# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM2/fasta_for_each_cluster/cluster_247.txt # target HMM database: merged_hmms/CBM2.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM2/CBM2_cluster_247.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: XQV91709.1|CBM2|GH5_40 [L=520] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-35 107.6 14.6 6.7e-35 106.0 14.6 1.9 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 106.0 14.6 6.7e-35 6.7e-35 1 101 [] 35 135 .. 35 135 .. 0.98 Alignments for each domain: == domain 1 score: 106.0 bits; conditional E-value: 6.7e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 C+vtytv+s+W+gGf++nv +tn g+ a++gWtltf++p +q++t++W+at+sqsg++v++ ++swn+++++gas+t+gfng +sg XQV91709.1|CBM2|GH5_40 35 CAVTYTVQSQWNGGFSGNVAITNLGA-ALTGWTLTFDFPdTDQRVTQGWSATWSQSGARVSAASMSWNSALNTGASTTIGFNGAWSG 120 9************************9.9***********66799******************************************* PP CBM2.hmm 87 ssaaptaftlngaac 101 +++ pt+f+lng++c XQV91709.1|CBM2|GH5_40 121 TNPVPTSFALNGTTC 135 *************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (520 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 52.00 // Query: WCH95404.1|CBM2|GH5_40 [L=488] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-35 106.1 15.3 6e-35 106.1 15.3 1.9 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 106.1 15.3 6e-35 6e-35 1 101 [] 36 135 .. 36 135 .. 0.98 2 ? -3.4 0.1 0.77 0.77 63 72 .. 404 413 .. 385 416 .. 0.65 Alignments for each domain: == domain 1 score: 106.1 bits; conditional E-value: 6e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vt +W+gGfq+ vtvt + + +++gW+l f++++gq++t++Wna++sqs +tvt+tn+swngs+a+gasv+ f +s+sgs WCH95404.1|CBM2|GH5_40 36 CTVEYSVTGQWDGGFQGAVTVTDNAA-PVSGWSLGFDFAGGQKVTQGWNAKWSQSAATVTATNESWNGSLATGASVSAAFIASWSGS 121 9*********************8666.************************************************************ PP CBM2.hmm 88 saaptaftlngaac 101 + ptaf++ng++c WCH95404.1|CBM2|GH5_40 122 NVVPTAFEFNGTTC 135 999*********99 PP == domain 2 score: -3.4 bits; conditional E-value: 0.77 CBM2.hmm 63 naswngsiap 72 + wn+++ap WCH95404.1|CBM2|GH5_40 404 ESCWNSTLAP 413 2336666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (488 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 73.05 // Query: UAB92472.1|CBM2|GH5_40 [L=525] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-24 72.6 11.3 1.6e-24 72.6 11.3 2.3 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.6 11.3 1.6e-24 1.6e-24 1 101 [] 35 148 .. 35 148 .. 0.84 2 ? -2.9 0.2 0.57 0.57 51 72 .. 425 446 .. 398 452 .. 0.62 Alignments for each domain: == domain 1 score: 72.6 bits; conditional E-value: 1.6e-24 CBM2.hmm 1 CtvtytvtssW.....ggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasv.tfgfn 81 C+vty+ ssW +gGf+ ++ +tn g+ +i+ Wtltftlpsgqt ts+Wnat++++ ++vt+t a wngsia+ga++ ++g++ UAB92472.1|CBM2|GH5_40 35 CSVTYQNLSSWqstptSGGFTTSLAITNLGD-PISHWTLTFTLPSGQTRTSGWNATFTGT-TAVTATDAGWNGSIATGATNaSVGLQ 119 9**********66666679************.**************************99.8*****************8736**** PP CBM2.hmm 82 gsgs........gs.saaptaftlngaac 101 g ++ s ++p++f+lng+ac UAB92472.1|CBM2|GH5_40 120 GDWTrsasgttaPSpFPQPSNFALNGVAC 148 **985555332211123367777777776 PP == domain 2 score: -2.9 bits; conditional E-value: 0.57 CBM2.hmm 51 tvsqsgntvtvtnaswngsiap 72 ++ + + + vt w ++iap UAB92472.1|CBM2|GH5_40 425 SWHTYNFNACVTASCWDSQIAP 446 3333333444555555555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (525 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.69 // Query: XTZ17479.1|CBM2|GH5_40 [L=505] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-35 107.6 12.9 2.1e-35 107.6 12.9 2.2 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 107.6 12.9 2.1e-35 2.1e-35 1 101 [] 35 135 .. 35 135 .. 0.98 2 ? -2.8 0.1 0.52 0.52 10 33 .. 203 221 .. 198 247 .. 0.62 Alignments for each domain: == domain 1 score: 107.6 bits; conditional E-value: 2.1e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 C+vtytv+s+W++Gf+an+t+tn gs a++gWtl ft+p ++q++ ++W+a+++qsg++vt+t+++wngs+ +g+s+++gf g++ g XTZ17479.1|CBM2|GH5_40 35 CAVTYTVASQWPDGFTANITITNLGS-AVTGWTLGFTFPnAAQRVGQGWSAKWTQSGSEVTATSMAWNGSLDTGSSTSIGFSGTWRG 120 9************************9.9**********9566999****************************************** PP CBM2.hmm 87 ssaaptaftlngaac 101 +++ p +f+lng++c XTZ17479.1|CBM2|GH5_40 121 TNPVPDSFALNGTTC 135 *************99 PP == domain 2 score: -2.8 bits; conditional E-value: 0.52 CBM2.hmm 10 sWggGfqanvtvtntgssaingWt 33 +W+gG + +v ++ W+ XTZ17479.1|CBM2|GH5_40 203 QWDGGPVDQASVDAMKT-----WN 221 66666666666654444.....33 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (505 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.90 // Query: WSD84759.1|CBM2|GH5_40 [L=490] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-36 111.3 12.5 1.4e-36 111.3 12.5 2.1 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 111.3 12.5 1.4e-36 1.4e-36 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -3.0 0.1 0.58 0.58 77 85 .. 398 406 .. 376 419 .. 0.49 Alignments for each domain: == domain 1 score: 111.3 bits; conditional E-value: 1.4e-36 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v+y+vts+W++Gfq+ v++tn+++ a+ +W+l f++++gq++t++Wna++sqsg+tvt+ ++s+ngs+a+gasv+ gf +s+sgs WSD84759.1|CBM2|GH5_40 36 CSVEYSVTSQWDSGFQGAVRITNNTA-AMRSWSLAFDFAGGQKLTQGWNAKWSQSGTTVTAASESYNGSLATGASVSAGFIASWSGS 121 9**********************988.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +a pt+f+lng++c WSD84759.1|CBM2|GH5_40 122 NAVPTSFKLNGTSC 135 ************99 PP == domain 2 score: -3.0 bits; conditional E-value: 0.58 CBM2.hmm 77 tfgfngsgs 85 +f +++ s WSD84759.1|CBM2|GH5_40 398 NFNTCANES 406 344444443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (490 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.64 // Query: WBP84704.1|CBM2|GH48 [L=995] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-34 103.3 14.9 4.4e-34 103.3 14.9 5.6 6 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 103.3 14.9 4.4e-34 4.4e-34 1 101 [] 45 145 .. 45 145 .. 0.99 2 ? -1.8 0.2 0.25 0.25 65 85 .. 160 180 .. 152 218 .. 0.46 3 ? -2.3 8.2 0.37 0.37 17 86 .. 264 337 .. 254 351 .. 0.43 4 ? -4.0 0.4 1 1 35 61 .. 647 673 .. 646 681 .. 0.68 5 ? -1.6 0.1 0.21 0.21 66 85 .. 716 735 .. 699 742 .. 0.77 6 ! 2.7 1.4 0.0098 0.0098 40 85 .. 807 855 .. 792 868 .. 0.71 Alignments for each domain: == domain 1 score: 103.3 bits; conditional E-value: 4.4e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgssa 89 C v+y+v ++Wg+Gf+an+t+t tg+++ingWtl t+p++qt++++Wn++++qsg+tvtvtn+s++ +i+pga+ t n s++g+++ WBP84704.1|CBM2|GH48 45 CGVSYAVGNDWGSGFTANLTITDTGTTPINGWTLGYTYPGNQTLQNGWNGNWTQSGQTVTVTNPSYAPTINPGATYTTSANFSYTGTNT 133 99*************************************************************************************** PP CBM2.hmm 90 aptaftlngaac 101 aptaft+ng++c WBP84704.1|CBM2|GH48 134 APTAFTVNGTPC 145 **********99 PP == domain 2 score: -1.8 bits; conditional E-value: 0.25 CBM2.hmm 65 swngsiapgasvtfgfngsgs 85 + ++ pg++v++ + + WBP84704.1|CBM2|GH48 160 AAGQTFTPGSTVKLSADAADA 180 333333333333333332222 PP == domain 3 score: -2.3 bits; conditional E-value: 0.37 CBM2.hmm 17 anvtvtntgssaingWtltftlpsgq...titssWnatvsqsgntvtvtnaswng....siapga.......svtfgfngsgsg 86 +++tv +++++ + t+t++ ++++ + +sg+++t+t a+wn ++a+g ++tf ++g g WBP84704.1|CBM2|GH48 264 GTFTVA-LSQAPTADTTVTVARTGSDpdlGV---------TSGASLTFTAANWNVpqtvTVAAGTdagqvggTATFTASATGFG 337 555554.333355555555554322110023.........34455555555555433333333331111111445544444433 PP == domain 4 score: -4.0 bits; conditional E-value: 1 CBM2.hmm 35 tftlpsgqtitssWnatvsqsgntvtv 61 t+ ++ g + +W+ ++s+s ++ + WBP84704.1|CBM2|GH48 647 TWYFAWGGAADGGWSWRISGSAAHQGY 673 566666667788888888888766544 PP == domain 5 score: -1.6 bits; conditional E-value: 0.21 CBM2.hmm 66 wngsiapgasvtfgfngsgs 85 g ia ga++++g n+ + WBP84704.1|CBM2|GH48 716 TEGGIAGGATNSWGGNYGDD 735 56778888888888887654 PP == domain 6 score: 2.7 bits; conditional E-value: 0.0098 CBM2.hmm 40 sgqtitssWnatvsqsgntvtvtnaswngsiap...gasvtfgfngsgs 85 s t+t + ++++ +t+++t++ n+ ++ g +++g+ gs + WBP84704.1|CBM2|GH48 807 STGTLTTPDKLSWTGAPDTWSATSPGGNAGLHVtasGTATDVGVAGSLA 855 44477888899999999************65541124455588887765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (995 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 37.17 // Query: XWY51192.1|CBM2|GH5_40 [L=496] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-37 112.3 14.7 7.3e-37 112.3 14.7 2.1 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 112.3 14.7 7.3e-37 7.3e-37 1 101 [] 37 136 .. 37 136 .. 0.99 2 ? -2.2 0.0 0.34 0.34 61 72 .. 409 420 .. 397 428 .. 0.68 Alignments for each domain: == domain 1 score: 112.3 bits; conditional E-value: 7.3e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W +Gfq+ v++tn+++ a++gW+ltf++++gq++t++Wna++sqsg+tvt+ ++swngs+ +gasvt gf +s+sgs XWY51192.1|CBM2|GH5_40 37 CTVEYSVTSQWADGFQGGVKITNNQA-ALSGWSLTFDFAGGQKLTQGWNARWSQSGTTVTAASESWNGSLGTGASVTAGFIASWSGS 122 9**********************988.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +a ptaf+lng++c XWY51192.1|CBM2|GH5_40 123 NAVPTAFKLNGTTC 136 ************99 PP == domain 2 score: -2.2 bits; conditional E-value: 0.34 CBM2.hmm 61 vtnaswngsiap 72 vt+ wn+++ap XWY51192.1|CBM2|GH5_40 409 VTESCWNSTLAP 420 555666666666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (496 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 105.36 // Query: XDQ47810.1|CBM2|GH5_40 [L=491] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-37 114.6 16.2 3e-37 113.5 16.2 1.6 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 113.5 16.2 3e-37 3e-37 1 101 [] 36 135 .. 36 135 .. 0.99 Alignments for each domain: == domain 1 score: 113.5 bits; conditional E-value: 3e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W++Gfq++vt+tn+ + a+++W+l+f++++gq++t++Wna++sqsg+tvt+tn+swngs+ +gasv+ gf gs+sgs XDQ47810.1|CBM2|GH5_40 36 CTVQYAVTSQWDTGFQGSVTITNNVA-AMSSWSLSFDFAGGQEVTQGWNAKWSQSGTTVTATNESWNGSLGTGASVSAGFLGSSSGS 121 ***********************998.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +a pt f+lng++c XDQ47810.1|CBM2|GH5_40 122 NAVPTMFKLNGTTC 135 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (491 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 115.69 // Query: XRQ14585.1|CBM2|GH5_40 [L=498] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-34 104.8 10.6 4.7e-34 103.3 10.6 1.9 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 103.3 10.6 4.7e-34 4.7e-34 1 101 [] 42 140 .. 42 140 .. 0.99 Alignments for each domain: == domain 1 score: 103.3 bits; conditional E-value: 4.7e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v+yt t++WggGf+a +t+tn gs +++gWtlt +++++q++t++Wn+++sqsg+tvtv+n+swngs+ +gasv++g + +sg+ XRQ14585.1|CBM2|GH5_40 42 CEVDYT-TNDWGGGFTAALTITNLGS-PLDGWTLTYSYTGDQRLTNGWNGRWSQSGGTVTVSNESWNGSLGTGASVDVGAQFAYSGT 126 9****9.9*****************9.************************************************************ PP CBM2.hmm 88 saaptaftlngaac 101 ++ap+ f++ng+ac XRQ14585.1|CBM2|GH5_40 127 NTAPAGFAVNGTAC 140 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (498 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 116.63 // Query: XKJ40256.1|CBM2|GH5_40 [L=504] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-33 100.9 10.8 5e-33 100.0 10.8 1.5 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.0 10.8 5e-33 5e-33 1 101 [] 36 135 .. 36 135 .. 0.98 Alignments for each domain: == domain 1 score: 100.0 bits; conditional E-value: 5e-33 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C v+y+vt +W++Gfq+ vt+tn+g+ +++gW+ltf++p+ q+++++Wna++sqs+ t t+ n+ wng + +g+svt+gf +s+++ XKJ40256.1|CBM2|GH5_40 36 CVVEYAVTHTWDQGFQGAVTLTNKGA-PLSGWRLTFDFPGTQSVSQGWNAKWSQSSRTATAVNETWNGGLGTGSSVTLGFLASWKSD 121 99*********************999.*********************************************************988 PP CBM2.hmm 88 saaptaftlngaac 101 +a+ptaf+lng++c XKJ40256.1|CBM2|GH5_40 122 NASPTAFALNGNTC 135 999*********99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (504 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.05 // Query: UZX20432.1|CBM2|GH5_40 [L=519] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-35 106.1 12.1 1.4e-34 104.9 12.1 1.7 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 104.9 12.1 1.4e-34 1.4e-34 1 101 [] 38 137 .. 38 137 .. 0.99 Alignments for each domain: == domain 1 score: 104.9 bits; conditional E-value: 1.4e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+v +W gG+q+ vtvtn+g+ a++gW+l f++p+gq + ++W +++sqsg++vtv n+swng++ +ga+v+ gf +s++g+ UZX20432.1|CBM2|GH5_40 38 CTVEYSVVGQWAGGYQGAVTVTNNGA-ALSGWSLGFDFPAGQVVGQGWGGKWSQSGASVTVVNESWNGALGTGAKVSGGFIASWTGA 123 9************************9.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++aptaftlng++c UZX20432.1|CBM2|GH5_40 124 NTAPTAFTLNGTPC 137 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (519 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 113.24 // Query: XDQ05819.1|CBM2|GH5_40 [L=493] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-37 114.1 15.4 2e-37 114.1 15.4 2.0 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 114.1 15.4 2e-37 2e-37 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -2.6 0.0 0.45 0.45 62 72 .. 407 417 .. 399 427 .. 0.64 Alignments for each domain: == domain 1 score: 114.1 bits; conditional E-value: 2e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W+ Gfq+ v++tn+ + ++++W+l+f++++gq++t++Wna++sqsg+tvt+tn+swng++ +gasv+ gf ++++gs XDQ05819.1|CBM2|GH5_40 36 CTVEYSVTSQWDAGFQGAVQITNNRA-PVSSWSLSFDFAGGQKVTQGWNAKWSQSGTTVTATNESWNGALGTGASVSAGFLANWAGS 121 9**********************998.************************************************************ PP CBM2.hmm 88 saaptaftlngaac 101 +a p+af+lng++c XDQ05819.1|CBM2|GH5_40 122 NAVPSAFKLNGTTC 135 ************99 PP == domain 2 score: -2.6 bits; conditional E-value: 0.45 CBM2.hmm 62 tnaswngsiap 72 t+ wn ++ap XDQ05819.1|CBM2|GH5_40 407 TESCWNTTLAP 417 44556666555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (493 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.97 // Query: BFD81667.1|CBM2|GH5_40 [L=491] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.9e-35 105.4 4.9 2.1e-34 104.3 4.9 1.6 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 104.3 4.9 2.1e-34 2.1e-34 1 101 [] 36 135 .. 