# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM32/fasta_for_each_cluster/cluster_156.txt # target HMM database: merged_hmms/CBM32.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM32/CBM32_cluster_156.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: QPS14042.1|CBM32|GH20 [L=1946] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-56 175.1 21.0 2.5e-25 75.6 3.0 4.3 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.1 0.6 1.6e-16 1.6e-16 15 123 .. 352 470 .. 341 471 .. 0.72 2 ! 64.2 0.1 8.4e-22 8.4e-22 7 123 .. 492 618 .. 487 619 .. 0.77 3 ? -4.0 0.5 1 1 8 46 .. 1009 1059 .. 1004 1062 .. 0.59 4 ! 75.6 3.0 2.5e-25 2.5e-25 4 123 .. 1412 1547 .. 1406 1548 .. 0.75 Alignments for each domain: == domain 1 score: 47.1 bits; conditional E-value: 1.6e-16 CBM32.hmm 15 ggggaenavDgdpn..trWssag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt...teti 92 g +a avDg + +r s a qwl+vdLgk+ t++++v+++ + ++ +k++v +k +++++e++n + g+ ++i QPS14042.1|CBM32|GH20 352 GRWTAPMAVDGIVSsdSRVSLAKdkdeQWLEVDLGKTETISNFVINYeS---QVPAFKIQVAGEDKVYRDIYEVSNLE-GQisnIQKI 435 445677899994432245444324679*******************644...5*********9999******998765.443322355 PP CBM32.hmm 93 tfdkpvtaryvRltvtk....ratn.awgasiaEla 123 ++d p++aryv+++ k + ++ +++ si+E++ QPS14042.1|CBM32|GH20 436 SID-PTEARYVKYVQLKrwthSGNGkQYSGSIYEFE 470 666.999********55433233332588*****96 PP == domain 2 score: 64.2 bits; conditional E-value: 8.4e-22 CBM32.hmm 7 aessssaaggggaenavDgdpn..trWssa.g...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekgnttd.g 87 a+s + +g ++a avDg + +r s + + qwl vdLg+ +tv+++v+++ ++ + +k++vStDg ++++v+e ++ +d g QPS14042.1|CBM32|GH20 492 ASSLEVGDGRFTAPMAVDGVVSkdSRVSFGkTadnQWLLVDLGSRKTVSEFVINY--ESCPPAFKIQVSTDGVNYQDVYEAADLPDgG 577 444566778899*******6443378777532569*******************5..267******************9988877744 PP CBM32.hmm 88 tteti.tfd.kpvtaryvRltv....tkratnawgasiaEla 123 +i +++ ++++aryv+++ t++++n+++ si+E++ QPS14042.1|CBM32|GH20 578 P-SEIkEIQiEATKARYVKYVQlkrwTHTNKNKYSGSIYEFE 618 4.455566667899********5444335566788*****96 PP == domain 3 score: -4.0 bits; conditional E-value: 1 CBM32.hmm 8 essssaaggggaenavDgdpnt.rWss......ag.....qwltvdLgkpt 46 +++ +++++ +++++D+ ++t W s +g ++ tv+L +p+ QPS14042.1|CBM32|GH20 1009 SEQMRKWTDHFINYVNDKGYDTrLWGSlgsrgfNGttpvsNDATVNLWAPY 1059 445555666788888888888844877655444113445556777776665 PP == domain 4 score: 75.6 bits; conditional E-value: 2.5e-25 CBM32.hmm 4 assaessssaaggggaenavDgdpn...t.rWss........ag.........qwltvdLgkpttvdkvvltw..aengrikdykv 66 as s + +++ +++ avDgd++ t rWss ++ q+ltvdLg++++vdkv + w a ++++y++ QPS14042.1|CBM32|GH20 1412 AS---SVNPLTPNLTPNLAVDGDNTkvtTnRWSSkratgagtNEgdteygtveQDLTVDLGANYKVDKVFISWegA---YATKYTI 1491 33...3344555689*******96556436****776665541045566789999******************644...5****** PP CBM32.hmm 67 evStDgktWttvaekgnttdgtteti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++S Dg ++ ++++ +n t g+ t ++ +v++ryvR+ + + ++ +wg+si+El+ QPS14042.1|CBM32|GH20 1492 QGSLDGVNFFDIKDITNGTGGE-ITHkDLG-DVETRYVRIACHDAKNRNWGYSIYELE 1547 ************9998855333.2333665.6889*******7766768*******85 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1946 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 135.88 // Query: QQY27138.1|CBM32|GH20 [L=1746] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-61 190.7 20.8 3.7e-27 81.4 5.4 3.