 76.2 1.1 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.9 0.6 5.9e-23 5.9e-23 7 123 .. 17 145 .. 12 146 .. 0.77 2 ! 76.2 1.1 1.5e-25 1.5e-25 6 122 .. 167 298 .. 163 300 .. 0.81 Alignments for each domain: == domain 1 score: 67.9 bits; conditional E-value: 5.9e-23 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekg 82 a+ +++a g++ a+n++Dg++ t W+s + ++l++d+ ++ v+++ +++ a + gri +y + S Dg++W ++++g QSY52727.1|AA5_2|CBM32 17 ASDEETARGDNRAANVLDGKAETIWHSRWsesaaalpHSLVIDMHRTEVVSALLYQPrADgPnGRIGEYAIHLSADGQNWGAAVASG 103 333445566688***************533567789999*****************9843435******************998887 PP CBM32.hmm 83 nttd.gttetitfdkpvtaryvRltvtkra.tna.wgasiaEla 123 + d tt+t +f+ + +ryvRlt+t+ a + w +s+aE++ QSY52727.1|AA5_2|CBM32 104 TLADdATTKTLSFA-ARGTRYVRLTATSEAgKRGpW-SSAAEIQ 145 76654553355776.4557*******9977644425.9999975 PP == domain 2 score: 76.2 bits; conditional E-value: 1.5e-25 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw..ae..n.grikdykvevStDgktWttva 79 sa+ +++a++++ a+n++Dgd++t W+s + +++t+d+ +++tv+++++++ ++ + gri y+v +S Dg ++ + QSY52727.1|AA5_2|CBM32 167 SASDEETAQADNRAANVLDGDADTLWHSRWsggatplpHSVTIDMHRTQTVSALTYQPrkSGggPnGRIGAYSVATSLDGVSFGAPV 253 4444566677799***************53345678999*******************97335546******************999 PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtkra.tnawgasiaEl 122 + g ++d +t + ++tf+ p++ar+vRlt+t+ a + +++s+aE+ QSY52727.1|AA5_2|CBM32 254 AGGVWKDdDT-VkSTTFTRPTPARFVRLTATTEAgNRGPWSSAAEI 298 9999998555.5477***999*********8877443444889987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (783 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.94 // Query: QEU82702.1|AA5_2|CBM32 [L=782] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-42 131.5 9.4 9.8e-23 67.2 3.6 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.8 0.3 1.3e-22 1.3e-22 4 122 .. 23 150 .. 18 152 .. 0.77 2 ! 67.2 3.6 9.8e-23 9.8e-23 4 122 .. 174 302 .. 169 304 .. 0.77 Alignments for each domain: == domain 1 score: 66.8 bits; conditional E-value: 1.3e-22 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttva 79 as +++a+++g a+n++Dg+++t W+s + +++t+d ++ v+++v+ + ++ gr+ +y v+ StDg +W + + QEU82702.1|AA5_2|CBM32 23 ASD---EETAGENGRAANVLDGNATTLWHSRWsapaapfpHSITIDTHRTAVVSALVYLPrSGvAnGRVGEYAVSLSTDGRSWGDPV 106 222...334445577***********999953356678899******************9844534********************9 PP CBM32.hmm 80 ekgnttd.gttetitfdkpvtaryvRltvtkra.tna.wgasiaEl 122 ++g+ d g+ +t f+ p ar+vRlt+ + a + w +s+aE+ QEU82702.1|AA5_2|CBM32 107 ATGTLADdGSAKTLGFA-PQGARFVRLTALTEAgNRGpW-TSAAEI 150 88877776774466887.6679*******5555343425.999997 PP == domain 2 score: 67.2 bits; conditional E-value: 9.8e-23 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw..ae.ngrikdykvevStDgktWttva 79 as +++a+++g a+n++Dg+++t W+s + +++t+d ++t v+++v+++ ++ ngr+ y+v +S Dg t+ + QEU82702.1|AA5_2|CBM32 174 ASD---EETAGENGRAANVLDGNATTLWHSRWsapaapfpHSITIDTHRTTAVSALVYHPrpDGaNGRAGAYTVTTSADGATFGAPV 257 222...334445577***********999953356678899******************9873334******************999 PP CBM32.hmm 80 ekgnttd.gtte.titfdkpvtaryvRltvtkra..tnawgasiaEl 122 ++g++ d +t + t tf+ + +ar+vRltvt+ a + w +s+ E+ QEU82702.1|AA5_2|CBM32 258 ATGTWRDdDT-VkTATFTRTENARFVRLTVTSEAggRGPW-TSAGEI 302 999*998555.536699976789*******8877422235.777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (782 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 90.92 // Query: ATO81963.1|AA5_2|CBM32 [L=959] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-65 205.7 10.7 6.8e-25 74.1 0.1 3.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.8 1.5 2.1e-21 2.1e-21 13 121 .. 63 179 .. 57 182 .. 0.79 2 ! 73.5 0.2 1.1e-24 1.1e-24 6 122 .. 198 328 .. 194 330 .. 0.80 3 ! 74.1 0.1 6.8e-25 6.8e-25 7 122 .. 347 475 .. 343 477 .. 