36 135 .. 0.98 Alignments for each domain: == domain 1 score: 104.3 bits; conditional E-value: 2.1e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vt +Wg+Gfq+ v +t + + +++gW+ltf+l++gq++t +Wna++sqsg++vt++n+swngs+ +gasv gf +++ gs BFD81667.1|CBM2|GH5_40 36 CTVEYSVTGQWGTGFQGAVILTDNRA-PLTGWRLTFDLADGQEVTGGWNAKWSQSGTEVTARNESWNGSLGTGASVAAGFLATSPGS 121 9*********************8877.************************************************************ PP CBM2.hmm 88 saaptaftlngaac 101 +ap++f+lng+ c BFD81667.1|CBM2|GH5_40 122 GPAPATFRLNGVVC 135 999********998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (491 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 111.57 // Query: XDQ25122.1|CBM2|GH5_40 [L=597] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-24 72.4 7.1 2e-24 72.4 7.1 2.7 3 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.4 7.1 2e-24 2e-24 1 86 [. 36 129 .. 36 149 .. 0.81 2 ? -1.7 0.1 0.23 0.23 49 57 .. 226 234 .. 177 258 .. 0.54 3 ? -3.3 0.2 0.72 0.72 41 55 .. 568 582 .. 558 589 .. 0.60 Alignments for each domain: == domain 1 score: 72.4 bits; conditional E-value: 2e-24 CBM2.hmm 1 CtvtytvtssW.....ggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvt.fgfn 81 C+vty+ s+W gGf+ ++ ++n g+ +i+gW+ltft+psgqt+t +Wnat++++ ++vt+t a wng+i +g++ t +g++ XDQ25122.1|CBM2|GH5_40 36 CEVTYQNLSTWqstptAGGFNTTLAIKNLGD-PITGWKLTFTMPSGQTLTGGWNATFTGT-TSVTATDAGWNGAIGTGQTGTsVGLQ 120 9**********55544458************.**************************99.8*****************8655**** PP CBM2.hmm 82 gsgs....g 86 g ++ g XDQ25122.1|CBM2|GH5_40 121 GDWTrstaG 129 ***944431 PP == domain 2 score: -1.7 bits; conditional E-value: 0.23 CBM2.hmm 49 natvsqsgn 57 +a++ +g+ XDQ25122.1|CBM2|GH5_40 226 SARAVDDGG 234 222222222 PP == domain 3 score: -3.3 bits; conditional E-value: 0.72 CBM2.hmm 41 gqtitssWnatvsqs 55 g+ + Wn+t +++ XDQ25122.1|CBM2|GH5_40 568 GSDLITDWNGTPTST 582 444455577776644 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (597 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.39 // Query: XIF77063.1|CBM2 [L=137] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-29 89.1 9.6 1.5e-29 88.8 9.6 1.1 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.8 9.6 1.5e-29 1.5e-29 1 84 [. 47 129 .. 47 135 .. 0.97 Alignments for each domain: == domain 1 score: 88.8 bits; conditional E-value: 1.5e-29 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsg 84 C+v+y+vts+Wg+Gf +++t+tntg ai++Wtl+ +++++q+++++Wn+t+s+sg++vtvt aswng++ +gas+++g n + XIF77063.1|CBM2 47 CQVAYAVTSDWGSGFGVSITITNTGP-AISSWTLQYSYSGNQKVQQGWNGTWSRSGAQVTVTYASWNGALDTGASTKIGANFTR 129 9************************9.9****************************************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (137 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 31.33 // Query: WFE40917.1|CBM2|GH5_40 [L=516] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-35 107.9 15.5 5.1e-35 106.3 15.5 1.9 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 106.3 15.5 5.1e-35 5.1e-35 1 101 [] 35 135 .. 35 135 .. 0.98 Alignments for each domain: == domain 1 score: 106.3 bits; conditional E-value: 5.1e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 Ctv+ytv+s+W gGf++nv +tn gs a+++Wtltf++p + q++t++W+at+sqsg++v++ + swngs+a+gas+t+gfngs+sg WFE40917.1|CBM2|GH5_40 35 CTVAYTVQSQWTGGFTGNVAITNLGS-ALTSWTLTFDFPtATQRVTQGWSATWSQSGARVSAASLSWNGSLATGASTTIGFNGSWSG 120 9************************9.9***********77799******************************************* PP CBM2.hmm 87 ssaaptaftlngaac 101 +++ pt+f+lng++c WFE40917.1|CBM2|GH5_40 121 ANPVPTSFALNGTTC 135 *************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (516 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.37 // Query: WEH43094.1|CBM2|GH5_40 [L=599] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-32 95.8 8.9 9.6e-32 95.8 8.9 3.0 3 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 0.4 1 1 41 54 .. 362 375 .. 349 383 .. 0.60 2 ? -3.4 4.0 0.82 0.82 62 62 .. 447 447 .. 397 493 .. 0.46 3 ! 95.8 8.9 9.6e-32 9.6e-32 1 101 [] 496 596 .. 496 596 .. 0.99 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 1 CBM2.hmm 41 gqtitssWnatvsq 54 g+ + + Wn+t ++ WEH43094.1|CBM2|GH5_40 362 GNVLIEDWNGTPTT 375 44444556665554 PP == domain 2 score: -3.4 bits; conditional E-value: 0.82 CBM2.hmm 62 t 62 WEH43094.1|CBM2|GH5_40 447 G 447 1 PP == domain 3 score: 95.8 bits; conditional E-value: 9.6e-32 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v y+v +Wg+Gfq ++t++ntg++a+++W+l ft+++gqt++++W +t +q+g++v+v +as+ ++i + +svt+gf ++ + + WEH43094.1|CBM2|GH5_40 496 CSVGYRVVGDWGSGFQSEITIRNTGAAAVSNWKLGFTFANGQTVNNMWGGTPTQTGGSVSVIPASYTNTITADGSVTLGFIANRGAT 582 9***********************************************************************************999 PP CBM2.hmm 88 saaptaftlngaac 101 ++apt+ftlng +c WEH43094.1|CBM2|GH5_40 583 NTAPTTFTLNGRTC 596 999********999 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (599 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 40.54 // Query: BFD55800.1|CBM2|GH5_40 [L=491] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-37 113.4 9.0 3.2e-37 113.4 9.0 2.3 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 113.4 9.0 3.2e-37 3.2e-37 1 101 [] 29 129 .. 29 129 .. 0.99 2 ? -3.3 0.0 0.74 0.74 45 72 .. 406 415 .. 398 423 .. 0.56 Alignments for each domain: == domain 1 score: 113.4 bits; conditional E-value: 3.2e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 Ctvty+++s+W gGfq++vtv+n g+ ++++Wtl f++p +gq++t++W+at+sqsg++vt+ ++swngs+a++as+ +gf+gs++g BFD55800.1|CBM2|GH5_40 29 CTVTYKIASQWTGGFQGDVTVKNLGD-PLSSWTLGFDFPdAGQKVTQGWSATWSQSGAHVTAASMSWNGSLATNASTGIGFTGSYTG 114 **************************.************889********************************************* PP CBM2.hmm 87 ssaaptaftlngaac 101 s++ p+aftlng+ac BFD55800.1|CBM2|GH5_40 115 SNPVPSAFTLNGVAC 129 *************99 PP == domain 2 score: -3.3 bits; conditional E-value: 0.74 CBM2.hmm 45 tssWnatvsqsgntvtvtnaswngsiap 72 ts Wn ++ap BFD55800.1|CBM2|GH5_40 406 TSCWNS------------------QLAP 415 344444..................4444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (491 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 86.66 // Query: WNM33603.1|CBM2|GH5_40 [L=496] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-35 108.5 15.1 1.1e-35 108.5 15.1 1.8 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 108.5 15.1 1.1e-35 1.1e-35 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -3.2 0.0 0.71 0.71 64 71 .. 412 419 .. 383 425 .. 0.54 Alignments for each domain: == domain 1 score: 108.5 bits; conditional E-value: 1.1e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v+y+vts+W++Gfq++v++tn+ + ++++W+ltf+++++q++t++Wnat+sqsg+tvt+ n+swngs+ +gasv gf gs+sgs WNM33603.1|CBM2|GH5_40 36 CSVEYSVTSQWDNGFQGSVKITNNLA-TLSSWKLTFDFAGDQKVTQGWNATWSQSGTTVTAGNESWNGSLGSGASVVAGFVGSWSGS 121 9**********************988.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +a p af+lng++c WNM33603.1|CBM2|GH5_40 122 NAMPVAFQLNGTTC 135 999*********99 PP == domain 2 score: -3.2 bits; conditional E-value: 0.71 CBM2.hmm 64 aswngsia 71 wn+++a WNM33603.1|CBM2|GH5_40 412 GCWNSTLA 419 23444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (496 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 93.50 // Query: UXY22918.1|CBM2|GH5_40 [L=491] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-38 116.7 16.0 3.1e-38 116.7 16.0 1.8 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 116.7 16.0 3.1e-38 3.1e-38 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -3.5 0.0 0.85 0.85 46 72 .. 407 415 .. 399 421 .. 0.58 Alignments for each domain: == domain 1 score: 116.7 bits; conditional E-value: 3.1e-38 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W++Gfq+ v++tn+ + a++gW ltf++++gq+++++Wna++sqsg+tvt+tn+swngs+a+gasv+ gf +s+sgs UXY22918.1|CBM2|GH5_40 36 CTVEYSVTSQWDSGFQGAVKITNNRA-AVSGWALTFDFAGGQKVSQGWNAKWSQSGTTVTATNESWNGSLATGASVSAGFLASWSGS 121 9**********************998.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +a pt f+lng++c UXY22918.1|CBM2|GH5_40 122 NAVPTVFKLNGTTC 135 ************99 PP == domain 2 score: -3.5 bits; conditional E-value: 0.85 CBM2.hmm 46 ssWnatvsqsgntvtvtnaswngsiap 72 s wn+++ap UXY22918.1|CBM2|GH5_40 407 SC------------------WNSTLAP 415 34..................5555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (491 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 106.69 // Query: XQA92173.1|CBM2|GH5_40 [L=491] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-36 108.9 15.5 1.6e-35 108.0 15.5 1.5 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 108.0 15.5 1.6e-35 1.6e-35 1 101 [] 35 134 .. 35 134 .. 0.99 Alignments for each domain: == domain 1 score: 108.0 bits; conditional E-value: 1.6e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v+y+vts+W++Gfq+ v+vtn+g+ a ++W+l+f++++gq++t++W+a++sqsg+t t+ n+swng++a+g+sv+ gf gs+sg+ XQA92173.1|CBM2|GH5_40 35 CSVEYSVTSQWNSGFQGAVKVTNNGA-AKDSWSLSFDFADGQEVTQGWSAKWSQSGTTATAANESWNGALASGGSVSAGFIGSWSGA 120 9************************9.99********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++ p++f+lng++c XQA92173.1|CBM2|GH5_40 121 NTVPKTFKLNGVTC 134 ***********999 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (491 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 115.07 // Query: XRK09211.1|CBM2|GH5_40 [L=500] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-33 101.3 6.3 1.9e-33 101.3 6.3 2.8 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 101.3 6.3 1.9e-33 1.9e-33 1 101 [] 33 134 .. 33 134 .. 0.98 2 ? -0.5 0.8 0.1 0.1 35 58 .. 469 492 .. 461 499 .. 0.78 Alignments for each domain: == domain 1 score: 101.3 bits; conditional E-value: 1.9e-33 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvt.fgfngsgs 85 C+v+y+v ++W+gGfq +v +tn g+ ++++W+l+f++p +gq++ s+Wnat+sqsg++vt+t+ s+ng++a++a++ +gf+g+ + XRK09211.1|CBM2|GH5_40 33 CKVAYKVVNQWSGGFQSDVAITNLGD-PLTSWKLEFDFPdAGQKVGSGWNATWSQSGAHVTATSLSYNGALATNATTGgIGFTGTFT 118 9*************************.************889***********************************77******** PP CBM2.hmm 86 gssaaptaftlngaac 101 s++ p+af+lng++c XRK09211.1|CBM2|GH5_40 119 ASNPVPSAFKLNGVTC 134 999***********99 PP == domain 2 score: -0.5 bits; conditional E-value: 0.1 CBM2.hmm 35 tftlpsgqtitssWnatvsqsgnt 58 +++ +sg ++ Wn+t+++ g+ XRK09211.1|CBM2|GH5_40 469 NWDCSSGPSLITDWNGTATNYGAG 492 6888899999999***99988865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (500 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 112.33 // Query: UXX97833.1|CBM2|GH5_40 [L=472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-37 113.8 14.9 2.4e-37 113.8 14.9 2.0 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 113.8 14.9 2.4e-37 2.4e-37 1 101 [] 15 114 .. 15 114 .. 0.99 2 ? -2.6 0.0 0.43 0.43 62 72 .. 386 396 .. 378 406 .. 0.64 Alignments for each domain: == domain 1 score: 113.8 bits; conditional E-value: 2.4e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vt +W++Gfq+ v++tn+ + ++++W+l+f++++gq++t++Wna++sqsg+tvt+tn+swng++ +gasv+ gf ++++gs UXX97833.1|CBM2|GH5_40 15 CTVEYSVTGQWDTGFQGAVRITNNRA-PVSSWSLSFDFADGQKVTQGWNAKWSQSGTTVTATNESWNGTLGTGASVSAGFLANWAGS 100 9**********************998.************************************************************ PP CBM2.hmm 88 saaptaftlngaac 101 +a p+af+lng++c UXX97833.1|CBM2|GH5_40 101 NAVPSAFKLNGTTC 114 ************99 PP == domain 2 score: -2.6 bits; conditional E-value: 0.43 CBM2.hmm 62 tnaswngsiap 72 t+ wn ++ap UXX97833.1|CBM2|GH5_40 386 TESCWNTTLAP 396 44556666555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (472 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.60 // Query: XRQ14517.1|CBM2|GH5_40 [L=495] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-33 99.0 12.6 2.8e-32 97.6 12.6 1.8 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 97.6 12.6 2.8e-32 2.8e-32 1 101 [] 41 139 .. 41 139 .. 0.99 Alignments for each domain: == domain 1 score: 97.6 bits; conditional E-value: 2.8e-32 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v+yt t++Wg+Gf+a +t+tn g +++ Wtlt ++ ++q++ ++Wn+++sqsg+tvtvtn+swngs+a+ga v++g + ++sg+ XRQ14517.1|CBM2|GH5_40 41 CEVDYT-TNDWGTGFTAALTITNLGP-SVDAWTLTYAYGGNQRLANGWNGRWSQSGGTVTVTNESWNGSLATGAAVQVGAQFTYSGT 125 9****9.9*****************9.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++ap+ ftlngaac XRQ14517.1|CBM2|GH5_40 126 NTAPSGFTLNGAAC 139 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (495 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 109.09 // Query: BBC31651.1|CBM2|GH5_40 [L=502] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-37 113.4 14.9 7.8e-37 112.2 14.9 1.7 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 112.2 14.9 7.8e-37 7.8e-37 1 101 [] 37 136 .. 37 136 .. 0.99 Alignments for each domain: == domain 1 score: 112.2 bits; conditional E-value: 7.8e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W +Gfq+ v++tn+++ a++gW+ltf++++gq+++++Wna++sqsg+tvt+ n+swngs+ +gas + gf +s+sgs BBC31651.1|CBM2|GH5_40 37 CTVEYSVTSQWADGFQGGVKITNNQA-ALSGWSLTFAFAGGQKVSQGWNARWSQSGTTVTAANESWNGSLGTGASLSAGFIASWSGS 122 9**********************988.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +a ptaf+lng++c BBC31651.1|CBM2|GH5_40 123 NAVPTAFKLNGTTC 136 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (502 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 116.19 // Query: UQU62445.1|CBM2|GH5_40 [L=492] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-34 102.8 11.0 1.9e-33 101.3 11.0 1.9 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 101.3 11.0 1.9e-33 1.9e-33 1 101 [] 34 134 .. 34 134 .. 0.98 Alignments for each domain: == domain 1 score: 101.3 bits; conditional E-value: 1.9e-33 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 C+v+y+vt sW+gGfq+++ +tn g+ ++ W+l ft+p s q++t++W +t++q+g++vt+tna+wngs+ ++a++++gf gs+sg UQU62445.1|CBM2|GH5_40 34 CSVSYRVTGSWQGGFQGDIGITNLGD-PLPAWSLGFTFPtSTQKVTQAWGGTATQTGAQVTITNAAWNGSLGTNATTSIGFIGSWSG 119 9*************************.