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.2 0.3 8.6e-18 8.6e-18 10 121 .. 65 177 .. 59 188 .. 0.78 2 ! 66.4 1.8 1.7e-22 1.7e-22 17 123 .. 212 329 .. 197 330 .. 0.74 3 ! 81.4 5.4 3.7e-27 3.7e-27 6 123 .. 1140 1267 .. 1135 1268 .. 0.76 Alignments for each domain: == domain 1 score: 51.2 bits; conditional E-value: 8.6e-18 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttv.aekgnttdgttet 91 ss+ ag ++ +navDg+++t+W+ ++ +++vdLgk+ ++ k++l+w + + + +yk++v + ++++ +v +++t g+ e+ QQY27138.1|CBM32|GH20 65 SSAIAG-NEGSNAVDGKIDTKWEVGNistnPSIIVDLGKEESFEKITLKWaS--NFAFRYKLYVAKADQKYGQVlFHEEGTG-GD-EE 147 334456.899**************74445778******************62..469********9889**99976554432.54.57 PP CBM32.hmm 92 itfdkpvtaryvRltvtkratnawgasiaE 121 + ++++ aryv+++ ++ ++++ + + E QQY27138.1|CBM32|GH20 148 WEMEENTIARYVKIELIEAKSGESTIGLKE 177 799977779******977665444455555 PP == domain 2 score: 66.4 bits; conditional E-value: 1.7e-22 CBM32.hmm 17 ggaenavDgdpnt....rWssag.....qwltvdLgkpttvdkvvltw.aengrikdykvevStD...gktWttvaekgnttdgttet 91 g+ a+Dg++++ rWss++ qw++vdL++++t++++++ w + +++y +++S+D +k+W t++++++ + g+ e+ QQY27138.1|CBM32|GH20 212 LGPGGAFDGKYSNdyneRWSSGNitkspQWIYVDLEAEMTFSSIHIFWeN--AFATKYVLQYSNDvgtDKNWITFVNVDDGK-GSWEK 296 56999****75432334****7445679********************62..56***********855589****9886533.44124 PP CBM32.hmm 92 itfdkpvtaryvRltvtkra.tna.wgasiaEla 123 ++fd p+tar+vRl++t+++ ++ + s++E++ QQY27138.1|CBM32|GH20 297 FDFD-PITARFVRLYATASNgVGSaKPISVWEME 329 4666.9**********876664433779999985 PP == domain 3 score: 81.4 bits; conditional E-value: 3.7e-27 CBM32.hmm 6 saessssaaggggaenavDg....dpn.....trWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWtt 77 +a++sss++ ++++++a+Dg + +rW+sa qw++vdL+k+++vd++++tw a+ dy++ +S +gk+W t QQY27138.1|CBM32|GH20 1140 KATASSSYTDYQTPNKAFDGiinqS-AsgpeqSRWASARthdQWIQVDLNKVYKVDQIKITWedAY---GVDYELKGSVNGKDWFT 1221 4444555556699*******55331.02333479***84479********************7445...***************** PP CBM32.hmm 78 vaekg.nttd.gttetitfdkpvtaryvRltvtkratna.wgasiaEla 123 +++++ n + ++ + + +++ary++l +tk a+na +g+si+E++ QQY27138.1|CBM32|GH20 1222 IKNVTgNVAKeNN--HTGLG-DIEARYIKLIGTKAANNAkYGYSIYEIE 1267 *998745443333..44555.6889*******99997755*******85 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1746 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 139.62 // Query: QPS14043.1|CBM32|GH20 [L=1746] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-61 192.5 20.7 3.7e-27 81.4 5.4 3.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.5 0.4 6.8e-18 6.8e-18 10 121 .. 65 177 .. 59 188 .. 0.78 2 ! 67.9 1.7 5.9e-23 5.9e-23 17 123 .. 212 329 .. 197 330 .. 0.75 3 ! 81.4 5.4 3.7e-27 3.7e-27 6 123 .. 1140 1267 .. 1135 1268 .. 0.76 Alignments for each domain: == domain 1 score: 51.5 bits; conditional E-value: 6.8e-18 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttv.aekgnttdgttet 91 ss+ ag ++ +navDg+ +t+W+ ++ +++vdLgk+ ++ k++l+w + + + +yk++v + ++++ +v +++t g+ e+ QPS14043.1|CBM32|GH20 65 SSAIAG-NEGSNAVDGKMDTKWEVGNistnPSIIVDLGKEESFEKITLKWaS--NFAFRYKLYVAKTDQKYGQVlFHEEGTG-GD-EE 147 334456.899**************74445778******************62..469********8888**99976554432.54.57 PP CBM32.hmm 92 itfdkpvtaryvRltvtkratnawgasiaE 