0.79 Alignments for each domain: == domain 1 score: 62.8 bits; conditional E-value: 2.1e-21 CBM32.hmm 13 aaggggaenavDgdpntrWssag....qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttet 91 ++g+ +a++a+Dg ++t W s++ + l +d g+ v+++++ + a+ gri +y+v++S++g+tW +++g++ d t +t ATO81963.1|AA5_2|CBM32 63 DSGQTSAAKAIDGAAGTAWLSGTtalpHRLAIDTGNRVAVSGLTYLPrAStAtGRIGRYRVQTSDNGTTWAAPVATGTFADdATLKT 149 345588***************85579999*****************9844445******************9998989876555348 PP CBM32.hmm 92 itfdkpvtaryvRltvtkra.tnawgasiaE 121 +tf + v +ryvRl++ + a + +++aE ATO81963.1|AA5_2|CBM32 150 VTFGT-VITRYVRLVAVTEAgNRGRQVAAAE 179 89984.558*******443322233355555 PP == domain 2 score: 73.5 bits; conditional E-value: 1.1e-24 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStDgktWttva 79 +a s+++aa++g+a+na+Dgd+++ W++a+ +++tvd+ + v+++++ + ++ + g i +y++e+S+Dg+tW ++a ATO81963.1|AA5_2|CBM32 198 TADSQETAAANGAAANALDGDTRSIWHTAYsvapaaplpHTFTVDMRVTNLVSGLSYLPrqDGgRnGLIGRYRIETSMDGTTWGPAA 284 3334455566699***************744567788999******************98633545********************9 PP CBM32.hmm 80 ekgnttd.gttetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 ++g + d + +t+tf+ p+ ar+vR+t+ + a + +++s+aE+ ATO81963.1|AA5_2|CBM32 285 ATGAFIDsQDAQTVTFA-PALARFVRITALSEAgNRGPWSSAAEI 328 99887764444588**9.778********7777433444889987 PP == domain 3 score: 74.1 bits; conditional E-value: 6.8e-25 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw..ae.ngrikdykvevStDgktWttvaek 81 a s+++aa++g a n++Dgdp t W+sa+ +++tvdL + v ++++ + a+ ngri +y++ +S+D +tWt+ ++ ATO81963.1|AA5_2|CBM32 347 ADSEETAAENGRAVNVLDGDPATIWHSAWsatpvpglpHSVTVDLHHAVPVGGLSYLPrpASpNGRIGRYRIATSSDATTWTDRVTD 433 333445666689***************744667888999******************9864434******************99988 PP CBM32.hmm 82 gnttd.gttetitfdkpvtaryvRltvtkra.tna.wgasiaEl 122 g + d + +t+ f+ p+taryvRlt+ + a t w +s+aEl ATO81963.1|AA5_2|CBM32 434 GVFADnPARQTVIFP-PATARYVRLTAVTEAgTRGpW-SSAAEL 475 776654444588999.889********4444455525.999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (959 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.68 // Query: APU44849.1|AA5_2|CBM32 [L=777] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-46 142.1 9.8 9.3e-25 73.7 1.1 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.7 1.1 9.3e-25 9.3e-25 3 122 .. 16 144 .. 12 146 .. 0.76 2 ! 72.4 2.1 2.4e-24 2.4e-24 3 122 .. 167 296 .. 163 298 .. 0.79 Alignments for each domain: == domain 1 score: 73.7 bits; conditional E-value: 9.3e-25 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttv 78 tas +++++++g a+n++Dgd+nt W+s++ +++t+d+ ++ v+++v+ + + + gr+ +y ++vS Dg tW + APU44849.1|AA5_2|CBM32 16 TASD---EETTGENGRAANVLDGDANTIWHSKWtaptaplpHSITIDMHRTAVVSALVYRPrTNgPnGRVGEYAISVSADGRTWGSA 99 2333...334455578***************75567789999******************9843435*****************999 PP CBM32.hmm 79 aekgnttd.gttetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 ++g+ d t +t f+ p+ ar+vRlt+++ a + +++s+aE+ APU44849.1|AA5_2|CBM32 100 LATGTLADdATAKTLGFA-PTGARFVRLTAQSEAgNRGPWTSAAEI 144 555555443442355776.888********7766433444999997 PP == domain 2 score: 72.4 bits; conditional E-value: 2.4e-24 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttv 78 tas +++++++g a+n++Dgd+nt W+s + +++t+d+ ++ v+++v+++ ++ + gr+ y+v +StDg ++ + APU44849.1|AA5_2|CBM32 167 TASD---EETTGENGRAANVLDGDANTIWHSRWtapaaplpHSITIDMHRTAVVSALVYHPrGNgPnGRAGAYTVATSTDGISFGAA 250 2333...334455578***************54456778999******************9844445******************** PP CBM32.hmm 79 aekgnttd.gttetitfdkpvtaryvRltvtkra..tnawgasiaEl 122 +++g + d +t +t tf+ ++ aryvRltvt+ a + w +s+ E+ APU44849.1|AA5_2|CBM32 251 VASGAWRDdDTAKTATFTRAAHARYVRLTVTTEAggRGPW-TSAGEI 296 999999885554477***8899********7766422235.776665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (777 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.30 // Query: AVZ77018.1|CBM32 [L=450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-11 30.2 0.4 7.5e-11 28.8 0.4 1.7 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.8 0.4 7.5e-11 7.5e-11 8 78 .. 125 206 .. 120 225 .. 