************77799******************************************* PP CBM2.hmm 87 ssaaptaftlngaac 101 s++ap++ft+ng++c UQU62445.1|CBM2|GH5_40 120 SNPAPASFTVNGVTC 134 *************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (492 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 109.36 // Query: WKU07053.1|CBM2|GH5_40 [L=517] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-33 100.4 13.6 3.7e-33 100.4 13.6 2.0 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.4 13.6 3.7e-33 3.7e-33 1 101 [] 35 135 .. 35 135 .. 0.98 2 ? -3.2 0.1 0.69 0.69 52 71 .. 420 439 .. 401 445 .. 0.57 Alignments for each domain: == domain 1 score: 100.4 bits; conditional E-value: 3.7e-33 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 C+vtytv+s+W gGf++n+ +tn gs a+ +Wtltf++p +q++t++W+a +sqsg++v++ + swn+++++gas+t+gfng +sg WKU07053.1|CBM2|GH5_40 35 CAVTYTVQSQWTGGFSGNIAITNLGS-ALANWTLTFDFPdTDQRVTQGWSAAWSQSGARVSAASLSWNSALNTGASTTIGFNGAWSG 120 9************************9.9***********66799******************************************* PP CBM2.hmm 87 ssaaptaftlngaac 101 +++ pt+f+lng++c WKU07053.1|CBM2|GH5_40 121 TNPVPTSFALNGTTC 135 *************99 PP == domain 2 score: -3.2 bits; conditional E-value: 0.69 CBM2.hmm 52 vsqsgntvtvtnaswngsia 71 + + + + vt+ w +ia WKU07053.1|CBM2|GH5_40 420 WHSYNFNACVTETCWDTQIA 439 33333333444444555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (517 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.09 // Query: WYH85886.1|CBM2|GH5_40 [L=496] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-38 116.1 14.7 1.2e-37 114.8 14.7 1.8 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 114.8 14.7 1.2e-37 1.2e-37 1 101 [] 36 135 .. 36 135 .. 0.99 Alignments for each domain: == domain 1 score: 114.8 bits; conditional E-value: 1.2e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vt +W++Gfq+ vt+tn+ s a++gW+l f++p+gq++t++Wna++sqsg+tvt++n+swngs+a+ga+v+ gf +s+sg WYH85886.1|CBM2|GH5_40 36 CTVEYSVTGQWDTGFQGAVTITNNMS-ALSGWSLGFDFPNGQKVTQGWNAKWSQSGTTVTASNESWNGSLASGATVSAGFLASWSGG 121 9**********************999.9**********************************************************9 PP CBM2.hmm 88 saaptaftlngaac 101 +a ptaf+lng++c WYH85886.1|CBM2|GH5_40 122 NAVPTAFRLNGTTC 135 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (496 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 114.11 // Query: WOX13731.1|CBM2|GH5_40 [L=493] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-36 111.7 15.3 1.1e-36 111.7 15.3 2.0 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 111.7 15.3 1.1e-36 1.1e-36 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -3.0 0.0 0.59 0.59 63 72 .. 408 417 .. 395 425 .. 0.65 Alignments for each domain: == domain 1 score: 111.7 bits; conditional E-value: 1.1e-36 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W++Gfq++v++tn+ + ++++W+l f++++gq++t++Wna++sqs +tvt+tn+swng++ +gasv+ gf +++sgs WOX13731.1|CBM2|GH5_40 36 CTVEYSVTSQWDTGFQGSVRITNNMA-PVSSWSLGFDFAGGQKVTQGWNAKWSQSATTVTATNESWNGALGTGASVSAGFLANWSGS 121 9**********************998.************************************************************ PP CBM2.hmm 88 saaptaftlngaac 101 +a p+af+lng++c WOX13731.1|CBM2|GH5_40 122 NAVPSAFKLNGTTC 135 ************99 PP == domain 2 score: -3.0 bits; conditional E-value: 0.59 CBM2.hmm 63 naswngsiap 72 + wn+++ap WOX13731.1|CBM2|GH5_40 408 ESCWNSTLAP 417 3445655555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (493 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 112.48 // Query: BFT27608.1|CBM2|GH5_40 [L=495] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-38 115.9 11.7 5.6e-38 115.9 11.7 2.1 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 115.9 11.7 5.6e-38 5.6e-38 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -2.8 0.0 0.52 0.52 45 72 .. 410 419 .. 400 427 .. 0.60 Alignments for each domain: == domain 1 score: 115.9 bits; conditional E-value: 5.6e-38 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W+gGfq++v++tn+++ a++gW+ltf++++gq++t++Wna++sqsg+tvt+ n+s+ngs+ +gasv gf gs+sgs BFT27608.1|CBM2|GH5_40 36 CTVEYSVTSQWDGGFQGSVRITNNQA-ALSGWKLTFDFAGGQKVTQGWNAKWSQSGTTVTAANESYNGSLGTGASVGAGFLGSWSGS 121 9**********************988.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++ p+af+lng++c BFT27608.1|CBM2|GH5_40 122 NPVPAAFKLNGTTC 135 ************99 PP == domain 2 score: -2.8 bits; conditional E-value: 0.52 CBM2.hmm 45 tssWnatvsqsgntvtvtnaswngsiap 72 +s Wn t +ap BFT27608.1|CBM2|GH5_40 410 ESCWNST------------------LAP 419 4445554..................444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (495 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 111.80 // Query: BFU43872.1|CBM2|GH5_40 [L=481] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-37 112.1 4.0 2.3e-36 110.7 4.0 1.8 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 110.7 4.0 2.3e-36 2.3e-36 1 101 [] 33 133 .. 33 133 .. 0.97 Alignments for each domain: == domain 1 score: 110.7 bits; conditional E-value: 2.3e-36 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 C+v+y+vt++W gGfqa+vtvtn g+ +++gW+l f++p ++q +t++Wnat+sqsg+++t+tna+wng +a+g+s+ +gf g ++ BFU43872.1|CBM2|GH5_40 33 CRVAYRVTNQWTGGFQADVTVTNLGD-PLSGWSLGFDFPdAAQHVTQGWNATWSQSGAHITATNADWNGVLATGSSTPLGFLGARAD 118 9*************************.************556899****************************************99 PP CBM2.hmm 87 ssaaptaftlngaac 101 +++ pt ftlng+ac BFU43872.1|CBM2|GH5_40 119 ANPDPTGFTLNGVAC 133 9999*********99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (481 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 118.28 // Query: WFE36346.1|CBM2|GH5_40 [L=516] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-35 107.6 16.2 6.3e-35 106.1 16.2 1.9 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 106.1 16.2 6.3e-35 6.3e-35 1 101 [] 35 135 .. 35 135 .. 0.98 Alignments for each domain: == domain 1 score: 106.1 bits; conditional E-value: 6.3e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 Ctv+ytv+s+W gGf++nv +tn gs a+++Wtltf++p + q++t++W+at+sqsg++v++ + swngs+a+g+s+t+gfngs+sg WFE36346.1|CBM2|GH5_40 35 CTVAYTVQSQWTGGFTGNVAITNLGS-AVTSWTLTFDFPtATQRVTQGWSATWSQSGARVSAASLSWNGSLATGGSTTIGFNGSWSG 120 9************************9.9***********77799******************************************* PP CBM2.hmm 87 ssaaptaftlngaac 101 +++ pt+f+lng++c WFE36346.1|CBM2|GH5_40 121 ANPVPTSFALNGTTC 135 *************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (516 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 116.85 // Query: UFR01166.1|CBM2|GH5_40 [L=491] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-37 114.9 14.5 1.1e-37 114.9 14.5 1.9 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 114.9 14.5 1.1e-37 1.1e-37 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -2.8 0.0 0.51 0.51 45 72 .. 406 415 .. 397 424 .. 0.60 Alignments for each domain: == domain 1 score: 114.9 bits; conditional E-value: 1.1e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W+gGfq++v++tn+ + a++gW+ltf+l++gq++t++Wna++sqsg+tvt+ n+swng++ +gasv+ gf +s+sg UFR01166.1|CBM2|GH5_40 36 CTVEYAVTSQWDGGFQGSVKITNNRT-ALSGWKLTFDLAGGQKVTQGWNAEWSQSGTTVTAANESWNGTLGTGASVSAGFLASWSGG 121 9**********************998.9**********************************************************9 PP CBM2.hmm 88 saaptaftlngaac 101 ++ap+ f+lng++c UFR01166.1|CBM2|GH5_40 122 NTAPAVFKLNGTTC 135 ************99 PP == domain 2 score: -2.8 bits; conditional E-value: 0.51 CBM2.hmm 45 tssWnatvsqsgntvtvtnaswngsiap 72 +s Wn t +ap UFR01166.1|CBM2|GH5_40 406 ESCWNST------------------LAP 415 4455554..................444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (491 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 108.06 // Query: UJA13648.1|CBM2|GH5_40 [L=491] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-36 109.0 16.3 7.5e-36 109.0 16.3 1.8 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 109.0 16.3 7.5e-36 7.5e-36 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -3.5 0.0 0.85 0.85 64 72 .. 407 415 .. 389 421 .. 0.68 Alignments for each domain: == domain 1 score: 109.0 bits; conditional E-value: 7.5e-36 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vt +W++Gfq++v++tn+++ a+ngW+ltf++++gq++t++Wna++sqs +tvt+ n+swng++ +ga +t gf +s+sg+ UJA13648.1|CBM2|GH5_40 36 CTVEYAVTAQWDNGFQGTVKITNNEA-AVNGWKLTFDFAAGQKVTQGWNAKWSQSATTVTAANESWNGTLGTGAGTTAGFLASWSGT 121 9**********************998.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +a ptaf+lng++c UJA13648.1|CBM2|GH5_40 122 NAVPTAFRLNGTPC 135 ************99 PP == domain 2 score: -3.5 bits; conditional E-value: 0.85 CBM2.hmm 64 aswngsiap 72 wn+++ap UJA13648.1|CBM2|GH5_40 407 SCWNSTLAP 415 345665555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (491 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 108.44 // Query: WKX14453.1|CBM2|GH5_40 [L=493] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-37 113.9 11.3 6e-37 112.6 11.3 1.8 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 112.6 11.3 6e-37 6e-37 1 101 [] 36 135 .. 36 135 .. 0.98 Alignments for each domain: == domain 1 score: 112.6 bits; conditional E-value: 6e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W++Gfqa v++tn+++ a+++W+ltf+l++gq+i+++Wna++sqsg+tvt+ n+s+ngs+a+gas++ gf +s sgs WKX14453.1|CBM2|GH5_40 36 CTVEYSVTSQWDTGFQAAVRITNNTA-AVSSWRLTFDLAGGQKINQGWNAKWSQSGTTVTAANESYNGSLATGASISAGFLASRSGS 121 9**********************988.9**********************************************************9 PP CBM2.hmm 88 saaptaftlngaac 101 +a pt+f+lng +c WKX14453.1|CBM2|GH5_40 122 TAVPTSFQLNGITC 135 999********998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (493 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 113.47 // Query: WBP84706.1|CBM2|GH5_40 [L=505] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-34 105.1 16.8 2.7e-34 104.0 16.8 1.6 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 104.0 16.8 2.7e-34 2.7e-34 1 101 [] 45 145 .. 45 145 .. 0.99 Alignments for each domain: == domain 1 score: 104.0 bits; conditional E-value: 2.7e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v+y+v ++Wg+Gf+ nvt+t tg+++ingWtl t+p++qt++++Wn++++qsg+tvtvtn+s++ +i+pga+ t n s++g+ WBP84706.1|CBM2|GH5_40 45 CNVSYAVGNDWGSGFTTNVTITDTGTTPINGWTLGYTYPGNQTLQNGWNGNWTQSGQTVTVTNPSYAPTINPGATYTTSANFSYTGT 131 9************************************************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++aptaft+ng++c WBP84706.1|CBM2|GH5_40 132 NTAPTAFTVNGTPC 145 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (505 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 112.19 // Query: XDQ77593.1|CBM2|GH5_40 [L=509] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-31 92.6 15.2 2.3e-30 91.4 15.2 1.7 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.4 15.2 2.3e-30 2.3e-30 1 101 [] 40 139 .. 40 139 .. 0.98 Alignments for each domain: == domain 1 score: 91.4 bits; conditional E-value: 2.3e-30 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C v+y+ ++Wg+Gf+anvt+t tg+++ingWtl +++++qt++++Wn+t++q+g++vtvtn++++ +i+pga t n s++g XDQ77593.1|CBM2|GH5_40 40 CGVSYA-VNDWGSGFTANVTITDTGTTPINGWTLGYAYTGNQTLQNGWNGTWTQTGQSVTVTNPAYAPTINPGAGYTTSANFSYTGP 125 889999.7*****************************************************************************99 PP CBM2.hmm 88 saaptaftlngaac 101 ++aptaft+ng+ac XDQ77593.1|CBM2|GH5_40 126 NTAPTAFTVNGTAC 139 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (509 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 120.43 // Query: XDQ75279.1|CBM2|GH5_40 [L=496] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-33 101.3 13.9 4.8e-33 100.0 13.9 1.7 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.0 13.9 4.8e-33 4.8e-33 1 101 [] 21 120 .. 21 120 .. 0.99 Alignments for each domain: == domain 1 score: 100.0 bits; conditional E-value: 4.8e-33 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+v+ +W gG+ + vt+tn+++ a+++W+l f +p+gq ++++W +t+sq+g++vtv n+swng++ +ga+v+ gf +s++g+ XDQ75279.1|CBM2|GH5_40 21 CTVEYSVAGQWAGGYRGAVTITNNSA-ALTSWSLGFGFPAGQVVSQGWGGTWSQTGASVTVVNESWNGTLGTGAKVSGGFIASWTGA 106 9**********************998.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++aptaftlng++c XDQ75279.1|CBM2|GH5_40 107 NTAPTAFTLNGTPC 120 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (496 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.69 // Query: XSC33334.1|CBM2|GH5_40 [L=506] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-34 103.4 14.5 4.2e-34 103.4 14.5 2.3 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 103.4 14.5 4.2e-34 4.2e-34 1 101 [] 36 136 .. 36 136 .. 0.99 2 ? -1.1 0.1 0.15 0.15 48 75 .. 401 428 .. 387 440 .. 0.77 Alignments for each domain: == domain 1 score: 103.4 bits; conditional E-value: 4.2e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 C+vtytv+s+W+gGf+anv +tn g+ ai+gWtlt ++p +gq+++++W+at++qsg++v++ + swngs+++gas++ gf g++sg XSC33334.1|CBM2|GH5_40 36 CSVTYTVQSQWPGGFSANVAITNLGA-AISGWTLTYDFPnAGQSVNNGWSATWTQSGAHVSAASLSWNGSLNTGASTSAGFVGTWSG 121 9************************9.9**********9789********************************************* PP CBM2.hmm 87 ssaaptaftlngaac 101 +++ pt+f+lng+ac XSC33334.1|CBM2|GH5_40 122 ANPVPTSFALNGSAC 136 *************99 PP == domain 2 score: -1.1 bits; conditional E-value: 0.15 CBM2.hmm 48 Wnatvsqsgntvtvtnaswngsiapgas 75 a++ + +n+ ++ w ++iap a+ XSC33334.1|CBM2|GH5_40 401 IAASWHSYSNNACASASCWDSQIAPLAQ 428 5678888889999999999999999554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (506 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 108.46 // Query: XEC29489.1|CBM2|GH5_40 [L=520] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-36 110.5 15.1 7.3e-36 109.1 15.1 1.8 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 109.1 15.1 7.3e-36 7.3e-36 1 101 [] 41 140 .. 41 140 .. 0.99 Alignments for each domain: == domain 1 score: 109.1 bits; conditional E-value: 7.3e-36 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vt++W gGfq++v+vtn+++ a+++Wtl f +p+gq ++++W +++sqsg++vtv n+swng++ +ga+vt gf +s++gs XEC29489.1|CBM2|GH5_40 41 CTVEYSVTNQWTGGFQGSVSVTNNST-ALSSWTLGFGFPAGQAVSQGWGGKWSQSGTSVTVVNESWNGALGTGAKVTAGFIASWTGS 126 9**********************998.