121 + ++++ aryv+++ ++ ++++ + + E QPS14043.1|CBM32|GH20 148 WEMEENTIARYVKIELIEAKSGESTIGLKE 177 799977779******977665444455555 PP == domain 2 score: 67.9 bits; conditional E-value: 5.9e-23 CBM32.hmm 17 ggaenavDgdpnt....rWssag.....qwltvdLgkpttvdkvvltw.aengrikdykvevStD...gktWttvaekgnttdgttet 91 g+ a+Dg++++ rWss++ qw++vdL++++t++++++ w + +++y +++S+D +k+W t++++++ + g+ e+ QPS14043.1|CBM32|GH20 212 LGPGGAFDGKYSNdyneRWSSGNitkspQWIYVDLEAEMTFSSIHIFWeN--AFATKYVLQYSNDvgtDKNWITFVNVDDGK-GSWEK 296 56999****75432334****7445679********************62..56***********855589****9886533.44124 PP CBM32.hmm 92 itfdkpvtaryvRltvtkra.tna.wgasiaEla 123 ++fd p+tar+vRl++t+++ ++ + si+E++ QPS14043.1|CBM32|GH20 297 FDFD-PITARFVRLYATASNgVGSaKPISIWEME 329 4666.9**********88666444377*****85 PP == domain 3 score: 81.4 bits; conditional E-value: 3.7e-27 CBM32.hmm 6 saessssaaggggaenavDg....dpn.....trWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWtt 77 +a++sss++ ++++++a+Dg + +rW+sa qw++vdL+k+++vd++++tw a+ dy++ +S +gk+W t QPS14043.1|CBM32|GH20 1140 KATASSSYTDYQTPNKAFDGiinqS-AsgpeqSRWASARthdQWIQVDLNKVYKVDQIKITWedAY---GVDYELKGSVNGKDWFT 1221 4444555556699*******55331.02333479***84479********************7445...***************** PP CBM32.hmm 78 vaekg.nttd.gttetitfdkpvtaryvRltvtkratna.wgasiaEla 123 +++++ n + ++ + + +++ary++l +tk a+na +g+si+E++ QPS14043.1|CBM32|GH20 1222 IKNVTgNVAKeNN--HTGLG-DIEARYIKLIGTKAANNAkYGYSIYEIE 1267 *998745443333..44555.6889*******99997755*******85 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1746 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.43 // Query: QCJ42599.1|CBM32 [L=108] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-15 43.0 0.5 3.5e-15 42.8 0.5 1.1 1 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.8 0.5 3.5e-15 3.5e-15 21 79 .. 29 96 .. 17 106 .. 0.84 Alignments for each domain: == domain 1 score: 42.8 bits; conditional E-value: 3.5e-15 CBM32.hmm 21 navDgdpntrWssag..........qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttva 79 + +Dgd trW s++ qw+ v+L+ +++d+v+l w++ r+ +y++ +S+Dg+++++v+ QCJ42599.1|CBM32 29 YFTDGDLLTRWGSQYknisasevdnQWIMVELDDSRKIDTVKLSWER-ARAEKYTLLASKDGNSFEEVY 96 679**999*****633455667899*******************955.67****************996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (108 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 34.11 // Query: API91270.1|CBM32|GH20 [L=2016] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-46 144.5 21.1 1.1e-25 76.7 2.3 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.6 0.2 0.19 0.19 62 88 .. 745 768 .. 726 793 .. 0.64 2 ! 76.0 5.6 1.8e-25 1.8e-25 5 122 .. 835 959 .. 831 961 .. 0.82 3 ! 76.7 2.3 1.1e-25 1.1e-25 5 122 .. 1047 1171 .. 1043 1173 .. 0.81 Alignments for each domain: == domain 1 score: -1.6 bits; conditional E-value: 0.19 CBM32.hmm 62 kdykvevStDgktWttvaekgnttdgt 88 +++k +S ++W+ + +gn + API91270.1|CBM32|GH20 745 YKFKHDYSLEENKWQNIIITGN---NR 768 5667779999999999965554...22 PP == domain 2 score: 76.0 bits; conditional E-value: 1.8e-25 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag..........qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekg 82 ++ ++ss+++++++a++++Dg+ +trW s++ qw+ ++L++ +++++v++ w++ r+++y+++vS+Dgk+++tv++ + API91270.1|CBM32|GH20 835 