0.82 Alignments for each domain: == domain 1 score: 28.8 bits; conditional E-value: 7.5e-11 CBM32.hmm 8 essssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttv 78 +s +++++++ga+ +Dgdp++ W+ ++ +++t+d ++ v+++v+ + + + gri +y+v g +W ++ AVZ77018.1|CBM32 125 ASDEETTTDNGAALGLDGDPDNLWHRTWygtaasfpHSITIDKHRTAVVSALVYRPrTGsTnGRIGKYTVHLKPEGGDWGPA 206 33445666689***************74456788999******************9833434***********9999**876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (450 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.99 // Query: ARE79312.1|AA5_2|CBM32 [L=783] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-46 142.1 5.2 2.5e-25 75.5 1.3 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.7 0.1 6.8e-23 6.8e-23 4 122 .. 23 150 .. 18 152 .. 0.74 2 ! 75.5 1.3 2.5e-25 2.5e-25 3 122 .. 173 302 .. 169 304 .. 0.78 Alignments for each domain: == domain 1 score: 67.7 bits; conditional E-value: 6.8e-23 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttva 79 as +++a+++g a+n++Dg+ nt W+s + + +tvd+ ++ v+++v+ + + + gr+ +y+++ StDg++W + ARE79312.1|AA5_2|CBM32 23 ASD---EETAGENGRAANVLDGNVNTLWHSRWtgtpaplpHVITVDMHRTAVVSALVYRPrTNgPnGRVGEYSISLSTDGQNWASPV 106 222...334445577***************533567789999*****************9843435*****************9997 PP CBM32.hmm 80 ekgnttd.gttetitfdkpvtaryvRltvtkra..tnawgasiaEl 122 ++g+ d +t f+ p r+vRlt+ + a + w +s+aE+ ARE79312.1|AA5_2|CBM32 107 ATGTLADdAGAKTLGFA-PQGSRFVRLTALSEAggRGPW-SSAAEI 150 76655432223466887.5546*******7766423235.888887 PP == domain 2 score: 75.5 bits; conditional E-value: 2.5e-25 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw..aen.grikdykvevStDgktWttv 78 tas +e +++++ g a+n++Dg++nt W+s++ +++t+d+ ++ v+++v+++ +++ gr+ y++ +StDg+t+ ARE79312.1|AA5_2|CBM32 173 TASDEE--TGSEN-GRAANVLDGNDNTIWHSKWapaptplpHSITIDMHRTAAVSALVYHPrpDGSnGRAGAYSIATSTDGSTFGAP 256 333333..33334.78***************75567789999******************9863334******************99 PP CBM32.hmm 79 aekgnttd.gtte.titfdkpvtaryvRltvtkra..tnawgasiaEl 122 ++ g++ d +t + t tf + taryvRltvt+ a + w +s+ E+ ARE79312.1|AA5_2|CBM32 257 VAAGTWRDdDT-VkTATFLRAETARYVRLTVTSEAggRGPW-TSAGEI 302 99999987554.43558877778********8877422235.777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (783 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 91.34 // Query: QTI43626.1|AA5_2|CBM32 [L=851] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-45 140.0 4.2 1e-24 73.5 1.5 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.5 0.1 1.6e-22 1.6e-22 7 122 .. 91 218 .. 86 220 .. 0.76 2 ! 73.5 1.5 1e-24 1e-24 3 122 .. 241 370 .. 237 372 .. 0.79 Alignments for each domain: == domain 1 score: 66.5 bits; conditional E-value: 1.6e-22 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw..aen.grikdykvevStDgktWttvaekg 82 a+ +++aa++g a+n++Dg++ t W+s++ + +tvd+ +++ v+++ + + +++ gr+ +y+++ S Dg +W t +++g QTI43626.1|AA5_2|CBM32 91 ASDEETAAENGRASNVLDGNTATIWHSKYaptptplpHVITVDMHRTQVVSALIYRPrtDGPnGRVGEYSISLSPDGLSWATPVATG 177 233345556689***************744557789999*****************9853334*****************9998776 PP CBM32.hmm 83 nttdgt.tetitfdkpvtaryvRltvtkra..tnawgasiaEl 122 + d+ ++t f+ p ar+vRlt+ + a +aw +s+aE+ QTI43626.1|AA5_2|CBM32 178 TLADDVsPKTLGFA-PQGARFVRLTALSEAgaRGAW-SSAAEI 218 65432223466887.6679*******6655534457.888887 PP == domain 2 score: 73.5 bits; conditional E-value: 1e-24 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttv 78 tas +++ a++g a+n++Dg+++t W+s++ +++t+d+ ++ v+++v+++ ++ + gr+ y+v +S Dg t+ t QTI43626.1|AA5_2|CBM32 241 TASD---EETGAENGRASNVLDGKDGTIWHSKYaptptplpHSITIDMHRTEAVSALVYHPrSTgPnGRAGAYTVATSADGVTFGTP 324 2322...334455588***************74455779999******************9854545******************** PP CBM32.hmm 79 aekgnttd.gtte.titfdkpvtaryvRltvtkra..tnawgasiaEl 122 ++ g++ d +t + t tf+ +++ar+vRltvt+ a + w +s+ E+ QTI43626.1|AA5_2|CBM32 325 VAAGTWRDdDT-VkTATFTRTASARFVRLTVTSEAggRGPW-TSAGEI 370 99999998555.5366***8889********8877422235.777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (851 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.22 // Query: QEV50223.1|CBM32 [L=787] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-44 135.6 6.7 2.1e-23 69.4 1.4 3.0 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.8 0.1 6.2e-23 6.2e-23 11 122 .. 