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++aptaftlnga+c XEC29489.1|CBM2|GH5_40 127 NPAPTAFTLNGAPC 140 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (520 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 122.47 // Query: UWE08315.1|CBM2|GH5_40 [L=521] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-36 108.7 12.2 2.8e-35 107.2 12.2 1.8 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 107.2 12.2 2.8e-35 2.8e-35 1 101 [] 39 138 .. 39 138 .. 0.99 Alignments for each domain: == domain 1 score: 107.2 bits; conditional E-value: 2.8e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v ytvt++W+ Gfq+nv +tntg+ ++++W l+f +++gq++t++Wnat+ qsg+tv +t++s+ng+ia+g++v+ gf gs+sg UWE08315.1|CBM2|GH5_40 39 CSVLYTVTNQWDAGFQGNVVITNTGA-PTTSWDLSFGFADGQKVTQGWNATWVQSGTTVHATSMSYNGAIATGGTVSAGFLGSWSGR 124 9**********************999.***********************************************************9 PP CBM2.hmm 88 saaptaftlngaac 101 +a p+ ftlngaac UWE08315.1|CBM2|GH5_40 125 NAIPNGFTLNGAAC 138 999*********99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (521 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.82 // Query: XCJ74339.1|CBM2|GH5_40 [L=491] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-36 109.6 15.4 1e-35 108.6 15.4 1.6 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 108.6 15.4 1e-35 1e-35 1 101 [] 35 134 .. 35 134 .. 0.99 Alignments for each domain: == domain 1 score: 108.6 bits; conditional E-value: 1e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v+y+vts+W++Gfq+ v+vtn+g+ a ++W+l+f++++gq++t++W+a++sqsg+t t+ n+swng++a+g+sv+ gf gs+sg+ XCJ74339.1|CBM2|GH5_40 35 CSVEYSVTSQWNSGFQGAVKVTNNGA-AKDSWSLSFDFADGQKVTQGWSAKWSQSGTTATAANESWNGTLASGGSVSAGFLGSWSGA 120 9************************9.99********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++ p++f+lng++c XCJ74339.1|CBM2|GH5_40 121 NTVPKTFRLNGVTC 134 ***********999 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (491 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 108.51 // Query: BGA23567.1|CBM2|GH5_40 [L=488] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-34 102.5 11.6 2.7e-33 100.8 11.6 2.0 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.8 11.6 2.7e-33 2.7e-33 1 101 [] 39 138 .. 39 138 .. 0.99 Alignments for each domain: == domain 1 score: 100.8 bits; conditional E-value: 2.7e-33 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v+yt t++Wg+Gf a vt++n gs+a++gWtlt +++++qt++++W++++sqsg+++tvt++swn+s+++g+sv+ g n s+sgs BGA23567.1|CBM2|GH5_40 39 CRVDYT-TNDWGSGFGAGVTISNVGSAAVDGWTLTYSYAGDQTLQHGWSGNWSQSGKQITVTSMSWNSSVPAGGSVSTGANFSYSGS 124 99***9.9******************************************************************************* PP CBM2.hmm 88 saaptaftlngaac 101 +a+p++f++nga+c BGA23567.1|CBM2|GH5_40 125 NAKPADFAVNGAEC 138 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (488 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 114.02 // Query: WBB75865.1|CBM2|GH5_40 [L=521] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-35 107.5 16.2 6.4e-35 106.0 16.2 1.9 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 106.0 16.2 6.4e-35 6.4e-35 1 101 [] 35 135 .. 35 135 .. 0.98 Alignments for each domain: == domain 1 score: 106.0 bits; conditional E-value: 6.4e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 Ctv+ytv+s+W gGf++nv +tn gs a+++Wtltf++p + q++t++W+at+sqsg++v++ + swngs+a+g+s+t+gfngs+sg WBB75865.1|CBM2|GH5_40 35 CTVAYTVQSQWTGGFTGNVAITNLGS-AVTSWTLTFDFPtATQRVTQGWSATWSQSGARVSAASLSWNGSLATGGSTTIGFNGSWSG 120 9************************9.9***********77799******************************************* PP CBM2.hmm 87 ssaaptaftlngaac 101 +++ pt+f+lng++c WBB75865.1|CBM2|GH5_40 121 ANPVPTSFALNGTTC 135 *************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (521 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 115.23 // Query: WDM16038.1|CBM2|GH5_40 [L=650] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-31 94.7 6.9 2.2e-31 94.7 6.9 3.1 3 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.6 0.2 0.9 0.9 44 54 .. 416 426 .. 400 436 .. 0.60 2 ? -3.2 4.7 0.7 0.7 43 58 .. 497 512 .. 444 545 .. 0.49 3 ! 94.7 6.9 2.2e-31 2.2e-31 1 101 [] 547 647 .. 547 647 .. 0.99 Alignments for each domain: == domain 1 score: -3.6 bits; conditional E-value: 0.9 CBM2.hmm 44 itssWnatvsq 54 + + Wn+t ++ WDM16038.1|CBM2|GH5_40 416 LIEDWNGTPTS 426 44456665554 PP == domain 2 score: -3.2 bits; conditional E-value: 0.7 CBM2.hmm 43 titssWnatvsqsgnt 58 +++s atv++ +++ WDM16038.1|CBM2|GH5_40 497 AVSASNRATVTGLSGN 512 2222222222222222 PP == domain 3 score: 94.7 bits; conditional E-value: 2.2e-31 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v y+ +Wg+Gfq ++t++ntg++a+++W+l ft+++gqti+++W +t +q+g++v+v +as+ +i +g+svt+gf ++ + + WDM16038.1|CBM2|GH5_40 547 CSVGYRLVGDWGSGFQSEITIRNTGAAAVSNWKLGFTFTNGQTISNMWGGTPTQTGGSVSVIPASYTDTITAGGSVTLGFIANRGAT 633 9***********************************************************************************999 PP CBM2.hmm 88 saaptaftlngaac 101 ++apt+ftl g +c WDM16038.1|CBM2|GH5_40 634 NTAPTTFTLSGRTC 647 999********999 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (650 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 48.42 // Query: WUX64028.1|CBM2|GH5_40 [L=597] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-22 66.2 10.0 1.7e-22 66.2 10.0 2.7 3 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 66.2 10.0 1.7e-22 1.7e-22 1 89 [. 36 128 .. 36 149 .. 0.82 2 ? -2.4 0.1 0.37 0.37 88 98 .. 238 248 .. 197 257 .. 0.62 3 ? -2.6 0.6 0.44 0.44 48 66 .. 493 511 .. 451 533 .. 0.57 Alignments for each domain: == domain 1 score: 66.2 bits; conditional E-value: 1.7e-22 CBM2.hmm 1 CtvtytvtssW.....ggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapga.svtfgfn 81 C+vty+ s+W +gGf+ ++ ++n g+ +++ W+ltft+psgqt t +Wnat++++ ++vt++ a wng+ia+ + s+++g++ WUX64028.1|CBM2|GH5_40 36 CEVTYQNPSTWqstptSGGFNTTLAIKNLGD-PTTHWKLTFTMPSGQTATGGWNATFTGT-TSVTASDAGWNGAIATDQtSTSVGLQ 120 9**********66666679************.9*************************99.8***************662778**** PP CBM2.hmm 82 gsgsgssa 89 g+++ s+a WUX64028.1|CBM2|GH5_40 121 GEWTRSTA 128 ***94422 PP == domain 2 score: -2.4 bits; conditional E-value: 0.37 CBM2.hmm 88 saaptaftlng 98 ++ap+++t++g WUX64028.1|CBM2|GH5_40 238 TTAPAKVTVTG 248 22244444443 PP == domain 3 score: -2.6 bits; conditional E-value: 0.44 CBM2.hmm 48 Wnatvsqsgntvtvtnasw 66 a++ + + + vt a w WUX64028.1|CBM2|GH5_40 493 VMASWHSYNFNACVTAACW 511 3333333444444444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (597 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 103.62 // Query: UXY31019.1|CBM2|GH5_40 [L=490] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-36 109.8 16.9 4.3e-36 109.8 16.9 1.9 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 109.8 16.9 4.3e-36 4.3e-36 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -2.9 0.0 0.57 0.57 64 72 .. 406 414 .. 392 423 .. 0.66 Alignments for each domain: == domain 1 score: 109.8 bits; conditional E-value: 4.3e-36 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vt +W++Gfq+ v++tn+++ a++gW+ltf++++gq++t++W+a++sqsg+tvt n+swngs+ +gasv+ gf gs+sgs UXY31019.1|CBM2|GH5_40 36 CTVEYSVTGQWDTGFQGAVKITNNTA-ALSGWSLTFDFANGQKVTQGWSAKWSQSGTTVTTANESWNGSLGTGASVSAGFLGSWSGS 121 9**********************988.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +a ptaf+lng++c UXY31019.1|CBM2|GH5_40 122 NAVPTAFKLNGTTC 135 ************99 PP == domain 2 score: -2.9 bits; conditional E-value: 0.57 CBM2.hmm 64 aswngsiap 72 wn+++ap UXY31019.1|CBM2|GH5_40 406 SCWNSTLAP 414 336666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (490 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 86.24 // Query: XCE95268.1|CBM2|GH5_40 [L=512] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-35 108.0 15.4 5.8e-35 106.2 15.4 2.1 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 106.2 15.4 5.8e-35 5.8e-35 1 101 [] 35 135 .. 35 135 .. 0.99 Alignments for each domain: == domain 1 score: 106.2 bits; conditional E-value: 5.8e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 C+v+ytv+s+W gGf++n+ +tn gs a++gWtltf++p sgq++t++W+at+sqsg++v++ + swngs+ +g+s+ +gfngs+sg XCE95268.1|CBM2|GH5_40 35 CSVAYTVQSQWTGGFSGNIAITNLGS-AVTGWTLTFDFPtSGQQVTQGWSATWSQSGTRVSAASLSWNGSLGTGGSTAIGFNGSWSG 120 9************************9.9***********999********************************************* PP CBM2.hmm 87 ssaaptaftlngaac 101 s++ pt+f+lng++c XCE95268.1|CBM2|GH5_40 121 SNPVPTSFALNGTTC 135 *************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (512 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.85 // Query: BFD89003.1|CBM2|GH5_40 [L=505] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-36 111.6 11.9 2.4e-36 110.6 11.9 1.6 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 110.6 11.9 2.4e-36 2.4e-36 1 101 [] 38 137 .. 38 137 .. 0.99 Alignments for each domain: == domain 1 score: 110.6 bits; conditional E-value: 2.4e-36 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v+y++ ++W+gGfqa+v +tn+g+ +++gW+l f++++gq +t++W+a++sqsg++vt+ n+swngs+ +gasvt+gf+gs+sg BFD89003.1|CBM2|GH5_40 38 CSVAYATVNQWDGGFQASVAITNNGA-PTSGWSLGFDFAGGQHLTQGWSASWSQSGSRVTAVNESWNGSLGTGASVTIGFTGSWSGG 123 9************************9.************************************************************ PP CBM2.hmm 88 saaptaftlngaac 101 ++aptaftlng ac BFD89003.1|CBM2|GH5_40 124 NPAPTAFTLNGLAC 137 ***********988 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (505 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 114.78 // Query: WRK40578.1|CBM2|GH5_40 [L=525] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-34 105.0 13.4 4.2e-34 103.4 13.4 1.9 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 103.4 13.4 4.2e-34 4.2e-34 1 101 [] 38 137 .. 38 137 .. 0.99 Alignments for each domain: == domain 1 score: 103.4 bits; conditional E-value: 4.2e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+v +W gG+q+ vtvtn+++ a+++W+l f++p+gq ++++W +++sqsg++vtv n+swn+++ +ga+vt gf +s++g+ WRK40578.1|CBM2|GH5_40 38 CTVEYSVVGQWAGGYQGAVTVTNNSA-ALSSWSLGFDFPAGQVVSQGWGGKWSQSGASVTVVNESWNAALGTGAKVTGGFIASWTGA 123 9**********************998.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++aptaftlng++c WRK40578.1|CBM2|GH5_40 124 NTAPTAFTLNGTPC 137 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (525 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 118.65 // Query: WNM33780.1|CBM2|GH5_40 [L=492] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-37 112.5 16.1 6.3e-37 112.5 16.1 2.0 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 112.5 16.1 6.3e-37 6.3e-37 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -2.3 0.0 0.37 0.37 63 73 .. 407 417 .. 394 426 .. 0.70 Alignments for each domain: == domain 1 score: 112.5 bits; conditional E-value: 6.3e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W +Gfq+ v++tn+++ a+++Wtltf+l++gq++t++Wna++sqsg+tvt+ n+swngs+ +gasv+ gf +s++gs WNM33780.1|CBM2|GH5_40 36 CTVDYSVTSQWATGFQGAVRITNNQA-ALSSWTLTFDLAGGQKVTQGWNAKWSQSGTTVTAANESWNGSLGTGASVSAGFLASWAGS 121 9**********************988.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +a p++f+lng++c WNM33780.1|CBM2|GH5_40 122 NAVPATFKLNGTTC 135 ************99 PP == domain 2 score: -2.3 bits; conditional E-value: 0.37 CBM2.hmm 63 naswngsiapg 73 + wn++iap WNM33780.1|CBM2|GH5_40 407 ESCWNSTIAPV 417 44577777664 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (492 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 95.70 // Query: WUX71115.1|CBM2|GH5_40 [L=490] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-38 117.7 12.1 4e-38 116.3 12.1 1.8 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 116.3 12.1 4e-38 4e-38 1 101 [] 36 135 .. 36 135 .. 0.99 Alignments for each domain: == domain 1 score: 116.3 bits; conditional E-value: 4e-38 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+ ts+W+gGfq+ vt+tn+gs ++ +W+ltf++p++q++t++Wn+++sqsg tvtv n+swng+i++g+s + gf++s+sgs WUX71115.1|CBM2|GH5_40 36 CTVEYSATSQWDGGFQGGVTLTNNGS-PVASWSLTFDFPGSQRVTQGWNGKWSQSGRTVTVVNESWNGAIPTGGSLSAGFTASWSGS 121 9************************9.************************************************************ PP CBM2.hmm 88 saaptaftlngaac 101 ++ap+af+lng++c WUX71115.1|CBM2|GH5_40 122 NPAPAAFKLNGTTC 135 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (490 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 115.87 // Query: WNI18794.1|CBM2|GH5_40 [L=511] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-36 109.7 12.1 1e-35 108.6 12.1 1.7 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 108.6 12.1 1e-35 1e-35 1 101 [] 39 138 .. 39 138 .. 0.98 Alignments for each domain: == domain 1 score: 108.6 bits; conditional E-value: 1e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v+y+v s+W++Gfq++vt+tn+ + a+++W+ltf++p++q +t++Wn++++qsg+tvtv + s+ng+ia+g++ + gf +++sgs WNI18794.1|CBM2|GH5_40 39 CAVSYSVVSQWDSGFQGDVTITNNAA-ATTSWNLTFDFPGNQHVTQGWNGDWTQSGGTVTVASLSYNGTIATGGTLSTGFLANWSGS 124 9**********************888.899********************************************************* PP CBM2.hmm 88 saaptaftlngaac 101 ++apt+f+lng+ c WNI18794.1|CBM2|GH5_40 125 NPAPTSFRLNGTLC 138 ***********988 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (511 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 115.91 // Query: XLX05628.1|CBM2|GH5_40 [L=494] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-37 113.9 17.9 2.2e-37 113.9 17.9 1.9 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 113.9 17.9 2.2e-37 2.2e-37 1 101 [] 37 136 .. 37 136 .. 0.99 2 ? -3.2 0.0 0.69 0.69 60 85 .. 384 410 .. 380 423 .. 0.54 Alignments for each domain: == domain 1 score: 113.9 bits; conditional E-value: 2.2e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W++Gfq+ vt+tn+++ a+++W+ltf++++gq+++++Wna++sqsg+tvt+ n++wngs+a+gasv+ gf +s+sg XLX05628.1|CBM2|GH5_40 37 CTVEYSVTSQWDTGFQGAVTITNNTA-AVSSWSLTFDFAGGQKVSQGWNAKWSQSGTTVTAANENWNGSLATGASVSAGFLASWSGG 122 9**********************988.