QKVTASSEYDSSQAASFITDGNFGTRWGSKYnydteeekdnQWIMIELDEIYDLSTVKVFWEK-ARANKYDLQVSEDGKNFKTVYSYK 921 5566778888889****************633455677899*******************954.67******************9987 PP CBM32.hmm 83 nttdgttetitfdkpvtaryvRltvtkratnawgasiaEl 122 ++t ++ +ti+++ +v+a+yv++++++ra+ ++g+s++E+ API91270.1|CBM32|GH20 922 DKTRSQIDTINLQ-DVKAKYVKIVMSERAS-KYGYSMFEV 959 7553223577776.79*********66664.699***998 PP == domain 3 score: 76.7 bits; conditional E-value: 1.1e-25 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaek 81 ++a++ss+++ +++a+n++Dgd+ trW s++ qw+ v+L+ ++++d+v++ w++ r+++y++ vS+Dgk++++v++ API91270.1|CBM32|GH20 1047 QKATASSQYNDSHKAANIIDGDYATRWGSQYkvgpeerdnQWIMVELDDEKQFDTVKMEWEQ-ARASEYEIFVSKDGKDFEKVYSY 1131 455556666666*****************63445667899*******************954.67*******************98 PP CBM32.hmm 82 gnttd.gtteti.tfdkpvtaryvRltvtkratnawgasiaEl 122 ++ + g+ ++i ++ ++ta+yv++ tk t+++g+s++El API91270.1|CBM32|GH20 1132 SDHSPkGN-RDIiHLK-DTTAKYVKISLTKP-TTKYGYSMFEL 1171 76554444.5555998.578********555.5589*****98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (2016 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.85 // Query: QMW75623.1|CBM32|GH20 [L=1746] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-61 192.5 20.7 3.7e-27 81.4 5.4 3.9 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.5 0.4 6.8e-18 6.8e-18 10 121 .. 65 177 .. 59 188 .. 0.78 2 ! 67.9 1.7 5.9e-23 5.9e-23 17 123 .. 212 329 .. 197 330 .. 0.75 3 ! 81.4 5.4 3.7e-27 3.7e-27 6 123 .. 1140 1267 .. 1135 1268 .. 0.76 Alignments for each domain: == domain 1 score: 51.5 bits; conditional E-value: 6.8e-18 CBM32.hmm 10 sssaaggggaenavDgdpntrWssag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttv.aekgnttdgttet 91 ss+ ag ++ +navDg+ +t+W+ ++ +++vdLgk+ ++ k++l+w + + + +yk++v + ++++ +v +++t g+ e+ QMW75623.1|CBM32|GH20 65 SSAIAG-NEGSNAVDGKMDTKWEVGNistnPSIIVDLGKEESFEKITLKWaS--NFAFRYKLYVAKTDQKYGQVlFHEEGTG-GD-EE 147 334456.899**************74445778******************62..469********8888**99976554432.54.57 PP CBM32.hmm 92 itfdkpvtaryvRltvtkratnawgasiaE 121 + ++++ aryv+++ ++ ++++ + + E QMW75623.1|CBM32|GH20 148 WEMEENTIARYVKIELIEAKSGESTIGLKE 177 799977779******977665444455555 PP == domain 2 score: 67.9 bits; conditional E-value: 5.9e-23 CBM32.hmm 17 ggaenavDgdpnt....rWssag.....qwltvdLgkpttvdkvvltw.aengrikdykvevStD...gktWttvaekgnttdgttet 91 g+ a+Dg++++ rWss++ qw++vdL++++t++++++ w + +++y +++S+D +k+W t++++++ + g+ e+ QMW75623.1|CBM32|GH20 212 LGPGGAFDGKYSNdyneRWSSGNitkspQWIYVDLEAEMTFSSIHIFWeN--AFATKYVLQYSNDvgtDKNWITFVNVDDGK-GSWEK 296 56999****75432334****7445679********************62..56***********855589****9886533.44124 PP CBM32.hmm 92 itfdkpvtaryvRltvtkra.tna.wgasiaEla 123 ++fd p+tar+vRl++t+++ ++ + si+E++ QMW75623.1|CBM32|GH20 297 FDFD-PITARFVRLYATASNgVGSaKPISIWEME 329 4666.9**********88666444377*****85 PP == domain 3 score: 81.4 bits; conditional E-value: 3.7e-27 CBM32.hmm 6 saessssaaggggaenavDg....dpn.....trWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWtt 77 +a++sss++ ++++++a+Dg + +rW+sa qw++vdL+k+++vd++++tw a+ dy++ +S +gk+W t QMW75623.1|CBM32|GH20 1140 KATASSSYTDYQTPNKAFDGiinqS-AsgpeqSRWASARthdQWIQVDLNKVYKVDQIKITWedAY---GVDYELKGSVNGKDWFT 1221 4444555556699*******55331.02333479***84479********************7445...