27 152 .. 19 154 .. 0.73 2 ! 69.4 1.4 2.1e-23 2.1e-23 10 122 .. 179 304 .. 170 306 .. 0.79 3 ? -1.9 0.0 0.24 0.24 58 74 .. 558 575 .. 520 593 .. 0.65 Alignments for each domain: == domain 1 score: 67.8 bits; conditional E-value: 6.2e-23 CBM32.hmm 11 ssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw..aen.grikdykvevStDgktWttvaekg..nttd.gtt 89 ++++++g a+n++Dg+++t W+s++ ++lt+d+ ++ v+++v+ + +++ gr+ +y ++vStDg +W ++ ++ + d g+ QEV50223.1|CBM32 27 ETSGENGRAANVLDGNTGTIWHSKWagtpaplpHTLTIDMHRTAVVSALVYLPrtDGPnGRVGEYGISVSTDGRNWAEANPVAsgTLADdGSA 119 23344478***************75567889999******************9853334*****************88854331133333433 PP CBM32.hmm 90 etitfdkpvtaryvRltvtkra..tnawgasiaEl 122 +t f+ p ar+vRlt+ + a + w +s+aE+ QEV50223.1|CBM32 120 KTLGFA-PQGARFVRLTALTEAggRGPW-TSAAEI 152 366777.6679*******5544333346.899997 PP == domain 2 score: 69.4 bits; conditional E-value: 2.1e-23 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw..ae.ngrikdykvevStDgktWttvaekgnttd.gtte 90 +++++++g a+n++Dgd+nt W+s + +++t+d+ ++ v+++v+++ ++ ngr+ y++ +StDg+ + ++ g++ d +t + QEV50223.1|CBM32 179 EETTGENGRAANVLDGDANTLWHSRWsgtpaplpHSITIDMHRTAAVSALVYHPrlDGgNGRAGAYTITTSTDGTAFGAPVAAGTWRDdDT-V 270 334455578***************53356788999******************9874334******************9999999987554.4 PP CBM32.hmm 91 .titfdkpvtaryvRltvtkra..tnawgasiaEl 122 t tf + tar++Rltvt+ a + w +s+aE+ QEV50223.1|CBM32 271 kTATFLRTETARFIRLTVTSEAggRGPW-TSAAEI 304 35577766689*******9977523235.999997 PP == domain 3 score: -1.9 bits; conditional E-value: 0.24 CBM32.hmm 58 n.grikdykvevStDgkt 74 + + + y+v++S+ g t QEV50223.1|CBM32 558 TpATRRAYTVSISDGGRT 575 245667999999987744 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (787 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 106.47 // Query: ANP56735.1|AA5_2|CBM32 [L=783] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-48 150.9 12.0 1.7e-26 79.3 3.3 2.7 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.8 1.5 2.1e-25 2.1e-25 7 122 .. 23 150 .. 19 152 .. 0.77 2 ! 79.3 3.3 1.7e-26 1.7e-26 3 122 .. 173 302 .. 170 304 .. 0.77 Alignments for each domain: == domain 1 score: 75.8 bits; conditional E-value: 2.1e-25 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekg 82 a+ +++aa++g a+n+ Dgd+ t W+s++ +++t+d+ ++ v+++v+++ a + gri +y++ S+Dg tW + +++g ANP56735.1|AA5_2|CBM32 23 ASDQENAAEDGRAANVMDGDTATIWHSKWsgtptalpHSITIDMHRTAVVSAIVYWPrAVsPnGRIGTYEIRLSNDGRTWSEPVASG 109 333456667788***************74466789999******************9843434********************9887 PP CBM32.hmm 83 nttd.gtte.titfd.kpvtaryvRltvtkra..tnawgasiaEl 122 + d t + t +f+ + +ryvRlt+ + a + w as+aEl ANP56735.1|AA5_2|CBM32 110 TLADdAT-VkTLSFAaQ--GTRYVRLTALTEAggRGPW-ASAAEL 150 7765444.435677733..36*******5544333346.999997 PP == domain 2 score: 79.3 bits; conditional E-value: 1.7e-26 CBM32.hmm 3 tassaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw..aen.grikdykvevStDgktWttv 78 tas + +s+a++g a+n++Dgd++t W+s++ +++t+d+++p+tv+++++++ +++ gri ++v +S+Dg+++ ANP56735.1|AA5_2|CBM32 173 TASDE---ESSAEDGRAANVLDGDADTIWHSKWssstaalpHSITIDMKRPRTVSELTYQPrqDSTnGRIGAFTVTTSSDGTSFGAP 256 33333...33445578***************74456789999******************9852334******************99 PP CBM32.hmm 79 aekgnttd.gttetitfdkpvtaryvRltvtkra..tnawgasiaEl 122 +++g++ d +t + +f pvtaryvRlt+t+ a + w +s+aE+ ANP56735.1|AA5_2|CBM32 257 VASGTWADdDTIKGASFIRPVTARYVRLTATTEAggRGPW-SSAAEI 302 9999*987443223355599**********7766423235.889887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (783 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.53 // Query: QCO99490.1|CBM32 [L=383] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-43 133.2 11.8 3.2e-25 75.2 3.1 2.1 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.2 1.5 1.7e-21 1.7e-21 5 120 .. 