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +aapt+f+lng++c XLX05628.1|CBM2|GH5_40 123 NAAPTSFRLNGTTC 136 ************99 PP == domain 2 score: -3.2 bits; conditional E-value: 0.69 CBM2.hmm 60 tvtnaswngsiapgasv.tfgfngsgs 85 t+++ + +g++a+ v +f ++++ s XLX05628.1|CBM2|GH5_40 384 TYKPSDPAGNLAAAWHVyNFNVCANES 410 555566666666644432466666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (494 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 108.02 // Query: XUL92311.1|CBM2|GH5_40 [L=472] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-37 114.3 19.2 1.9e-37 114.2 17.5 2.0 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 114.2 17.5 1.9e-37 1.9e-37 1 101 [] 15 114 .. 15 114 .. 0.99 2 ? -2.7 0.0 0.48 0.48 63 72 .. 387 396 .. 374 409 .. 0.67 Alignments for each domain: == domain 1 score: 114.2 bits; conditional E-value: 1.9e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+Wg+Gfq+ v++tn+ + ++++W+l+f++++gq++t++Wna++sqsg+tvt+tn+swngs+ +gasv+ gf +++sgs XUL92311.1|CBM2|GH5_40 15 CTVEYSVTSQWGTGFQGAVQITNNMA-PVTSWSLSFDFTGGQKVTQGWNAKWSQSGTTVTATNESWNGSLGTGASVSAGFLANWSGS 100 9**********************998.************************************************************ PP CBM2.hmm 88 saaptaftlngaac 101 +a p+af+lng++c XUL92311.1|CBM2|GH5_40 101 NAVPSAFKLNGTTC 114 ************99 PP == domain 2 score: -2.7 bits; conditional E-value: 0.48 CBM2.hmm 63 naswngsiap 72 + wn+++ap XUL92311.1|CBM2|GH5_40 387 ESCWNSTLAP 396 3445555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (472 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.59 // Query: WIM94572.1|CBM2|GH5_40 [L=507] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-36 110.6 6.8 2.4e-36 110.6 6.8 2.1 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 110.6 6.8 2.4e-36 2.4e-36 1 101 [] 34 134 .. 34 134 .. 0.99 2 ? -3.5 0.0 0.83 0.83 45 54 .. 422 431 .. 415 440 .. 0.58 Alignments for each domain: == domain 1 score: 110.6 bits; conditional E-value: 2.4e-36 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 C+vty+++ssW+gGfq++vtv+n g+ ++++W+l f++p gq++t++W+at+sqsg++vt+ ++ wngs+ +gasv +gf+g+++g WIM94572.1|CBM2|GH5_40 34 CAVTYKIASSWPGGFQGDVTVKNLGD-PLSSWSLGFDFPdPGQKVTQGWSATWSQSGAHVTAASMGWNGSLGTGASVGLGFTGTWTG 119 9*************************.************779********************************************* PP CBM2.hmm 87 ssaaptaftlngaac 101 ++ ptaft+ng+ac WIM94572.1|CBM2|GH5_40 120 GNPVPTAFTVNGVAC 134 *************99 PP == domain 2 score: -3.5 bits; conditional E-value: 0.83 CBM2.hmm 45 tssWnatvsq 54 ts Wn ++ WIM94572.1|CBM2|GH5_40 422 TSCWNSQLAP 431 4555555444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (507 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.66 // Query: BFF26426.1|CBM2 [L=251] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-26 78.9 8.6 1.8e-26 78.9 8.6 1.8 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 78.9 8.6 1.8e-26 1.8e-26 1 101 [] 38 136 .. 38 136 .. 0.93 2 ? -2.0 0.1 0.29 0.29 45 57 .. 211 223 .. 198 241 .. 0.56 Alignments for each domain: == domain 1 score: 78.9 bits; conditional E-value: 1.8e-26 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvs.qsgntvtvtnaswngsiapgasvt.fgfngsgsgssaapt 92 C+v+y v ++Wg+Gfqanv++t ++++gWt++++++++ + s+Wn+t + sg+++t++ a wng+ia+g++ + fgf++sg+ s + t BFF26426.1|CBM2 38 CDVEYDVVNDWGSGFQANVSITA--GETLDGWTVEWDFTGAVSGISAWNVTSQsLSGSHFTASDAGWNGAIAAGQTREvFGFTASGN--SGEIT 127 9*********************6..446*************999******9875799********************99*******8..56799 PP CBM2.hmm 93 aftlngaac 101 +++++g+ac BFF26426.1|CBM2 128 NVEVDGVAC 136 9***99998 PP == domain 2 score: -2.0 bits; conditional E-value: 0.29 CBM2.hmm 45 tssWnatvsqsgn 57 +++W++ +++ ++ BFF26426.1|CBM2 211 SKAWSGCATTGTS 223 3444444443322 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (251 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 63.79 // Query: XDQ57242.1|CBM2|GH5_40 [L=491] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-36 111.6 19.0 1.3e-36 111.5 17.2 2.1 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 111.5 17.2 1.3e-36 1.3e-36 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -3.1 0.0 0.62 0.62 63 72 .. 406 415 .. 396 423 .. 0.63 Alignments for each domain: == domain 1 score: 111.5 bits; conditional E-value: 1.3e-36 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W++Gfq+ v+vtn+ s a+++W+ltf++ +gq+i+++Wna++sqsg+tvt++n+swngs+ +g+sv+ gf +s+sgs XDQ57242.1|CBM2|GH5_40 36 CTVEYSVTSQWDTGFQGAVNVTNNMS-AVSSWSLTFDFGHGQKINQGWNAKWSQSGTTVTASNESWNGSLGSGSSVSAGFLASWSGS 121 9**********************999.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +a ptaf+lng++c XDQ57242.1|CBM2|GH5_40 122 NAVPTAFKLNGTTC 135 ************99 PP == domain 2 score: -3.1 bits; conditional E-value: 0.62 CBM2.hmm 63 naswngsiap 72 + wn+++ap XDQ57242.1|CBM2|GH5_40 406 ESCWNSTLAP 415 3446666555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (491 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 108.03 // Query: XHN49642.1|CBM2|GH5_40 [L=583] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-31 94.5 7.2 2.6e-31 94.5 7.2 3.0 3 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.7 0.3 0.97 0.97 41 54 .. 346 359 .. 333 367 .. 0.60 2 ? -3.0 4.2 0.59 0.59 43 85 .. 420 457 .. 388 476 .. 0.45 3 ! 94.5 7.2 2.6e-31 2.6e-31 1 101 [] 480 580 .. 480 580 .. 0.99 Alignments for each domain: == domain 1 score: -3.7 bits; conditional E-value: 0.97 CBM2.hmm 41 gqtitssWnatvsq 54 g+ + + Wn+t ++ XHN49642.1|CBM2|GH5_40 346 GSVLIEDWNGTPTS 359 44444556666554 PP == domain 2 score: -3.0 bits; conditional E-value: 0.59 CBM2.hmm 43 titssWnatvsqsg.ntvtvtnaswngsiapgasvtfgfngsgs 85 ++t + +v +s n+ tvt s n tf + ++ + XHN49642.1|CBM2|GH5_40 420 RVTGGTETQVAGSAsNRATVTGLSGNT------AYTFAVYAKDA 457 233333333332222444444444443......44444444444 PP == domain 3 score: 94.5 bits; conditional E-value: 2.6e-31 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v y+ +Wg+Gfq ++t++ntg++a+++W+l ft+++gqti+++W +t +q+g++v+v +as+ +i +g+svt+gf ++ + + XHN49642.1|CBM2|GH5_40 480 CSVGYRLVGDWGSGFQSEITIRNTGAAAVSNWKLGFTFTNGQTINNMWGGTPTQTGGSVSVIPASYTDTITAGGSVTLGFIANRGAT 566 9***********************************************************************************999 PP CBM2.hmm 88 saaptaftlngaac 101 ++apt+ftl g +c XHN49642.1|CBM2|GH5_40 567 NTAPTTFTLSGRTC 580 999********999 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (583 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 40.35 // Query: UOZ04733.1|CBM2|GH5_40 [L=496] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-34 102.4 9.6 2.6e-33 100.9 9.6 1.9 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.9 9.6 2.6e-33 2.6e-33 1 101 [] 37 136 .. 37 136 .. 0.99 Alignments for each domain: == domain 1 score: 100.9 bits; conditional E-value: 2.6e-33 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v yt ++Wg+Gf+an+t++n g+++++gW+++ +++++q+++++Wnat+ q+g tvtvt+a wng+iapg+s+t g n +sg+ UOZ04733.1|CBM2|GH5_40 37 CEVGYT-VNDWGSGFTANLTLKNLGTAPLSGWQISYAYAGNQQLQQGWNATWAQTGRTVTVTPAGWNGTIAPGSSITAGANFGYSGT 122 999999.7******************************************************************************* PP CBM2.hmm 88 saaptaftlngaac 101 ++ap++++++ga+c UOZ04733.1|CBM2|GH5_40 123 NTAPASISVDGAPC 136 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (496 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 116.35 // Query: XDQ39064.1|CBM2|GH5_40 [L=498] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-36 110.6 11.0 2.5e-36 110.6 11.0 2.0 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 110.6 11.0 2.5e-36 2.5e-36 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -2.8 0.1 0.5 0.5 63 72 .. 413 422 .. 396 431 .. 0.67 Alignments for each domain: == domain 1 score: 110.6 bits; conditional E-value: 2.5e-36 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W++Gfq+ v++tn+++ a+++W+l+f++++g ++t++Wna++sqsg+tvt+ n+swng++ +gasv+ gf +s sgs XDQ39064.1|CBM2|GH5_40 36 CTVEYSVTSQWDSGFQGAVEITNNTA-ALSSWSLSFDFAGGPQVTQGWNAKWSQSGTTVTAVNESWNGALGTGASVSAGFIASRSGS 121 9**********************988.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +a p+af+lng+ c XDQ39064.1|CBM2|GH5_40 122 DAVPAAFKLNGTIC 135 999********988 PP == domain 2 score: -2.8 bits; conditional E-value: 0.5 CBM2.hmm 63 naswngsiap 72 + wn+++ap XDQ39064.1|CBM2|GH5_40 413 ESCWNSTLAP 422 3446666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (498 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 109.81 // Query: BFE61925.1|CBM2|GH5_40 [L=501] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-36 110.1 12.0 1.2e-35 108.4 12.0 2.0 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 108.4 12.0 1.2e-35 1.2e-35 1 101 [] 34 132 .. 34 132 .. 0.99 Alignments for each domain: == domain 1 score: 108.4 bits; conditional E-value: 1.2e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+vtyt ts+W+gGf+a +tv+n g+ a+++Wtl +t+++gq ++++W+at++qsg++vt+ + s+ng++a+gas+++gfngs++gs BFE61925.1|CBM2|GH5_40 34 CQVTYT-TSDWPGGFTAAITVKNLGD-AVSSWTLGWTFAAGQHVDQGWSATYTQSGANVTAASLSYNGALATGASTSIGFNGSWTGS 118 9****9.9******************.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +++p+aftlng++c BFE61925.1|CBM2|GH5_40 119 NPKPAAFTLNGVTC 132 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (501 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 114.61 // Query: UZF74842.1|CBM2|GH5_40 [L=499] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-33 100.7 14.3 9.5e-33 99.1 14.3 2.0 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 99.1 14.3 9.5e-33 9.5e-33 1 101 [] 33 132 .. 33 132 .. 0.99 Alignments for each domain: == domain 1 score: 99.1 bits; conditional E-value: 9.5e-33 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+vty+ +++Wg+Gf+ +v + n gs+a++gWtlt +++++qt++++W +t++qsg++vtvtnaswn++i++g+sv+ g n s+sg+ UZF74842.1|CBM2|GH5_40 33 CRVTYS-ANDWGSGFSLTVGIANVGSAAVDGWTLTYSYAGNQTLQQGWMGTWTQSGKRVTVTNASWNSAIPAGGSVNTGANFSYSGT 118 9*****.9******************************************************************************* PP CBM2.hmm 88 saaptaftlngaac 101 +++pt+f++ngaac UZF74842.1|CBM2|GH5_40 119 NTTPTDFAVNGAAC 132 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (499 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 110.08 // Query: WBO62750.1|CBM2|GH5_40 [L=492] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-37 112.6 16.6 6e-37 112.6 16.6 2.0 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 112.6 16.6 6e-37 6e-37 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -2.4 0.0 0.4 0.4 44 54 .. 406 416 .. 394 423 .. 0.63 Alignments for each domain: == domain 1 score: 112.6 bits; conditional E-value: 6e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vt++W gGfq++vt+tn+++ a+++W+l f++++gq++t++Wnat+sqsg+tvt+ n+s+ngs+ +ga+vt gf +s+sg+ WBO62750.1|CBM2|GH5_40 36 CTVEYSVTNQWAGGFQGSVTITNNQA-ALSSWQLGFDFADGQKVTQGWNATWSQSGTTVTAANESYNGSLGTGATVTAGFLASWSGK 121 9**********************988.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++ pt+f+lng++c WBO62750.1|CBM2|GH5_40 122 NSVPTTFKLNGTTC 135 ************99 PP == domain 2 score: -2.4 bits; conditional E-value: 0.4 CBM2.hmm 44 itssWnatvsq 54 ts Wn t+ WBO62750.1|CBM2|GH5_40 406 STSCWNSTLAP 416 45566665543 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (492 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 109.64 // Query: WIX85492.1|CBM2|GH5_40 [L=498] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-33 101.7 13.8 4.9e-33 100.0 13.8 2.0 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.0 13.8 4.9e-33 4.9e-33 1 101 [] 32 131 .. 32 131 .. 0.99 Alignments for each domain: == domain 1 score: 100.0 bits; conditional E-value: 4.9e-33 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+vty+ +++Wg+Gf+ v + n g++a++gWtlt +++++qt++++W +t++qsg++vtvtnaswng+i++g+sv+ g n s+sg+ WIX85492.1|CBM2|GH5_40 32 CRVTYS-ANDWGSGFSLAVGIANVGAAAVDGWTLTYSYAGNQTLQQGWMGTWTQSGKRVTVTNASWNGTIPAGGSVNTGANFSYSGT 117 9*****.9******************************************************************************* PP CBM2.hmm 88 saaptaftlngaac 101 +++pt+f++ngaac WIX85492.1|CBM2|GH5_40 118 NTTPTDFAVNGAAC 131 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (498 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 109.08 // Query: UJA11486.1|CBM2|GH5_40 [L=491] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-36 109.0 16.3 7.5e-36 109.0 16.3 1.8 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 109.0 16.3 7.5e-36 7.5e-36 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -3.5 0.0 0.85 0.85 64 72 .. 407 415 .. 389 421 .. 0.68 Alignments for each domain: == domain 1 score: 109.0 bits; conditional E-value: 7.5e-36 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vt +W++Gfq++v++tn+++ a+ngW+ltf++++gq++t++Wna++sqs +tvt+ n+swng++ +ga +t gf +s+sg+ UJA11486.1|CBM2|GH5_40 36 CTVEYAVTAQWDNGFQGTVKITNNEA-AVNGWKLTFDFAAGQKVTQGWNAKWSQSATTVTAANESWNGTLGTGAGTTAGFLASWSGT 121 9**********************998.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +a ptaf+lng++c UJA11486.1|CBM2|GH5_40 122 NAVPTAFRLNGTPC 135 ************99 PP == domain 2 score: -3.5 bits; conditional E-value: 0.85 CBM2.hmm 64 aswngsiap 72 wn+++ap UJA11486.1|CBM2|GH5_40 407 SCWNSTLAP 415 345665555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (491 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.23 // Query: WYV85261.1|CBM2|GH5_40 [L=496] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-35 106.8 15.2 1.3e-34 105.1 15.2 2.0 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 105.1 15.2 1.3e-34 1.3e-34 1 101 [] 36 135 .. 36 135 .. 0.98 Alignments for each domain: == domain 1 score: 105.1 bits; conditional E-value: 1.3e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vt +W+ Gfq+ v++tn+ + a+n+Wtltf++++gq++t++W+a++sqsg++vt+ n+swngs+ +gasv+ gf +s++ + WYV85261.1|CBM2|GH5_40 36 CTVEYSVTGQWDAGFQGAVRITNNAA-AVNSWTLTFDFANGQKVTQGWSAKWSQSGTAVTAVNESWNGSLGTGASVDAGFVASKGAT 121 9**********************887.9********************************************************999 PP CBM2.hmm 88 saaptaftlngaac 101 +a pt+f+lng++c WYV85261.1|CBM2|GH5_40 122 NAVPTTFRLNGTTC 135 999*********99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (496 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 119.99 // Query: WIY00208.1|CBM2|GH5_40 [L=500] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-33 100.1 10.1 4.6e-33 100.1 10.1 2.2 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 100.1 10.1 4.6e-33 4.6e-33 1 101 [] 37 136 .. 