***************** PP CBM32.hmm 78 vaekg.nttd.gttetitfdkpvtaryvRltvtkratna.wgasiaEla 123 +++++ n + ++ + + +++ary++l +tk a+na +g+si+E++ QMW75623.1|CBM32|GH20 1222 IKNVTgNVAKeNN--HTGLG-DIEARYIKLIGTKAANNAkYGYSIYEIE 1267 *998745443333..44555.6889*******99997755*******85 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1746 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 154.94 // Query: QMW75624.1|CBM32|GH20 [L=1946] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-56 175.1 21.0 2.5e-25 75.6 3.0 4.3 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.1 0.6 1.6e-16 1.6e-16 15 123 .. 352 470 .. 341 471 .. 0.72 2 ! 64.2 0.1 8.4e-22 8.4e-22 7 123 .. 492 618 .. 487 619 .. 0.77 3 ? -4.0 0.5 1 1 8 46 .. 1009 1059 .. 1004 1062 .. 0.59 4 ! 75.6 3.0 2.5e-25 2.5e-25 4 123 .. 1412 1547 .. 1406 1548 .. 0.75 Alignments for each domain: == domain 1 score: 47.1 bits; conditional E-value: 1.6e-16 CBM32.hmm 15 ggggaenavDgdpn..trWssag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt...teti 92 g +a avDg + +r s a qwl+vdLgk+ t++++v+++ + ++ +k++v +k +++++e++n + g+ ++i QMW75624.1|CBM32|GH20 352 GRWTAPMAVDGIVSsdSRVSLAKdkdeQWLEVDLGKTETISNFVINYeS---QVPAFKIQVAGEDKVYRDIYEVSNLE-GQisnIQKI 435 445677899994432245444324679*******************644...5*********9999******998765.443322355 PP CBM32.hmm 93 tfdkpvtaryvRltvtk....ratn.awgasiaEla 123 ++d p++aryv+++ k + ++ +++ si+E++ QMW75624.1|CBM32|GH20 436 SID-PTEARYVKYVQLKrwthSGNGkQYSGSIYEFE 470 666.999********55433233332588*****96 PP == domain 2 score: 64.2 bits; conditional E-value: 8.4e-22 CBM32.hmm 7 aessssaaggggaenavDgdpn..trWssa.g...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekgnttd.g 87 a+s + +g ++a avDg + +r s + + qwl vdLg+ +tv+++v+++ ++ + +k++vStDg ++++v+e ++ +d g QMW75624.1|CBM32|GH20 492 ASSLEVGDGRFTAPMAVDGVVSkdSRVSFGkTadnQWLLVDLGSRKTVSEFVINY--ESCPPAFKIQVSTDGVNYQDVYEAADLPDgG 577 444566778899*******6443378777532569*******************5..267******************9988877744 PP CBM32.hmm 88 tteti.tfd.kpvtaryvRltv....tkratnawgasiaEla 123 +i +++ ++++aryv+++ t++++n+++ si+E++ QMW75624.1|CBM32|GH20 578 P-SEIkEIQiEATKARYVKYVQlkrwTHTNKNKYSGSIYEFE 618 4.455566667899********5444335566788*****96 PP == domain 3 score: -4.0 bits; conditional E-value: 1 CBM32.hmm 8 essssaaggggaenavDgdpnt.rWss......ag.....qwltvdLgkpt 46 +++ +++++ +++++D+ ++t W s +g ++ tv+L +p+ QMW75624.1|CBM32|GH20 1009 SEQMRKWTDHFINYVNDKGYDTrLWGSlgsrgfNGttpvsNDATVNLWAPY 1059 445555666788888888888844877655444113445556777776665 PP == domain 4 score: 75.6 bits; conditional E-value: 2.5e-25 CBM32.hmm 4 assaessssaaggggaenavDgdpn...t.rWss........ag.........qwltvdLgkpttvdkvvltw..aengrikdykv 66 as s + +++ +++ avDgd++ t rWss ++ q+ltvdLg++++vdkv + w a ++++y++ QMW75624.1|CBM32|GH20 1412 AS---SVNPLTPNLTPNLAVDGDNTkvtTnRWSSkratgagtNEgdteygtveQDLTVDLGANYKVDKVFISWegA---YATKYTI 1491 33...3344555689*******96556436****776665541045566789999******************644...5****** PP CBM32.hmm 67 evStDgktWttvaekgnttdgtteti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++S Dg ++ ++++ +n t g+ t ++ +v++ryvR+ + + ++ +wg+si+El+ QMW75624.1|CBM32|GH20 1492 QGSLDGVNFFDIKDITNGTGGE-ITHkDLG-DVETRYVRIACHDAKNRNWGYSIYELE 1547 ************9998855333.2333665.6889*******7766768*******85 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1946 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 156.81 // Query: QQV05909.1|CBM32|GH20 [L=2020] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-63 198.9 17.2 3.7e-27 81.5 5.7 4.1 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.0 0.5 3.4e-20 3.4e-20 15 123 .. 