67 193 .. 63 197 .. 0.79 2 ! 75.2 3.1 3.2e-25 3.2e-25 6 122 .. 220 348 .. 216 350 .. 0.80 Alignments for each domain: == domain 1 score: 63.2 bits; conditional E-value: 1.7e-21 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae..ngrikdykvevStDgktWttvaekgnttd 86 s++ +++++++g a+n++Dg+++ W+s++ +++ +d + +++++++++ + ++ ngri ++++ vSt+g+t t++++g++ d QCO99490.1|CBM32 67 SAS-DEETSGENGRASNVLDGKAGAIWHSKWtapavplpHTIRIDTKVTQSISGFRYLPrSSgaNGRIGSFEILVSTNGTTQGTLVASGTWAD 158 333.3344445588***************75567889999******************9843334********************9999**99 PP CBM32.hmm 87 .gttetitfdkpvtaryvRltvtkra.tna.wgasia 120 g+++++tf+ +v+a+yvRl++++ a + w +s+a QCO99490.1|CBM32 159 tGDEKSVTFA-TVSAQYVRLRAITEAgNRGpW-SSAA 193 8885588998.699********7766333314.4444 PP == domain 2 score: 75.2 bits; conditional E-value: 3.2e-25 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw..aen.grikdykvevStDgktWttvaekgnttd 86 sa+ ++ ++g+g a+n++Dg++ t W+s + q+lt+d+g + +v+++++ + +++ gr+ y++ vS++g tW++v ++g+++d QCO99490.1|CBM32 220 SASDEEVTSGNGRAANVLDGSAATIWHSRWspapaaplpQSLTIDMGVENQVSGFRYLPrsDGSnGRVGAYSIDVSSNGATWRVV-TSGTWPD 311 4445667778799***************534556778999******************9852334******************77.5779987 PP CBM32.hmm 87 .gtte.titfdkpvtaryvRltvtkra.tnawgasiaEl 122 + e t +f+ +v+a yvRlt+t+ a + +++s+aE+ QCO99490.1|CBM32 312 tSA-EkTANFT-AVSAWYVRLTATTEAgNRGPWSSAAEI 348 444.4377998.89*********8877443444899987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (383 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.02 // Query: QKM66471.1|AA5_2|CBM32 [L=782] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-47 144.8 12.0 2.3e-26 78.9 5.9 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.9 0.3 2.9e-23 2.9e-23 4 122 .. 23 150 .. 19 152 .. 0.75 2 ! 78.9 5.9 2.3e-26 2.3e-26 7 122 .. 174 302 .. 169 304 .. 0.79 Alignments for each domain: == domain 1 score: 68.9 bits; conditional E-value: 2.9e-23 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttva 79 as +++aa++g a+n++Dg++ t W+s + +++t+d++++ v+++v+ + + + gr+ +y+++ S Dg++W + QKM66471.1|AA5_2|CBM32 23 AS---DEETAAENGRAANVLDGNAATIWHSRYagtsaplpHSITIDMNRTAVVSGLVYLPrNDgPnGRVGEYSISMSADGQNWGSPV 106 22...3345566689***************53335678999******************9843445*****************9998 PP CBM32.hmm 80 ekgnttd.gttetitfdkpvtaryvRltvtkra.tna.wgasiaEl 122 ++g+ d +t f+ p+ ar+vRlt+ + a + w + +aEl QKM66471.1|AA5_2|CBM32 107 ATGTLADdAAAKTLGFA-PTGARFVRLTAVTEAgNRGpW-TTAAEL 150 77766543333466776.8889*******4444233324.666665 PP == domain 2 score: 78.9 bits; conditional E-value: 2.3e-26 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekg 82 a+ +++aa++g a+n++Dg++ t W+s + +++t+d++++t v+++v+++ + + gr+ y+v +StDg+t+ t ++ g QKM66471.1|AA5_2|CBM32 174 ASDEETAAENGRAANVLDGNAATIWHSRYagtsaplpHSITIDMNRTTAVSALVYQPrNDgPnGRAGAYTVTTSTDGTTFGTPVAAG 260 233345556689***************53335678999******************9843445********************9999 PP CBM32.hmm 83 nttd.gtte.titfdkpvtaryvRltvtkra.tna.wgasiaEl 122 ++ d +t + t tf+ ++taryvRlt+t+ a + w + +aE+ QKM66471.1|AA5_2|CBM32 261 TWRDdDT-VkTATFTRTATARYVRLTATGEAgNRGpW-TTAAEI 302 9998555.5366***7789********9877433324.666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (782 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 87.11 // Query: CUM37197.1|AA5_2|CBM32 [L=770] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-47 145.5 10.3 1.2e-25 76.6 2.3 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.0 1.2 1.5e-24 1.5e-24 6 122 .. 11 138 .. 6 140 .. 0.75 2 ! 76.6 2.3 1.2e-25 1.2e-25 6 122 .. 162 290 .. 157 292 .. 