37 136 .. 0.99 2 ? -1.5 0.0 0.2 0.2 45 77 .. 234 266 .. 211 291 .. 0.60 Alignments for each domain: == domain 1 score: 100.1 bits; conditional E-value: 4.6e-33 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v yt ++Wg+Gf+an+t++n g+++++gW+++ t++++q+++++Wn+t+ qsg t+tvt+a wng+iap+asvt g n + g+ WIY00208.1|CBM2|GH5_40 37 CEVGYT-VNDWGSGFTANLTLKNLGTAPLSGWRISYTYTGNQQLQQGWNGTWAQSGPTITVTPATWNGTIAPNASVTAGANFGYRGT 122 999999.7******************************************************************************* PP CBM2.hmm 88 saaptaftlngaac 101 +aapt+f++ng++c WIY00208.1|CBM2|GH5_40 123 NAAPTSFSVNGEPC 136 ************99 PP == domain 2 score: -1.5 bits; conditional E-value: 0.2 CBM2.hmm 45 tssWnatvsqsgntvtvtnaswngsiapgasvt 77 + n+++ g+t+++ +s+ +++++ v WIY00208.1|CBM2|GH5_40 234 LGLSNVDLRYAGATYRAALKSYVDLLHQNGVVA 266 456677777788888888888887777777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (500 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 104.02 // Query: XHM91755.1|CBM2|GH5_40 [L=507] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-34 103.5 17.5 4e-34 103.5 17.5 2.5 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 103.5 17.5 4e-34 4e-34 1 101 [] 38 137 .. 38 137 .. 0.99 2 ? -0.7 0.2 0.12 0.12 27 74 .. 221 270 .. 217 298 .. 0.57 Alignments for each domain: == domain 1 score: 103.5 bits; conditional E-value: 4e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C vty+ t++Wg+Gf+anvtvtntg++a+ngWtlt +++++q+++++Wn+t+sqs+n vtv++ s+ng++a+g+s++ g n s+sgs XHM91755.1|CBM2|GH5_40 38 CGVTYS-TNDWGSGFTANVTVTNTGTAAVNGWTLTYSYSGNQKLQQGWNGTWSQSDNVVTVKSLSYNGTLAAGGSASAGANFSYSGS 123 99****.9******************************************************************************* PP CBM2.hmm 88 saaptaftlngaac 101 +a+pt+f++ng+ c XHM91755.1|CBM2|GH5_40 124 NATPTSFSVNGVGC 137 ***********999 PP == domain 2 score: -0.7 bits; conditional E-value: 0.12 CBM2.hmm 27 saingWtltftl.psgqtitssWna....tvsqsgntvtvtnaswngsiapga 74 +ai++W +++ p + + Wna ++ sg+t++ +++ +++++ XHM91755.1|CBM2|GH5_40 221 AAIKSWHVNVVRvPLN---EDCWNAlsdvDAAYSGTTYRTAVKNYVDLLHQNG 270 5677888776430222...4555554433555777777777777766555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (507 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.01 // Query: XJJ23883.1|CBM2|GH5_40 [L=497] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-36 109.7 11.5 1.4e-35 108.1 11.5 1.9 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 108.1 11.5 1.4e-35 1.4e-35 1 101 [] 21 120 .. 21 120 .. 0.99 Alignments for each domain: == domain 1 score: 108.1 bits; conditional E-value: 1.4e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+v+ +W+gG+q+ +tvtn+++ a++gW+l f++p+gq ++++W +++sqs ++vtvtn+swn+s+ +ga++t gf +s++g+ XJJ23883.1|CBM2|GH5_40 21 CTVEYSVAGQWSGGYQGALTVTNNSA-ALDGWSLGFDFPAGQVVSQGWGGKWSQSAASVTVTNESWNASLGTGAKITAGFIASWTGT 106 9**********************998.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++aptaftlng++c XJJ23883.1|CBM2|GH5_40 107 NPAPTAFTLNGTPC 120 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (497 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 108.44 // Query: XTR40781.1|CBM2|GH5_40 [L=493] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-36 109.3 14.1 1.2e-35 108.3 14.1 1.6 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 108.3 14.1 1.2e-35 1.2e-35 1 101 [] 37 136 .. 37 136 .. 0.99 Alignments for each domain: == domain 1 score: 108.3 bits; conditional E-value: 1.2e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v+y+vt +W++Gfq+ v+vtn+g+ a ++W+l+f++++gq++t++W+a++sqsg+tvt+ n+swng++a+gasv+ gf gs++g+ XTR40781.1|CBM2|GH5_40 37 CSVEYSVTGQWDSGFQGAVKVTNNGA-AKDSWSLSFDFADGQKVTQGWSAKWSQSGTTVTAANESWNGALASGASVSAGFIGSWKGA 122 9************************9.99********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++ p++f+lng++c XTR40781.1|CBM2|GH5_40 123 NTVPKTFKLNGVTC 136 ***********999 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (493 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 113.24 // Query: XDQ24905.1|CBM2|GH5_40 [L=492] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-35 107.7 18.0 2e-35 107.7 18.0 1.9 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 107.7 18.0 2e-35 2e-35 1 101 [] 37 136 .. 37 136 .. 0.99 2 ? -3.3 0.0 0.76 0.76 45 55 .. 407 417 .. 400 423 .. 0.64 Alignments for each domain: == domain 1 score: 107.7 bits; conditional E-value: 2e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W+ Gfq+ v++ n+++ a+++W+ltf++++gq+++++Wna++sqs +tvt+tn+swngs+ +g+sv+ gf +s+sg XDQ24905.1|CBM2|GH5_40 37 CTVEYSVTSQWDAGFQGAVKIVNNTA-AVSSWSLTFDFAGGQKVNQGWNAKWSQSATTVTATNESWNGSLGTGSSVSAGFVASWSGG 122 9**********************988.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +aaptaf+lng++c XDQ24905.1|CBM2|GH5_40 123 NAAPTAFKLNGTTC 136 ************99 PP == domain 2 score: -3.3 bits; conditional E-value: 0.76 CBM2.hmm 45 tssWnatvsqs 55 s Wn t+s XDQ24905.1|CBM2|GH5_40 407 ASCWNSTLSPV 417 46677777654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (492 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 109.67 // Query: XDQ66937.1|CBM2|GH5_40 [L=491] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-37 113.1 16.4 4.1e-37 113.1 16.4 1.9 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 113.1 16.4 4.1e-37 4.1e-37 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -3.1 0.0 0.62 0.62 63 72 .. 406 415 .. 396 423 .. 0.63 Alignments for each domain: == domain 1 score: 113.1 bits; conditional E-value: 4.1e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W++Gfq+ v++tn+ + a+++W+ltf++++gq++t++W+a++sqsg+tvt+ n+swngs+a+gasv+ gf +s+sgs XDQ66937.1|CBM2|GH5_40 36 CTVEYSVTSQWDTGFQGAVKITNNMA-AVSSWSLTFDFAGGQKVTQGWSAKWSQSGTTVTAANESWNGSLATGASVSAGFLASWSGS 121 9**********************998.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +a ptaf+lng++c XDQ66937.1|CBM2|GH5_40 122 NAVPTAFKLNGTTC 135 ************99 PP == domain 2 score: -3.1 bits; conditional E-value: 0.62 CBM2.hmm 63 naswngsiap 72 + wn+++ap XDQ66937.1|CBM2|GH5_40 406 ESCWNSTLAP 415 3446666555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (491 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 106.28 // Query: UIX29742.1|CBM2|GH5_40 [L=502] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-36 111.0 10.0 4.8e-36 109.7 10.0 1.8 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 109.7 10.0 4.8e-36 4.8e-36 1 101 [] 37 136 .. 37 136 .. 0.99 Alignments for each domain: == domain 1 score: 109.7 bits; conditional E-value: 4.8e-36 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W+ Gfq++v+vtn+ + a+++W+ltf++ +gq++t++Wna++sqsg tvt+ n+s+ngs+ +gasv+ gf +s sgs UIX29742.1|CBM2|GH5_40 37 CTVEYSVTSEWDAGFQGSVKVTNNLA-ALSSWSLTFDFGAGQKVTQGWNAKWSQSGVTVTAANESYNGSLGTGASVSAGFLASRSGS 122 9**********************988.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++ p++f+lng++c UIX29742.1|CBM2|GH5_40 123 NPVPASFKLNGTTC 136 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (502 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 112.80 // Query: BFE81712.1|CBM2 [L=154] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-37 114.4 11.2 2.3e-37 113.9 11.2 1.2 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 113.9 11.2 2.3e-37 2.3e-37 1 101 [] 41 141 .. 41 141 .. 0.97 Alignments for each domain: == domain 1 score: 113.9 bits; conditional E-value: 2.3e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsg..ntvtvtnaswngsiapgasvtfgfngsgsgssaapt 92 C+v+y+ t++W+gGf++nvt++n g+ ai+gWtl ft+++gq+++++W+at+sq ++vt++n +wng++a+gas+++gfngs++gs+++pt BFE81712.1|CBM2 41 CDVAYS-TNDWQGGFTGNVTIKNLGD-AIDGWTLGFTFTAGQRVQQGWSATWSQPAgsDKVTAKNLDWNGKLATGASTSIGFNGSWTGSNPKPT 132 99***9.9******************.9*************************766467*********************************** PP CBM2.hmm 93 aftlngaac 101 +ft+ng+ac BFE81712.1|CBM2 133 DFTVNGVAC 141 *******99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (154 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 49.67 // Query: WFE65191.1|CBM2|GH5_40 [L=516] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-35 106.7 10.6 8.3e-35 105.7 10.6 1.6 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 105.7 10.6 8.3e-35 8.3e-35 1 101 [] 35 135 .. 35 135 .. 0.98 Alignments for each domain: == domain 1 score: 105.7 bits; conditional E-value: 8.3e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 C+vtytv+s+W+gGf++nv vtn g+ ++ +Wtltf++p +q+++++W at++q+g++v++ ++swn+++ +ga +++gfngs+sg WFE65191.1|CBM2|GH5_40 35 CSVTYTVQSQWPGGFTGNVAVTNLGD-PLPNWTLTFDFPePDQQVSHGWGATWTQTGTRVSAASMSWNAALGTGAATSIGFNGSWSG 120 9*************************.************66799******************************************* PP CBM2.hmm 87 ssaaptaftlngaac 101 +++ pt+f+lng++c WFE65191.1|CBM2|GH5_40 121 TNPVPTSFALNGTTC 135 *************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (516 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 118.23 // Query: WCE00640.1|CBM2|GH5_40 [L=491] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-38 115.9 15.9 5.2e-38 115.9 15.9 1.9 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 115.9 15.9 5.2e-38 5.2e-38 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -3.4 0.1 0.79 0.79 63 72 .. 407 416 .. 389 419 .. 0.64 Alignments for each domain: == domain 1 score: 115.9 bits; conditional E-value: 5.2e-38 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vt +W+gGfq+ vtvtn+ + +++gW+l f++++gq++t++Wna++sqsg+tvt+tn+swngs+ +gasv+ gf +s+sgs WCE00640.1|CBM2|GH5_40 36 CTVEYSVTGQWDGGFQGAVTVTNNAA-PVSGWSLGFDFAGGQKVTQGWNAKWSQSGTTVTATNESWNGSLDTGASVSAGFIASWSGS 121 9**********************877.************************************************************ PP CBM2.hmm 88 saaptaftlngaac 101 +a ptaf+lng++c WCE00640.1|CBM2|GH5_40 122 NAVPTAFELNGTTC 135 ************99 PP == domain 2 score: -3.4 bits; conditional E-value: 0.79 CBM2.hmm 63 naswngsiap 72 + wn+++ap WCE00640.1|CBM2|GH5_40 407 ESCWNSTLAP 416 2336666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (491 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 109.02 // Query: WFE97573.1|CBM2|GH5_40 [L=515] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-34 102.8 9.4 1.4e-33 101.7 9.4 1.6 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 101.7 9.4 1.4e-33 1.4e-33 1 101 [] 35 135 .. 35 135 .. 0.98 Alignments for each domain: == domain 1 score: 101.7 bits; conditional E-value: 1.4e-33 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 C+v+ytv+s+W+gGf+a v vtn g+ ++++Wtltf++p +q+++++W at++q+g++ ++ ++swn+++ +ga +++gfngs+sg WFE97573.1|CBM2|GH5_40 35 CSVSYTVQSQWPGGFTAAVAVTNLGD-PLSNWTLTFDFPePDQQVSHGWGATWTQTGTRASAASMSWNAALGTGAMTSIGFNGSWSG 120 9*************************.************66799******************************************* PP CBM2.hmm 87 ssaaptaftlngaac 101 +++ p +f+lng++c WFE97573.1|CBM2|GH5_40 121 TNPVPRSFALNGTTC 135 *************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (515 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 108.55 // Query: UWZ47080.1|CBM2|GH5_40 [L=498] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-35 106.5 12.4 1.5e-34 104.8 12.4 1.9 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 104.8 12.4 1.5e-34 1.5e-34 1 101 [] 34 132 .. 34 132 .. 0.99 Alignments for each domain: == domain 1 score: 104.8 bits; conditional E-value: 1.5e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+vtyt ts+W+gGf+a +tv+n g+ a+++W+l +t+++gq ++++W+at++qsg++vt+ + s+ng++a++as+++gfngs+sgs UWZ47080.1|CBM2|GH5_40 34 CQVTYT-TSDWPGGFTAAITVKNLGD-AVSSWNLGWTFAAGQHVDQGWSATFTQSGANVTAASLSYNGALATNASTSIGFNGSWSGS 118 9****9.9******************.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +++p+aftlng++c UWZ47080.1|CBM2|GH5_40 119 NPKPAAFTLNGVTC 132 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (498 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 115.05 // Query: XRV55376.1|CBM2|GH5_40 [L=510] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-34 103.0 11.7 5.5e-34 103.0 11.7 2.0 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 103.0 11.7 5.5e-34 5.5e-34 1 101 [] 38 137 .. 38 137 .. 0.99 2 ? -3.8 0.0 1 1 47 72 .. 427 434 .. 419 438 .. 0.63 Alignments for each domain: == domain 1 score: 103.0 bits; conditional E-value: 5.5e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+v +W gG+q+ v+vtn+g+ a++gW+l f++++gq i+++W +t+sqsg++vtv n+swng++ +ga+v+ gf +s++g+ XRV55376.1|CBM2|GH5_40 38 CTVEYSVVGQWAGGYQGAVSVTNNGA-ALTGWSLGFDFSAGQVISQGWGGTWSQSGTAVTVVNESWNGALGTGAKVSGGFLASWTGA 123 9************************9.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++ap+aftlng++c XRV55376.1|CBM2|GH5_40 124 NPAPAAFTLNGTPC 137 ************99 PP == domain 2 score: -3.8 bits; conditional E-value: 1 CBM2.hmm 47 sWnatvsqsgntvtvtnaswngsiap 72 Wna ++ap XRV55376.1|CBM2|GH5_40 427 CWNA------------------TLAP 434 4555..................4444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (510 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 110.12 // Query: XCQ84774.1|CBM2|GH5_40 [L=512] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-35 108.0 15.4 5.8e-35 106.2 15.4 2.1 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 106.2 15.4 5.8e-35 5.8e-35 1 101 [] 35 135 .. 35 135 .. 0.99 Alignments for each domain: == domain 1 score: 106.2 bits; conditional E-value: 5.8e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 C+v+ytv+s+W gGf++n+ +tn gs a++gWtltf++p sgq++t++W+at+sqsg++v++ + swngs+ +g+s+ +gfngs+sg XCQ84774.1|CBM2|GH5_40 35 CSVAYTVQSQWTGGFSGNIAITNLGS-AVTGWTLTFDFPtSGQQVTQGWSATWSQSGTRVSAASLSWNGSLGTGGSTAIGFNGSWSG 120 9************************9.9***********999********************************************* PP CBM2.hmm 87 ssaaptaftlngaac 101 s++ pt+f+lng++c XCQ84774.1|CBM2|GH5_40 121 SNPVPTSFALNGTTC 135 *************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (512 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 114.82 // Query: XPA59001.1|CBM2|GH5_40 [L=507] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-35 106.9 15.2 1.2e-34 105.2 15.2 2.0 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 105.2 15.2 1.2e-34 1.2e-34 1 101 [] 35 135 .. 