360 477 .. 349 478 .. 0.78 2 ! 63.9 0.1 9.8e-22 9.8e-22 7 123 .. 499 625 .. 494 626 .. 0.78 3 ! 81.5 5.7 3.7e-27 3.7e-27 5 123 .. 1413 1541 .. 1409 1542 .. 0.78 Alignments for each domain: == domain 1 score: 59.0 bits; conditional E-value: 3.4e-20 CBM32.hmm 15 ggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltw.aengrikdykvevStDgk..tWttvaekgnttd.gt.tetitf 94 ++++ e+a+Dgd+ +rWs+a qwl+vdLg++ ++ ++ l++ +e + +y++ vS+ g+ +++++ ++ + ++ ++ ++i f QQV05909.1|CBM32|GH20 360 PQFAGEKAIDGDAESRWSAAKqdeQWLIVDLGRVESIEHIILNFsSE---APEYSILVSKTGEedSYQEIFSTVDGSQgNEiVKSIGF 444 44889**************84479*******************9656...9*********9974469999654444442433348899 PP CBM32.hmm 95 dkpvtaryvRltvtk....ratna.wgasiaEla 123 + + +aryv+++ k +++++ +g+si+E++ QQV05909.1|CBM32|GH20 445 E-KCEARYVKYVQHKmwkyDKNGKyYGSSIYEFE 477 8.589********77765544556699*****96 PP == domain 2 score: 63.9 bits; conditional E-value: 9.8e-22 CBM32.hmm 7 aessssaaggggaenavDgdpn..trWssa.g...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekgnttd.g 87 a+s + +g ++a avDg + +r s + + qwl vdLg+ +tv+++v+++ ++ + +k++vStDg ++++v+e ++ +d g QQV05909.1|CBM32|GH20 499 ASSLEVGDGRFTAPMAVDGVVSedSRVSFGkTadnQWLLVDLGSRKTVSEFVINY--ESCPPAFKIQVSTDGVNYQDVYEAADLPDgG 584 444566788899*******6543378777532569*******************5..267******************9988877744 PP CBM32.hmm 88 tteti.tfd.kpvtaryvRltv....tkratnawgasiaEla 123 +i +++ ++++aryv+++ t++++n+++ si+E++ QQV05909.1|CBM32|GH20 585 P-SEIkEIQiEATKARYVKYVQlkrwTHTNKNKYSGSIYEFE 625 4.455566667899********5444335566788*****96 PP == domain 3 score: 81.5 bits; conditional E-value: 3.7e-27 CBM32.hmm 5 ssaessssaaggggaenavDg....dpn....trWssag...qwltvdLgkpttvdkvvltw..aengrikdykvevStDgktWtt 77 ++a++ss +a +++ae+a+Dg d+ +rW+s+ qw++vdL+k+++vd++++tw a+ dy++ +S +gk+W t QQV05909.1|CBM32|GH20 1413 KEASASSYYADHQKAEKAFDGiinqDAAtaeqSRWASERthdQWIQVDLNKVYKVDQIKITWedAY---GVDYELKGSVNGKDWFT 1495 45566777778799*******7755222223369***83479********************7445...***************** PP CBM32.hmm 78 vaekg.nttd.gttetitfdkpvtaryvRltvtkratna.wgasiaEla 123 +++++ n + ++ + + +++ary++l +tk a+na +g+si+E++ QQV05909.1|CBM32|GH20 1496 IKNVTgNVAKeNN--HTGLG-DIEARYIKLIGTKAANNAkYGYSIYEIE 1541 *998745443333..44555.6889*******99997755*******85 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (2020 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 133.03 // Query: QQY27139.1|CBM32|GH20 [L=1946] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-56 175.1 21.0 2.5e-25 75.6 3.0 4.3 4 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.1 0.6 1.6e-16 1.6e-16 15 123 .. 352 470 .. 341 471 .. 0.72 2 ! 64.2 0.1 8.4e-22 8.4e-22 7 123 .. 492 618 .. 487 619 .. 0.77 3 ? -4.0 0.5 1 1 8 46 .. 1009 1059 .. 1004 1062 .. 0.59 4 ! 75.6 3.0 2.5e-25 2.5e-25 4 123 .. 1412 1547 .. 1406 1548 .. 