0.81 Alignments for each domain: == domain 1 score: 73.0 bits; conditional E-value: 1.5e-24 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw....aengrikdykvevStDgktWttvae 80 ++ +++ ++ g a+n++Dg++ t W+s++ +++tvd+ ++t v+++v+++ a ngr+ +y+++vS Dg +W ++ CUM37197.1|AA5_2|CBM32 11 ASDEETVGEN-GRAANVLDGNTATAWHSKWtgtpaglpHSITVDMHRTTVVSALVYQPrtvgA-NGRVGEYSISVSADGRNWGSPVA 95 2222344444.88***************74467788999******************975433.3*****************99977 PP CBM32.hmm 81 kgnttd.gttetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 +g+ d +t f+ p ar+vRlt+ + a + +++s+aE+ CUM37197.1|AA5_2|CBM32 96 TGTLADdAGAKTLGFA-PQGARFVRLTAVTEAgNRGPWSSAAEI 138 7655432223466887.6679*******5544343443889987 PP == domain 2 score: 76.6 bits; conditional E-value: 1.2e-25 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw....aengrikdykvevStDgktWttvae 80 ++ +++ ++ g a+n++Dgd+ t W+s + +++t+d+ + v+++v+++ a ngr+ y++ vStDg+++ + ++ CUM37197.1|AA5_2|CBM32 162 ASDEETVREN-GRAANVLDGDAATIWHSRWsgtpaplpHSITIDMHRRAAVSALVYQPrrdvA-NGRVGAYTITVSTDGTHFGEPVA 246 3333455555.88***************53356788999******************976433.3********************99 PP CBM32.hmm 81 kgnttd.gtte.titfdkpvtaryvRltvtkra.tnawgasiaEl 122 +g++ d +t + t tf+ +++aryvRltvt a + +++s+aE+ CUM37197.1|AA5_2|CBM32 247 TGTWRDdDT-VkTATFTRAAKARYVRLTVTREAgNRGPWTSAAEI 290 99*998555.5366***999*********8877543444999997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (770 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 114.87 // Query: AWZ18053.1|AA5_2|CBM32 [L=783] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-45 139.1 11.1 1.4e-24 73.2 1.3 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 73.2 1.3 1.4e-24 1.4e-24 6 122 .. 23 151 .. 18 153 .. 0.75 2 ! 70.1 2.7 1.2e-23 1.2e-23 6 122 .. 175 303 .. 170 305 .. 0.78 Alignments for each domain: == domain 1 score: 73.2 bits; conditional E-value: 1.4e-24 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw...aen.grikdykvevStDgktWttvae 80 ++ +++a+++g a n++Dgd nt W+s + +++t+d+ ++ v+++v+ + a+ gri +y+++vStDg++W ++ AWZ18053.1|AA5_2|CBM32 23 AS-DEETAGENGRAVNVLDGDVNTMWHSRWtapaaplpHTITIDMHRTAVVSALVYVPrtiAWAnGRIGEYSISVSTDGQNWGNPVA 108 22.2333444477***************54456778999******************98653224*****************99987 PP CBM32.hmm 81 kgnttd.gttetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 +g+ d t+t f+ p+ ar++Rlt+ + a + +++s+aE+ AWZ18053.1|AA5_2|CBM32 109 TGTLADdAATKTLGFA-PTGARFIRLTAATEAgNRGPWTSAAEI 151 7766543333355665.888********4444333443999997 PP == domain 2 score: 70.1 bits; conditional E-value: 1.2e-23 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae..ngrikdykvevStDgktWttvaek 81 ++ +++a+++g a n++Dgd+nt W+s + +++t+d+ ++ v+++v++ a+ ngr+ y++ +St+g+t+ +++ AWZ18053.1|AA5_2|CBM32 175 AS-DEETAGENGRAVNVLDGDANTMWHSRYagtpaplpHTITIDMHRTAAVSALVYHSrASgvNGRAGGYTITTSTNGTTFGSPVAV 260 22.2333444477***************53345678999******************7633445********************99* PP CBM32.hmm 82 gnttd.gtte.titfdkpvtaryvRltvtkra.tnawgasiaEl 122 g+++d +t + t tf + ++r+vRltvt+ a + +++s+aE+ AWZ18053.1|AA5_2|CBM32 261 GTWKDdNT-VkTATFIRTENVRFVRLTVTSEAgNRGPWTSAAEI 303 ***99887.435688855578*******9988544444999997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (783 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 113.63 // Query: QDY81388.1|AA5_2|CBM32 [L=782] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-47 145.3 12.4 1.6e-26 79.4 6.3 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.9 0.3 2.9e-23 2.9e-23 4 122 .. 23 150 .. 19 152 .. 0.75 2 ! 79.4 6.3 1.6e-26 1.6e-26 7 122 .. 174 302 .. 169 304 .. 0.79 Alignments for each domain: == domain 1 score: 68.9 bits; conditional E-value: 2.9e-23 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttva 79 as +++aa++g a+n++Dg++ t W+s + +++t+d++++ v+++v+ + + + gr+ +y+++ S Dg++W + QDY81388.1|AA5_2|CBM32 23 AS---DEETAAENGRAANVLDGNAATIWHSRYagtsaplpHSITIDMNRTAVVSGLVYLPrNDgPnGRVGEYSISMSADGQNWGSPV 106 22...3345566689***************53335678999******************9843445*****************9998 PP CBM32.hmm 80 ekgnttd.gttetitfdkpvtaryvRltvtkra.tna.wgasiaEl 122 ++g+ d +t f+ p+ ar+vRlt+ + a + w + +aEl QDY81388.1|AA5_2|CBM32 107 ATGTLADdAAAKTLGFA-PTGARFVRLTAVTEAgNRGpW-TTAAEL 150 77766543333466776.8889*******4444233324.666665 PP == domain 2 score: 79.4 bits; conditional E-value: 1.6e-26 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekg 82 a+ +++aa++g a+n++Dg++ t W+s + +++t+d++++t v+++v+++ + + gr+ y+v +StDg+t+ t +++g QDY81388.1|AA5_2|CBM32 174 ASDEETAAENGRAANVLDGNAATIWHSRYagtsaplpHSITIDMNRTTAVSALVYQPrNDgPnGRAGAYTVTTSTDGTTFGTPVATG 260 233345556689***************53335678999******************9843445********************9999 PP CBM32.hmm 83 nttd.gtte.titfdkpvtaryvRltvtkra.tna.wgasiaEl 122 ++ d +t + t tf+ ++taryvRlt+t+ a + w + +aE+ QDY81388.1|AA5_2|CBM32 261 TWRDdDT-VkTATFTRTATARYVRLTATGEAgNRGpW-TTAAEI 302 *998555.5366***7789********9877433324.666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (782 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.30 // Query: QES52170.1|CBM32 [L=782] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-46 142.8 9.5 7.6e-25 74.0 4.4 2.6 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.0 0.2 6.4e-24 6.4e-24 4 122 .. 23 150 .. 18 152 .. 0.75 2 ! 74.0 4.4 7.6e-25 7.6e-25 10 122 .. 177 302 .. 169 304 .. 0.80 Alignments for each domain: == domain 1 score: 71.0 bits; conditional E-value: 6.4e-24 CBM32.hmm 4 assaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw..ae.ngrikdykvevStDgktWttvaekgntt 85 as +++a+++g a+n++Dgd+ t W+s++ +++t+d+ ++ v+++v+++ ++ ngr+ +y+++ S Dg++W +++g+ QES52170.1|CBM32 23 ASD---EETAGENGRAANVLDGDTATLWHSKWtgtpaplpHSITIDMHRTAVVSALVYHPrtNGaNGRPGEYRISLSGDGQNWGSPVATGTLA 112 222...334445577***************75567889999******************9853334*****************9997776554 PP CBM32.hmm 86 d.gttetitfdkpvtaryvRltvtkra.tna.wgasiaEl 122 d +t f+ p ar+vRlt+ + a + w +s+aEl QES52170.1|CBM32 113 DdAGAKTLGFA-PQGARFVRLTAVTEAgNRGpW-TSAAEL 150 32223466887.6679*******5544343425.999997 PP == domain 2 score: 74.0 bits; conditional E-value: 7.6e-25 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae..ngrikdykvevStDgktWttvaekgnttd.gtte 90 +++++++g a+n++Dgd+ t W+s++ +++tvd+ ++t v+++v+++ + ngr+ y++ +StDg+t+ ++ g++ d +t + QES52170.1|CBM32 177 EETTGENGRAANVLDGDAATIWHSKWsgtpaplpHSITVDMHRTTAVSALVYQPrNDglNGRAGAYTITTSTDGTTFGAPVAAGTWRDdDT-V 268 234455578***************75567889999******************9843355******************9999999988555.5 PP CBM32.hmm 91 .titfdkpvtaryvRltvtkra.tnawgasiaEl 122 t tf+ + ++ry+Rltvt+ a + +++s+aE+ QES52170.1|CBM32 269 kTATFTRTENTRYIRLTVTGEAgNRGPWTSAAEI 302 36699965678*******9988544444999997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (782 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 102.43 // Query: SLL99371.1|AA5_2|CBM32 [L=959] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-65 205.7 10.7 6.8e-25 74.1 0.1 3.4 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.8 1.5 2.1e-21 2.1e-21 13 121 .. 63 179 .. 57 182 .. 0.79 2 ! 73.5 0.2 1.1e-24 1.1e-24 6 122 .. 198 328 .. 194 330 .. 0.80 3 ! 74.1 0.1 6.8e-25 6.8e-25 7 122 .. 347 475 .. 343 477 .. 0.79 Alignments for each domain: == domain 1 score: 62.8 bits; conditional E-value: 2.1e-21 CBM32.hmm 13 aaggggaenavDgdpntrWssag....qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnttd.gttet 91 ++g+ +a++a+Dg ++t W s++ + l +d g+ v+++++ + a+ gri +y+v++S++g+tW +++g++ d t +t SLL99371.1|AA5_2|CBM32 63 DSGQTSAAKAIDGAAGTAWLSGTtalpHRLAIDTGNRVAVSGLTYLPrAStAtGRIGRYRVQTSDNGTTWAAPVATGTFADdATLKT 149 345588***************85579999*****************9844445******************9998989876555348 PP CBM32.hmm 92 itfdkpvtaryvRltvtkra.tnawgasiaE 121 +tf + v +ryvRl++ + a + +++aE SLL99371.1|AA5_2|CBM32 150 VTFGT-VITRYVRLVAVTEAgNRGRQVAAAE 179 89984.558*******443322233355555 PP == domain 2 score: 73.5 bits; conditional E-value: 1.1e-24 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw..ae.n.grikdykvevStDgktWttva 79 +a s+++aa++g+a+na+Dgd+++ W++a+ +++tvd+ + v+++++ + ++ + g i +y++e+S+Dg+tW ++a SLL99371.1|AA5_2|CBM32 198 TADSQETAAANGAAANALDGDTRSIWHTAYsvapaaplpHTFTVDMRVTNLVSGLSYLPrqDGgRnGLIGRYRIETSMDGTTWGPAA 284 3334455566699***************744567788999******************98633545********************9 PP CBM32.hmm 80 ekgnttd.gttetitfdkpvtaryvRltvtkra.tnawgasiaEl 122 ++g + d + +t+tf+ p+ ar+vR+t+ + a + +++s+aE+ SLL99371.1|AA5_2|CBM32 285 ATGAFIDsQDAQTVTFA-PALARFVRITALSEAgNRGPWSSAAEI 328 99887764444588**9.778********7777433444889987 PP == domain 3 score: 74.1 bits; conditional E-value: 6.8e-25 CBM32.hmm 7 aessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltw..ae.ngrikdykvevStDgktWttvaek 81 a s+++aa++g a n++Dgdp t W+sa+ +++tvdL + v ++++ + a+ ngri +y++ +S+D +tWt+ ++ SLL99371.1|AA5_2|CBM32 347 ADSEETAAENGRAVNVLDGDPATIWHSAWsatpvpglpHSVTVDLHHAVPVGGLSYLPrpASpNGRIGRYRIATSSDATTWTDRVTD 433 333445666689***************744667888999******************9864434******************99988 PP CBM32.hmm 82 gnttd.gttetitfdkpvtaryvRltvtkra.tna.wgasiaEl 122 g + d + +t+ f+ p+taryvRlt+ + a t w +s+aEl SLL99371.1|AA5_2|CBM32 434 GVFADnPARQTVIFP-PATARYVRLTAVTEAgTRGpW-SSAAEL 475 776654444588999.889********4444455525.999987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (959 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.47 // Query: AJF70111.1|AA5_2|CBM32 [L=782] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-43 134.4 12.0 1.4e-23 69.9 0.9 2.5 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 69.9 0.9 1.4e-23 1.4e-23 6 122 .. 23 150 .. 18 152 .. 0.75 2 ! 68.8 4.3 3.2e-23 3.2e-23 5 122 .. 173 302 .. 169 304 .. 0.79 Alignments for each domain: == domain 1 score: 69.9 bits; conditional E-value: 1.4e-23 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw.ae..ngrikdykvevStDgktWttvaek 81 ++ +++ ++ g a+n++Dg++ t W+s++ +++tvd+ ++ v+++v+++ a+ ngr+ +y++ vS Dg++W +++ AJF70111.1|AA5_2|CBM32 23 ASDEETVGEN-GRAANVLDGSTATIWHSKWtgtpaplpHSITVDMHRTAVVSALVYKPrATgaNGRVGEYRIHVSADGQNWGSPVAT 108 2222344444.88***************75567889999******************9844434*****************999877 PP CBM32.hmm 82 gnttdgt.tetitfdkpvtaryvRltvtkra.tna.wgasiaEl 122 g+ d+t +t f+ p ar+vRlt+ + a + w +s++E+ AJF70111.1|AA5_2|CBM32 109 GTLADDTaAKTLGFA-PQGARFVRLTAVTEAgNRGpW-TSASEI 150 766543323366777.6679*******4444333425.788776 PP == domain 2 score: 68.8 bits; conditional E-value: 3.2e-23 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag........qwltvdLgkpttvdkvvltw..aen.grikdykvevStDgktWttvae 80 +++ +++ +++ g a+n++Dgd+ t W+s + +++tvd ++t v+++v+++ +++ gr+ y+v +StDg+t+ ++ AJF70111.1|AA5_2|CBM32 173 TASDEETVKEN-GRAANVLDGDAATIWHSRYsgtaaplpHSITVDTHRTTAVSALVYQPrkDGPnGRAGAYTVTTSTDGTTFGAPVA 258 33333455555.89***************53345678999******************9853334******************9999 PP CBM32.hmm 81 kgnttd.gtte.titfdkpvtaryvRltvtkra.tnawgasiaEl 122 +g++ d +t + t tf+ +ar++Rltvt+ a + +++s+aE+ AJF70111.1|AA5_2|CBM32 259 SGTWRDdDT-VkTATFTRVSNARFIRLTVTGEAgNRGPWTSAAEI 302 99*998555.536699966689*******9988544444999997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (782 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 99.08 // Query: APW39155.1|AA5_2|CBM32 [L=2040] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-21 61.7 0.2 1.6e-19 56.8 0.1 2.8 2 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.6 0.0 0.02 0.02 93 123 .. 557 587 .. 537 588 .. 0.66 2 ! 56.8 0.1 1.6e-19 1.6e-19 9 88 .. 607 698 .. 601 715 .. 0.80 Alignments for each domain: == domain 1 score: 1.6 bits; conditional E-value: 0.02 CBM32.hmm 93 tfdkpvtaryvRltvtkratnawgasiaEla 123 t++++ + ryv++++ + +++ as+aE++ APW39155.1|AA5_2|CBM32 557 TVADASRPRYVKFEALSAINGQALASMAEFN 587 55555556*******5543666669999996 PP == domain 2 score: 56.8 bits; conditional E-value: 1.6e-19 CBM32.hmm 9 ssssaaggggaenavDgdpntrWssa.g.......qwltvdLgkpttvdkvvltw.ae.n.grikdykvevStDgktWttvaekgnt 84 s+++aa++g na+Dg++ t+W +a + +wl+vd+g ++++++v++ + a+ + g++ +++v+vS Dg +W+ ++ gn APW39155.1|AA5_2|CBM32 607 SAETAAESGIDGNAIDGNAATYWLTAaTptpapmpHWLVVDMGLAQKISAVRYLPrAGgGeGTVAEFRVYVSADGVNWNAPVAAGNL 693 444556668899*************6424577899*******************9854456*****************999888776 PP CBM32.hmm 85 td.gt 88 d g APW39155.1|AA5_2|CBM32 694 ADlGA 698 66555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (2040 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 186.02 // [ok]