35 135 .. 0.99 Alignments for each domain: == domain 1 score: 105.2 bits; conditional E-value: 1.2e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 C+v+ytv+s+W gGf++nv +tn gs a++gWtltf++p sgq++t++W+a +sqsg++v++ + swngs+ +g+s+t+gfngs+sg XPA59001.1|CBM2|GH5_40 35 CSVAYTVQSQWTGGFSGNVAITNLGS-ALTGWTLTFDFPtSGQQVTQGWSAAWSQSGTSVSAASLSWNGSLGTGGSTTIGFNGSWSG 120 9************************9.9***********999********************************************* PP CBM2.hmm 87 ssaaptaftlngaac 101 s++ p++f+lng++c XPA59001.1|CBM2|GH5_40 121 SNPVPKSFALNGTTC 135 *************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (507 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 111.71 // Query: WFE59709.1|CBM2|GH5_40 [L=507] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-35 106.9 15.2 1.2e-34 105.2 15.2 2.0 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 105.2 15.2 1.2e-34 1.2e-34 1 101 [] 35 135 .. 35 135 .. 0.99 Alignments for each domain: == domain 1 score: 105.2 bits; conditional E-value: 1.2e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 C+v+ytv+s+W gGf++nv +tn gs a++gWtltf++p sgq++t++W+a +sqsg++v++ + swngs+ +g+s+t+gfngs+sg WFE59709.1|CBM2|GH5_40 35 CSVAYTVQSQWTGGFSGNVAITNLGS-ALTGWTLTFDFPtSGQQVTQGWSAAWSQSGTSVSAASLSWNGSLGTGGSTTIGFNGSWSG 120 9************************9.9***********999********************************************* PP CBM2.hmm 87 ssaaptaftlngaac 101 s++ p++f+lng++c WFE59709.1|CBM2|GH5_40 121 SNPVPKSFALNGTTC 135 *************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (507 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 118.39 // Query: WNB98952.1|CBM2|GH5_40 [L=487] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-36 111.2 16.0 1.6e-36 111.2 16.0 1.9 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 111.2 16.0 1.6e-36 1.6e-36 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -3.3 0.0 0.76 0.76 63 72 .. 402 411 .. 388 417 .. 0.67 Alignments for each domain: == domain 1 score: 111.2 bits; conditional E-value: 1.6e-36 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W++Gfq+ v++tn+++ a+++W+ltf++ +gq++t++W+a++sqsg+tvt+ n+swngs+ +gasv+ gf +s+sgs WNB98952.1|CBM2|GH5_40 36 CTVEYSVTSQWDSGFQGAVKITNNSA-AVSSWSLTFDFGAGQKVTQGWSAKWSQSGTTVTAANESWNGSLGTGASVSAGFLASWSGS 121 9**********************998.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +aap +f+lng++c WNB98952.1|CBM2|GH5_40 122 NAAPMSFKLNGTTC 135 ************99 PP == domain 2 score: -3.3 bits; conditional E-value: 0.76 CBM2.hmm 63 naswngsiap 72 + wn+++ap WNB98952.1|CBM2|GH5_40 402 ETCWNSTLAP 411 4456666666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (487 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 110.82 // Query: XAN46519.1|CBM2|GH5_40 [L=503] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-35 108.1 15.4 5.7e-35 106.2 15.4 2.1 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 106.2 15.4 5.7e-35 5.7e-35 1 101 [] 35 135 .. 35 135 .. 0.99 Alignments for each domain: == domain 1 score: 106.2 bits; conditional E-value: 5.7e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 C+v+ytv+s+W gGf++n+ +tn gs a++gWtltf++p sgq++t++W+at+sqsg++v++ + swngs+ +g+s+ +gfngs+sg XAN46519.1|CBM2|GH5_40 35 CSVAYTVQSQWTGGFSGNIAITNLGS-AVTGWTLTFDFPtSGQQVTQGWSATWSQSGTRVSAASLSWNGSLGTGGSTAIGFNGSWSG 120 9************************9.9***********999********************************************* PP CBM2.hmm 87 ssaaptaftlngaac 101 s++ pt+f+lng++c XAN46519.1|CBM2|GH5_40 121 SNPVPTSFALNGTTC 135 *************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (503 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 116.71 // Query: XVQ87766.1|CBM2|GH5_40 [L=505] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-35 106.4 6.1 1.7e-34 104.6 6.1 2.0 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 104.6 6.1 1.7e-34 1.7e-34 1 101 [] 15 115 .. 15 115 .. 0.97 Alignments for each domain: == domain 1 score: 104.6 bits; conditional E-value: 1.7e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 C+v+y+v s+W+gGf ++v +t g +++gWtl+f++p ++q ++++Wna++sqsg++vt+++ swng++++++sv++gf g++sg XVQ87766.1|CBM2|GH5_40 15 CSVQYKVVSEWQGGFGGDVAITSLGG-PLTGWTLEFDFPaADQGVSNGWNADWSQSGAHVTAKSLSWNGNVPSNGSVSIGFIGKWSG 100 9**********************999.************566889****************************************** PP CBM2.hmm 87 ssaaptaftlngaac 101 ++ p+aft+ng++c XVQ87766.1|CBM2|GH5_40 101 RNPVPAAFTVNGVTC 115 *************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (505 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.78 // Query: XKS77868.1|CBM2|GH5_40 [L=497] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-37 114.1 14.7 2.3e-37 113.9 12.7 2.2 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 113.9 12.7 2.3e-37 2.3e-37 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -1.6 0.0 0.22 0.22 45 55 .. 407 417 .. 397 431 .. 0.67 Alignments for each domain: == domain 1 score: 113.9 bits; conditional E-value: 2.3e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vt +W++Gfq+ v++tn+ + a++gW+l f++p+gq++t++Wna++sqsg+tvt+ n+swng +a+gasv+ gf +s+sgs XKS77868.1|CBM2|GH5_40 36 CTVEYSVTGQWDTGFQGAVKITNNMA-ALSGWSLGFDFPNGQKVTQGWNAKWSQSGTTVTAANESWNGPLASGASVSAGFLASWSGS 121 9**********************998.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +a ptaf+lng++c XKS77868.1|CBM2|GH5_40 122 NAVPTAFRLNGTTC 135 ************99 PP == domain 2 score: -1.6 bits; conditional E-value: 0.22 CBM2.hmm 45 tssWnatvsqs 55 +s Wnat+ XKS77868.1|CBM2|GH5_40 407 ESCWNATLAPV 417 45566665544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (497 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 108.72 // Query: WWV98017.1|CBM2|GH5_40 [L=496] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-32 96.0 13.7 2.9e-31 94.3 13.7 2.0 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.3 13.7 2.9e-31 2.9e-31 1 101 [] 43 141 .. 43 141 .. 0.98 Alignments for each domain: == domain 1 score: 94.3 bits; conditional E-value: 2.9e-31 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v yt ++Wg+Gf+a vt+tn g a+ngWtlt +++++q++t +Wn++++qsg+tvtv n+swn+++a+gas++ g + +sg+ WWV98017.1|CBM2|GH5_40 43 CEVGYT-VNDWGTGFTAAVTITNRGP-AVNGWTLTYSYTGNQRLTGGWNGRWTQSGKTVTVANESWNAALATGASAQAGAQFAYSGA 127 999999.7***************999.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +aaptaf+lng+ac WWV98017.1|CBM2|GH5_40 128 NAAPTAFALNGTAC 141 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (496 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 111.68 // Query: WEO94338.1|CBM2|GH5_40 [L=491] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-36 111.5 15.6 1.3e-36 111.5 15.6 1.9 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 111.5 15.6 1.3e-36 1.3e-36 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -2.9 0.0 0.54 0.54 62 72 .. 405 415 .. 389 420 .. 0.63 Alignments for each domain: == domain 1 score: 111.5 bits; conditional E-value: 1.3e-36 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vt++W gGfq++vt+tn+g a+++W+ltf++++gq++t++Wna +sqsg+tvt+ n+s+n+++ +gasvt gf gs++g+ WEO94338.1|CBM2|GH5_40 36 CTVAYSVTNQWAGGFQGSVTITNNGP-AVSSWQLTFDFADGQKVTQGWNAAWSQSGATVTAANESYNAALGSGASVTAGFLGSWQGN 121 9************************9.9**********************************************************9 PP CBM2.hmm 88 saaptaftlngaac 101 ++ pt f+lng++c WEO94338.1|CBM2|GH5_40 122 NTVPTVFKLNGTTC 135 999*********99 PP == domain 2 score: -2.9 bits; conditional E-value: 0.54 CBM2.hmm 62 tnaswngsiap 72 ++ wn+++ap WEO94338.1|CBM2|GH5_40 405 SESCWNSTLAP 415 44456666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (491 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 109.29 // Query: UWZ40923.1|CBM2|GH5_40 [L=525] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-24 71.8 10.3 2.9e-24 71.8 10.3 2.2 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 71.8 10.3 2.9e-24 2.9e-24 1 101 [] 35 148 .. 35 148 .. 0.82 2 ? -2.9 0.2 0.57 0.57 51 72 .. 425 446 .. 398 452 .. 0.62 Alignments for each domain: == domain 1 score: 71.8 bits; conditional E-value: 2.9e-24 CBM2.hmm 1 CtvtytvtssW.....ggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasv.tfgfn 81 C+vty+ s+W +gGf+ ++ +tn g+ +i+ Wtltftlp+gqt ts+Wnat++++ ++vt+t a wngsia+ga++ ++g++ UWZ40923.1|CBM2|GH5_40 35 CSVTYQNLSTWqstptSGGFTTSLAITNLGD-PISHWTLTFTLPGGQTRTSGWNATFTGT-TAVTATDAGWNGSIATGATNaSVGLQ 119 9**********66666679************.**************************99.8*****************8736**** PP CBM2.hmm 82 gsgs........gs.saaptaftlngaac 101 g ++ s ++p++f+lng+ac UWZ40923.1|CBM2|GH5_40 120 GDWTrsasgttaPSpFPQPSDFALNGVAC 148 **985544322211122355566666555 PP == domain 2 score: -2.9 bits; conditional E-value: 0.57 CBM2.hmm 51 tvsqsgntvtvtnaswngsiap 72 ++ + + + vt w ++iap UWZ40923.1|CBM2|GH5_40 425 SWHTYNFNACVTASCWDSQIAP 446 3333333444555555555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (525 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.53 // Query: XSZ73278.1|CBM2|GH5_40 [L=491] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-35 107.7 11.1 1.9e-35 107.7 11.1 2.0 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 107.7 11.1 1.9e-35 1.9e-35 1 101 [] 36 137 .. 36 137 .. 0.96 2 ? -3.1 0.0 0.66 0.66 63 72 .. 406 415 .. 397 422 .. 0.62 Alignments for each domain: == domain 1 score: 107.7 bits; conditional E-value: 1.9e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsg..s 85 C+v+y+vt +W++Gfq+ v++tn+++ a++gW+l+f++++gq++t++Wna++sqsg+tvt+ n+s+ngs+a+gasv gf +s s XSZ73278.1|CBM2|GH5_40 36 CSVEYSVTGQWDTGFQGAVKITNNTA-ALSGWSLSFDFADGQKVTQGWNAKWSQSGTTVTAANESYNGSLATGASVGAGFLASRpaS 121 9**********************988.9*******************************************************9534 PP CBM2.hmm 86 gssaaptaftlngaac 101 gs+a pt+f+lng++c XSZ73278.1|CBM2|GH5_40 122 GSNAVPTSFKLNGTTC 137 77888*********99 PP == domain 2 score: -3.1 bits; conditional E-value: 0.66 CBM2.hmm 63 naswngsiap 72 + wn+++ap XSZ73278.1|CBM2|GH5_40 406 ESCWNSTLAP 415 3446666655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (491 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.69 // Query: UUS31205.1|CBM2|GH5_40 [L=515] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-38 116.3 5.4 8.5e-38 115.3 5.4 1.6 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 115.3 5.4 8.5e-38 8.5e-38 1 101 [] 59 158 .. 59 158 .. 0.99 Alignments for each domain: == domain 1 score: 115.3 bits; conditional E-value: 8.5e-38 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+ytv ++W+gGfq++vtvtn g a++gW+l f +p++q++t++W a++sqsg++vtv n+swn+++apgasvt gf +s+sg+ UUS31205.1|CBM2|GH5_40 59 CTVEYTVVNQWSGGFQGSVTVTNRGP-ALDGWRLGFGFPGDQRVTQGWGARWSQSGASVTVVNESWNAALAPGASVTAGFVASYSGA 144 9**********************999.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++aptaftl+g++c UUS31205.1|CBM2|GH5_40 145 NPAPTAFTLDGTPC 158 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (515 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 122.03 // Query: XCW08671.1|CBM2|GH5_40 [L=488] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-37 111.9 15.5 9.7e-37 111.9 15.5 1.9 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 111.9 15.5 9.7e-37 9.7e-37 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -3.1 0.0 0.63 0.63 64 72 .. 404 412 .. 392 419 .. 0.64 Alignments for each domain: == domain 1 score: 111.9 bits; conditional E-value: 9.7e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W++Gfq+ v++tn+ + a++gW+ltf++++gq++t++W+a++sqsg+tvt+ n+swngs+ +gasv+ gf +s sg+ XCW08671.1|CBM2|GH5_40 36 CTVEYSVTSQWDTGFQGAVKITNNAA-AVSGWSLTFDFADGQKVTQGWSAKWSQSGTTVTAANESWNGSLGTGASVSAGFLASRSGT 121 9**********************887.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +a pt+f+lng++c XCW08671.1|CBM2|GH5_40 122 NAVPTTFQLNGTTC 135 ************99 PP == domain 2 score: -3.1 bits; conditional E-value: 0.63 CBM2.hmm 64 aswngsiap 72 wn+++ap XCW08671.1|CBM2|GH5_40 404 SCWNSTLAP 412 336666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (488 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.90 // Query: XVQ73726.1|CBM2|GH5_40 [L=593] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-24 70.3 8.9 8.9e-24 70.3 8.9 3.7 3 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 70.3 8.9 8.9e-24 8.9e-24 1 96 [. 38 137 .. 37 143 .. 0.88 2 ? 2.2 2.5 0.014 0.014 31 73 .. 164 208 .. 141 245 .. 0.62 3 ? -1.0 0.4 0.14 0.14 45 74 .. 322 352 .. 292 380 .. 0.64 Alignments for each domain: == domain 1 score: 70.3 bits; conditional E-value: 8.9e-24 CBM2.hmm 1 CtvtytvtssWggG..fqanvtvtntgssaingWtltftlpsgqtitssWnatvs.....qsgntvtvtnaswngsiapgasvtfgf 80 C++ty+ +sW++G f an+tvtntg+ +++gWtl+f++p++q it++W + s g+++tvt+ s+n++ +ga+ t+gf XVQ73726.1|CBM2|GH5_40 38 CSATYA--KSWDNGsaFGANITVTNTGD-PLTGWTLSFDFPDNQVITQMWGGVPSpavptPAGGAITVTPTSYNAAQGAGATWTVGF 121 666666..88888877************.**********************976654555888************************ PP CBM2.hmm 81 ngsgsgssaaptaftl 96 ng+++g+++ap+ ++ XVQ73726.1|CBM2|GH5_40 122 NGTYTGANSAPSVSCA 137 *******999987665 PP == domain 2 score: 2.2 bits; conditional E-value: 0.014 CBM2.hmm 31 gWtltftlp..sgqtitssWna...tvs.qsgntvtvtnaswngsiapg 73 g+t++++ + ++ t+ts+ +++ sg+t+t+t +wn XVQ73726.1|CBM2|GH5_40 164 GYTVRLNAQpsGDVTVTSTAGTgdgDITvVSGATLTFTTSDWNT----P 208 44444444321334444332222225555788999999999997....3 PP == domain 3 score: -1.0 bits; conditional E-value: 0.14 CBM2.hmm 45 tssWnat.vsqsgntvtvtnaswngsiapga 74 ++ Wn+t + +g+t++ + +++ + + +g+ XVQ73726.1|CBM2|GH5_40 322 EECWNGTdGTPNGATYQQNVKDYVNLLVAGG 352 4678885256778888888777777666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (593 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 25.89 // Query: XSC30624.1|CBM2|GH5_40 [L=514] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-23 67.9 9.8 5e-23 67.9 9.8 2.6 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 67.9 9.8 5e-23 5e-23 1 101 [] 35 143 .. 35 143 .. 0.89 2 ? -2.3 0.2 0.36 0.36 50 72 .. 413 435 .. 388 441 .. 