0.75 Alignments for each domain: == domain 1 score: 47.1 bits; conditional E-value: 1.6e-16 CBM32.hmm 15 ggggaenavDgdpn..trWssag....qwltvdLgkpttvdkvvltw.aengrikdykvevStDgktWttvaekgnttdgt...teti 92 g +a avDg + +r s a qwl+vdLgk+ t++++v+++ + ++ +k++v +k +++++e++n + g+ ++i QQY27139.1|CBM32|GH20 352 GRWTAPMAVDGIVSsdSRVSLAKdkdeQWLEVDLGKTETISNFVINYeS---QVPAFKIQVAGEDKVYRDIYEVSNLE-GQisnIQKI 435 445677899994432245444324679*******************644...5*********9999******998765.443322355 PP CBM32.hmm 93 tfdkpvtaryvRltvtk....ratn.awgasiaEla 123 ++d p++aryv+++ k + ++ +++ si+E++ QQY27139.1|CBM32|GH20 436 SID-PTEARYVKYVQLKrwthSGNGkQYSGSIYEFE 470 666.999********55433233332588*****96 PP == domain 2 score: 64.2 bits; conditional E-value: 8.4e-22 CBM32.hmm 7 aessssaaggggaenavDgdpn..trWssa.g...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekgnttd.g 87 a+s + +g ++a avDg + +r s + + qwl vdLg+ +tv+++v+++ ++ + +k++vStDg ++++v+e ++ +d g QQY27139.1|CBM32|GH20 492 ASSLEVGDGRFTAPMAVDGVVSkdSRVSFGkTadnQWLLVDLGSRKTVSEFVINY--ESCPPAFKIQVSTDGVNYQDVYEAADLPDgG 577 444566778899*******6443378777532569*******************5..267******************9988877744 PP CBM32.hmm 88 tteti.tfd.kpvtaryvRltv....tkratnawgasiaEla 123 +i +++ ++++aryv+++ t++++n+++ si+E++ QQY27139.1|CBM32|GH20 578 P-SEIkEIQiEATKARYVKYVQlkrwTHTNKNKYSGSIYEFE 618 4.455566667899********5444335566788*****96 PP == domain 3 score: -4.0 bits; conditional E-value: 1 CBM32.hmm 8 essssaaggggaenavDgdpnt.rWss......ag.....qwltvdLgkpt 46 +++ +++++ +++++D+ ++t W s +g ++ tv+L +p+ QQY27139.1|CBM32|GH20 1009 SEQMRKWTDHFINYVNDKGYDTrLWGSlgsrgfNGttpvsNDATVNLWAPY 1059 445555666788888888888844877655444113445556777776665 PP == domain 4 score: 75.6 bits; conditional E-value: 2.5e-25 CBM32.hmm 4 assaessssaaggggaenavDgdpn...t.rWss........ag.........qwltvdLgkpttvdkvvltw..aengrikdykv 66 as s + +++ +++ avDgd++ t rWss ++ q+ltvdLg++++vdkv + w a ++++y++ QQY27139.1|CBM32|GH20 1412 AS---SVNPLTPNLTPNLAVDGDNTkvtTnRWSSkratgagtNEgdteygtveQDLTVDLGANYKVDKVFISWegA---YATKYTI 1491 33...3344555689*******96556436****776665541045566789999******************644...5****** PP CBM32.hmm 67 evStDgktWttvaekgnttdgtteti.tfdkpvtaryvRltvtkratnawgasiaEla 123 ++S Dg ++ ++++ +n t g+ t ++ +v++ryvR+ + + ++ +wg+si+El+ QQY27139.1|CBM32|GH20 1492 QGSLDGVNFFDIKDITNGTGGE-ITHkDLG-DVETRYVRIACHDAKNRNWGYSIYELE 1547 ************9998855333.2333665.6889*******7766768*******85 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1946 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.83 // Query: AZJ24225.1|CBM32|GH20 [L=1096] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-58 182.5 24.2 9.5e-32 96.3 4.4 3.3 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.8 6.9 2.7e-31 2.7e-31 6 122 .. 39 161 .. 34 163 .. 0.80 2 ? -1.4 0.2 0.16 0.16 62 85 .. 861 884 .. 819 914 .. 0.73 3 ! 96.3 4.4 9.5e-32 9.5e-32 6 123 .. 976 1092 .. 971 1093 .. 0.86 Alignments for each domain: == domain 1 score: 94.8 bits; conditional E-value: 2.7e-31 CBM32.hmm 6 saessssaaggggaenavDgdpn...trWssag....qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekgnttd 86 +a+ss+++++g +++ a+Dgd++ +rWss++ qw+tvdLg+ +t+d+v+++w++ +++ dy++ vS+D+k+Wttv+++++ ++ AZJ24225.1|CBM32|GH20 39 TASSSANETSGLTPNLAFDGDTTsksSRWSSGSfptpQWITVDLGQIQTFDRVRIYWEY-SHAVDYEIAVSNDNKQWTTVKSVTGDKT 125 4444555666699*******9764446****855679********************77.88******************99885433 PP CBM32.hmm 87 .gtteti.tfdkpvtaryvRltvtkra.tnawgasiaEl 122 g +i +f+ + +aryvR+++tk+ t++ + s++E+ AZJ24225.1|CBM32|GH20 126 