0.66 Alignments for each domain: == domain 1 score: 67.9 bits; conditional E-value: 5e-23 CBM2.hmm 1 CtvtytvtssW.....ggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvt.fgfn 81 C+vty+ s+W gGf+ + ++n g+ +i+ Wtltftlp+gqt +Wna ++++ +++t+t + wngsi +ga++t +g++ XSC30624.1|CBM2|GH5_40 35 CSVTYQNLSTWqssptAGGFTTGLAIKNLGD-PISHWTLTFTLPAGQTRGGGWNAGFTGT-TAITATDVGWNGSIGTGATNTsVGLQ 119 9**********55555569************.**************************99.8*****************9877**** PP CBM2.hmm 82 gsgsgssaa....ptaftlngaac 101 gs++g++a+ pt+f+lng+ac XSC30624.1|CBM2|GH5_40 120 GSWTGAQATpfpqPTNFALNGVAC 143 ***975332122489******999 PP == domain 2 score: -2.3 bits; conditional E-value: 0.36 CBM2.hmm 50 atvsqsgntvtvtnaswngsiap 72 a++ + + + vt a w ++iap XSC30624.1|CBM2|GH5_40 413 ASWHTYNFNACVTAACWDSQIAP 435 45555555566677777777776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (514 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 42.20 // Query: XRV98469.1|CBM2|GH5_40 [L=499] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-35 107.6 12.6 5.2e-35 106.3 12.6 1.7 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 106.3 12.6 5.2e-35 5.2e-35 1 101 [] 21 120 .. 21 120 .. 0.99 Alignments for each domain: == domain 1 score: 106.3 bits; conditional E-value: 5.2e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+v +W gG+q+ vt+tn+++ a++gW+l f++p+gq ++++W +++sqsg+tvtv n++wng++ +g++v+ gf +s++g+ XRV98469.1|CBM2|GH5_40 21 CTVEYSVVGQWAGGYQGAVTITNNSA-ALSGWSLGFDFPAGQVVSQGWGGKWSQSGKTVTVVNENWNGALGTGGKVSGGFIASWTGA 106 9**********************998.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++aptaftlng++c XRV98469.1|CBM2|GH5_40 107 NTAPTAFTLNGTPC 120 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (499 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 115.27 // Query: WWQ67672.1|CBM2|GH5_40 [L=493] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-36 109.5 15.8 1.2e-35 108.4 15.8 1.7 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 108.4 15.8 1.2e-35 1.2e-35 1 101 [] 35 134 .. 35 134 .. 0.99 Alignments for each domain: == domain 1 score: 108.4 bits; conditional E-value: 1.2e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v+y+vt +W++Gfqa v+vtn+g+ a ++W+l+f++++gq++t++W+a++sqsg++vt+ n+swngs+a+gasv+ gf g++sg+ WWQ67672.1|CBM2|GH5_40 35 CSVEYSVTGQWDTGFQAAVKVTNNGA-ARDSWSLSFAFADGQKVTQGWSAKWSQSGTAVTAANESWNGSLATGASVSAGFIGTWSGA 120 9************************9.99********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 ++ ptaf+lng++c WWQ67672.1|CBM2|GH5_40 121 NTVPTAFKLNGTTC 134 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (493 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 116.24 // Query: XIF82547.1|CBM2|GH5_40 [L=483] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-34 104.0 9.6 7.5e-34 102.6 9.6 1.8 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 102.6 9.6 7.5e-34 7.5e-34 1 101 [] 38 137 .. 38 137 .. 0.99 Alignments for each domain: == domain 1 score: 102.6 bits; conditional E-value: 7.5e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v+y+ ++Wg+Gf+a+vt+ n g s+++gW+lt t++++qt++++Wn+t+sqsg vtv n swn++++p +svt g n s+sgs XIF82547.1|CBM2|GH5_40 38 CKVDYA-VNDWGSGFTASVTIGNLGGSPLSGWQLTYTYAGNQTLQQGWNGTWSQSGRMVTVANLSWNATVPPSGSVTAGANFSYSGS 123 99***9.7******************************************************************************* PP CBM2.hmm 88 saaptaftlngaac 101 +a+pt+f++ng++c XIF82547.1|CBM2|GH5_40 124 NAKPTDFAVNGSPC 137 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (483 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 115.61 // Query: XQH33901.1|CBM2|GH5_40 [L=493] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-38 115.8 15.4 6e-38 115.8 15.4 2.0 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 115.8 15.4 6e-38 6e-38 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -2.6 0.0 0.45 0.45 62 72 .. 407 417 .. 399 427 .. 0.64 Alignments for each domain: == domain 1 score: 115.8 bits; conditional E-value: 6e-38 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W++Gfq+ v++tn+ + ++++W+l+f++++gq++t++Wna++sqsg+tvt+tn+swng++ +gasv+ gf ++++gs XQH33901.1|CBM2|GH5_40 36 CTVEYSVTSQWDSGFQGAVQITNNRA-PVSSWSLSFDFAGGQKVTQGWNAKWSQSGTTVTATNESWNGALGTGASVSAGFLANWAGS 121 9**********************998.************************************************************ PP CBM2.hmm 88 saaptaftlngaac 101 +a ptaf+lng+ac XQH33901.1|CBM2|GH5_40 122 NAVPTAFKLNGTAC 135 ************99 PP == domain 2 score: -2.6 bits; conditional E-value: 0.45 CBM2.hmm 62 tnaswngsiap 72 t+ wn ++ap XQH33901.1|CBM2|GH5_40 407 TESCWNTTLAP 417 44556666555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (493 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 111.15 // Query: XSC38031.1|CBM2|GH5_40 [L=500] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-36 109.8 11.0 1.3e-35 108.2 11.0 2.0 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 108.2 11.0 1.3e-35 1.3e-35 1 101 [] 34 132 .. 34 132 .. 0.99 Alignments for each domain: == domain 1 score: 108.2 bits; conditional E-value: 1.3e-35 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+vtyt t++W+gGf+a +tv+n g+ a+++W+l f++++gq ++++W+at++qsg++vt+ ++s+ng++a+gas+++gfngs++gs XSC38031.1|CBM2|GH5_40 34 CQVTYT-TNDWPGGFTAAITVKNLGD-AVSSWNLGFAFTAGQHVDQGWSATFTQSGANVTAASMSYNGALATGASTSIGFNGSWTGS 118 9****9.9******************.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +++p+aftlng++c XSC38031.1|CBM2|GH5_40 119 NPKPAAFTLNGVTC 132 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (500 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 115.96 // Query: XAN36870.1|CBM2|GH5_40 [L=503] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-34 104.8 14.8 1.5e-34 104.8 14.8 1.9 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 104.8 14.8 1.5e-34 1.5e-34 1 101 [] 35 135 .. 35 135 .. 0.98 2 ? -3.2 0.1 0.7 0.7 54 70 .. 408 424 .. 384 431 .. 0.57 Alignments for each domain: == domain 1 score: 104.8 bits; conditional E-value: 1.5e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlp.sgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsg 86 C+vtytv+s+W gGf++nv +tn gs a+++W+ltf++p ++q++t++W+at+sqsg++v++ + swngs+ +g+s+t+gfngs+sg XAN36870.1|CBM2|GH5_40 35 CAVTYTVQSQWTGGFSGNVAITNLGS-ALTSWSLTFDFPnANQRVTQGWSATWSQSGARVSAASLSWNGSLGTGGSTTIGFNGSWSG 120 9************************9.9**********96789******************************************** PP CBM2.hmm 87 ssaaptaftlngaac 101 +++ pt+f+lng++c XAN36870.1|CBM2|GH5_40 121 ANPVPTSFALNGTTC 135 *************99 PP == domain 2 score: -3.2 bits; conditional E-value: 0.7 CBM2.hmm 54 qsgntvtvtnaswngsi 70 + + + vt+ w +i XAN36870.1|CBM2|GH5_40 408 SYNFNACVTETCWDTQI 424 22223334444444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (503 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.95 // Query: WUX80042.1|CBM2|GH5_40 [L=496] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-34 102.8 10.6 1.1e-33 102.0 10.6 1.4 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 102.0 10.6 1.1e-33 1.1e-33 1 101 [] 36 135 .. 36 135 .. 0.99 Alignments for each domain: == domain 1 score: 102.0 bits; conditional E-value: 1.1e-33 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C v+y+vt +W++Gfq+ vt+tn+g+ +++gWtltf++p+ q+++++Wna+++qs++t t+ n+ wng + +g+s+t+gf +s sg WUX80042.1|CBM2|GH5_40 36 CVVEYAVTHTWDQGFQGAVTLTNKGA-PLSGWTLTFDFPGTQKVSQGWNAQWTQSSHTATAVNETWNGGLGTGSSATLGFLASRSGG 121 99*********************999.************************************************************ PP CBM2.hmm 88 saaptaftlngaac 101 ++apt+f+lng++c WUX80042.1|CBM2|GH5_40 122 NPAPTTFALNGNTC 135 ************99 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (496 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 112.29 // Query: XTM50396.1|CBM2|GH5_40 [L=493] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-37 112.4 18.1 7.5e-37 112.2 16.4 2.0 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 112.2 16.4 7.5e-37 7.5e-37 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -2.9 0.0 0.55 0.55 61 72 .. 406 417 .. 397 428 .. 0.70 Alignments for each domain: == domain 1 score: 112.2 bits; conditional E-value: 7.5e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vts+W++Gfq+ v++tn+ + ++++W+l+f++++gq++t++Wna++sqsg+tvt+ n+swngs+ +gasv+ gf +++sgs XTM50396.1|CBM2|GH5_40 36 CTVAYSVTSQWDTGFQGAVQITNNMA-PVTSWSLSFDFAGGQKVTQGWNAKWSQSGTTVTAANESWNGSLGTGASVSAGFLANWSGS 121 9**********************998.************************************************************ PP CBM2.hmm 88 saaptaftlngaac 101 +a p+af+lng++c XTM50396.1|CBM2|GH5_40 122 NAVPSAFKLNGTTC 135 ************99 PP == domain 2 score: -2.9 bits; conditional E-value: 0.55 CBM2.hmm 61 vtnaswngsiap 72 +t+ wn+++ap XTM50396.1|CBM2|GH5_40 406 ATESCWNSQLAP 417 455567777766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (493 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 109.53 // Query: XQC84563.1|CBM2|GH5_40 [L=491] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-38 117.3 16.4 1.9e-38 117.3 16.4 2.0 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 117.3 16.4 1.9e-38 1.9e-38 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -3.1 0.1 0.66 0.66 64 72 .. 408 416 .. 394 422 .. 0.63 Alignments for each domain: == domain 1 score: 117.3 bits; conditional E-value: 1.9e-38 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+vt +W+gGfq+ vtvtn+ + +++gW+l f++++gq++t++Wna++sqsg+tvt+tn+swngs+a+gasv+ gf +s+sgs XQC84563.1|CBM2|GH5_40 36 CTVEYSVTGQWDGGFQGAVTVTNNAA-PVSGWSLGFDFAGGQKVTQGWNAKWSQSGTTVTATNESWNGSLATGASVSAGFIASWSGS 121 9**********************877.************************************************************ PP CBM2.hmm 88 saaptaftlngaac 101 +aaptaf+lng++c XQC84563.1|CBM2|GH5_40 122 NAAPTAFELNGTTC 135 ************99 PP == domain 2 score: -3.1 bits; conditional E-value: 0.66 CBM2.hmm 64 aswngsiap 72 wn+++ap XQC84563.1|CBM2|GH5_40 408 SCWNSTLAP 416 336666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (491 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 108.29 // Query: UKZ10269.1|CBM2|GH5_40 [L=504] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-32 96.2 11.0 7.3e-32 96.2 11.0 1.9 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.2 11.0 7.3e-32 7.3e-32 1 101 [] 44 143 .. 44 143 .. 0.99 2 ? -3.6 0.0 0.94 0.94 43 70 .. 419 428 .. 403 435 .. 0.56 Alignments for each domain: == domain 1 score: 96.2 bits; conditional E-value: 7.3e-32 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v+y+ ++Wg+Gf+an+t+t tg+ +ingWtl +++++qt++++Wn+t+sqsg++vtvtn+ ++ +i pga+ t n s++g+ UKZ10269.1|CBM2|GH5_40 44 CDVKYA-VNDWGSGFTANLTITDTGTLPINGWTLGYSYTGNQTLQNGWNGTWSQSGQAVTVTNPGYAPTIDPGATYTTSANFSYNGT 129 99***9.7******************************************************************************* PP CBM2.hmm 88 saaptaftlngaac 101 ++aptaftlng++c UKZ10269.1|CBM2|GH5_40 130 NTAPTAFTLNGTPC 143 ************99 PP == domain 2 score: -3.6 bits; conditional E-value: 0.94 CBM2.hmm 43 titssWnatvsqsgntvtvtnaswngsi 70 + ts w g+i UKZ10269.1|CBM2|GH5_40 419 STTSC------------------WDGQI 428 33334..................44444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (504 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 109.59 // Query: WBB81998.1|CBM2 [L=164] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-27 80.9 0.5 5.5e-27 80.6 0.5 1.1 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 80.6 0.5 5.5e-27 5.5e-27 5 95 .. 71 161 .. 67 164 .] 0.91 Alignments for each domain: == domain 1 score: 80.6 bits; conditional E-value: 5.5e-27 CBM2.hmm 5 ytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgssaaptaft 95 ++ W+gGfq++vtv+n g ++ +Wt+tftlp+g+++ ++W +++qsg+tvt+ n + ng++ g+++ fgf ++ +++ ++pt ++ WBB81998.1|CBM2 71 HQTVGRWPGGFQGRVTVRNVGLAPSRSWTVTFTLPDGHRVRHAWHTRLTQSGTTVTAANTDHNGALFHGEEAVFGFLATATSAPTEPTLTC 161 567789**************************************************************************96666687665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (164 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 53.34 // Query: XVL68317.1|CBM2|GH5_40 [L=504] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-34 103.5 10.5 8.4e-34 102.4 10.5 1.6 1 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 102.4 10.5 8.4e-34 8.4e-34 1 101 [] 38 137 .. 38 137 .. 0.98 Alignments for each domain: == domain 1 score: 102.4 bits; conditional E-value: 8.4e-34 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 Ctv+y+v sW gGfq++vtvtn g++a+ngW+l f++ +gq+i+++W a++sq+++ vt+ n+swn+s+ +gasvt gf +s+sgs XVL68317.1|CBM2|GH5_40 38 CTVQYSVVGSWAGGFQGSVTVTN-GAAALNGWSLGFAFLDGQRISQGWGAKWSQTDAGVTAANESWNASLGTGASVTAGFIASWSGS 123 **********************8.888***********************************************************9 PP CBM2.hmm 88 saaptaftlngaac 101 ap+aftlnga c XVL68317.1|CBM2|GH5_40 124 HRAPAAFTLNGAVC 137 999********999 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (504 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 113.11 // Query: WUT56743.1|CBM2|GH5_40 [L=490] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-37 113.6 14.5 2.8e-37 113.6 14.5 2.3 2 CBM2.hmm Domain annotation for each model (and alignments): >> CBM2.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 113.6 14.5 2.8e-37 2.8e-37 1 101 [] 36 135 .. 36 135 .. 0.99 2 ? -2.1 0.1 0.3 0.3 63 71 .. 405 413 .. 376 421 .. 0.52 Alignments for each domain: == domain 1 score: 113.6 bits; conditional E-value: 2.8e-37 CBM2.hmm 1 CtvtytvtssWggGfqanvtvtntgssaingWtltftlpsgqtitssWnatvsqsgntvtvtnaswngsiapgasvtfgfngsgsgs 87 C+v+y+vts+Wg+Gfq+ v++tn+++ a+++W+l f++++gq++t++Wnat+sqsg+tvt+ n+s+ngs+a+gasv+ gf +s+sgs WUT56743.1|CBM2|GH5_40 36 CSVEYSVTSQWGSGFQGAVKITNNTA-AMSSWSLAFDFAGGQKLTQGWNATWSQSGTTVTAANESYNGSLATGASVSAGFIASWSGS 121 9**********************988.9*********************************************************** PP CBM2.hmm 88 saaptaftlngaac 101 +a pt+f+lng++c WUT56743.1|CBM2|GH5_40 122 NAVPTSFRLNGTSC 135 ************99 PP == domain 2 score: -2.1 bits; conditional E-value: 0.3 CBM2.hmm 63 naswngsia 71 + wn+++a WUT56743.1|CBM2|GH5_40 405 ESCWNSTLA 413 222444443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (490 residues searched) Target model(s): 1 (101 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.19 // [ok]