gGA--EIyQFT-TQNARYVRMYATKNDpTKWSSISLYEM 161 354..7779*9.4579*******9988765556888887 PP == domain 2 score: -1.4 bits; conditional E-value: 0.16 CBM32.hmm 62 kdykvevStDgktWttvaekgntt 85 +++k+ + tWt++ +g+ + AZJ24225.1|CBM32|GH20 861 YNFKFDYVVPTDTWTDITIVGTNK 884 567777777777899996665422 PP == domain 3 score: 96.3 bits; conditional E-value: 9.5e-32 CBM32.hmm 6 saessssaaggggaenavDgdpntrWssag...qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekgnttdgt 88 +a++ss+++++++a +avDgd trW+s++ +wl vdLg+++t+d+v+++w++ r+++ykv+vS+D+ tWt++ +++n + g+ AZJ24225.1|CBM32|GH20 976 KATASSEETSTFTAVKAVDGDSLTRWASKYndnEWLKVDLGENKTFDSVSINWEY-ARPSSYKVQVSNDDITWTDIIQQENSPAGE 1060 45567777788*********999*****96679********************77.78******************9887654344 PP CBM32.hmm 89 tetitfdkpvtaryvRltvtkratnawgasiaEla 123 et tf+ pvt+ryv+++++krat +g+si ++ AZJ24225.1|CBM32|GH20 1061 -ETLTFA-PVTGRYVKMQGIKRAT-GYGYSIKDFK 1092 .577998.9**********99887.699**99885 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1096 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 123.41 // Query: QTY17007.1|CBM32|GH20 [L=2016] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-46 142.0 21.8 6.8e-26 77.4 5.9 3.8 3 CBM32.hmm Domain annotation for each model (and alignments): >> CBM32.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.6 0.2 0.19 0.19 62 88 .. 745 768 .. 726 793 .. 0.64 2 ! 77.4 5.9 6.8e-26 6.8e-26 5 122 .. 835 959 .. 831 961 .. 0.82 3 ! 73.0 2.6 1.5e-24 1.5e-24 5 122 .. 1047 1171 .. 1043 1173 .. 0.81 Alignments for each domain: == domain 1 score: -1.6 bits; conditional E-value: 0.19 CBM32.hmm 62 kdykvevStDgktWttvaekgnttdgt 88 +++k +S ++W+ + +gn + QTY17007.1|CBM32|GH20 745 YKFKHDYSLEENKWQNIIITGN---NR 768 5667779999999999965554...22 PP == domain 2 score: 77.4 bits; conditional E-value: 6.8e-26 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag..........qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaekg 82 ++ ++ss+++++++a++++Dg+ +trW s++ qw+ ++L++ +++++v++ w++ r+++y+++vS+Dgk+++tv++ + QTY17007.1|CBM32|GH20 835 QKVTASSEYDSSQAASFITDGNFGTRWGSKYnydteeekdnQWIMIELDEIYDLSTVKVFWEK-ARANKYDLQVSEDGKNFKTVYSYN 921 5566778888889****************633455677899*******************954.67*******************987 PP CBM32.hmm 83 nttdgttetitfdkpvtaryvRltvtkratnawgasiaEl 122 ++t ++ +ti+++ +v+a+yv++++++ra+ ++g+si+E+ QTY17007.1|CBM32|GH20 922 DKTRSQIDTINLQ-DVKAKYVKIVMSERAS-KYGYSIFEV 959 6543223577776.79*********66664.799****98 PP == domain 3 score: 73.0 bits; conditional E-value: 1.5e-24 CBM32.hmm 5 ssaessssaaggggaenavDgdpntrWssag.........qwltvdLgkpttvdkvvltwaengrikdykvevStDgktWttvaek 81 ++a++ss+++ +++a+n++Dgd+ trW s++ qw+ v+L+ ++++d+v++ w++ r+++y++ vS+D k++++v++ QTY17007.1|CBM32|GH20 1047 QKATASSQYNDSHKAANIIDGDYATRWGSQYkvgpeerdnQWIMVELDDEKQFDTVKMEWEQ-ARASEYEIFVSKDEKDFEKVYSY 1131 455556666666*****************63445667899*******************954.67*******************98 PP CBM32.hmm 82 gnttd.gtteti.tfdkpvtaryvRltvtkratnawgasiaEl 122 ++ + g+ ++i ++ ++ta+yv++ tk t+++g+s++El QTY17007.1|CBM32|GH20 1132 SDHSPkGN-RDIiHLK-DTTAKYVKISLTKP-TTKYGYSMFEL 1171 76554444.5555998.578********555.5589*****98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (2016 residues searched) Target model(s): 1 (124 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 172.98 // [ok]