# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM25/fasta_for_each_cluster/cluster_21.txt # target HMM database: merged_hmms/CBM25.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM25/CBM25_cluster_21.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: XHF18661.1|CBM20|CBM25|GH119 [L=1451] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-59 183.5 8.4 3.7e-31 93.9 0.3 4.0 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.9 0.2 6.3e-30 6.3e-30 2 77 .. 985 1058 .. 984 1059 .. 0.98 2 ! 93.9 0.3 3.7e-31 3.7e-31 1 77 [. 1170 1244 .. 1170 1245 .. 0.98 3 ? 2.4 0.2 0.014 0.014 3 65 .. 1357 1424 .. 1355 1435 .. 0.74 Alignments for each domain: == domain 1 score: 89.9 bits; conditional E-value: 6.3e-30 CBM25.hmm 2 evtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 ++tvyY kkg++++ylhy+++gg+Wt++pgv M +++ +g++k t++lg+ +ql+a+Fn+gsg+WDNnng nY f XHF18661.1|CBM20|CBM25|GH119 985 TTTVYY---KKGFATPYLHYRPAGGTWTTAPGVLMpDAEVTGYAKYTVNLGSVQQLEAVFNNGSGTWDNNNGVNYLF 1058 689***...******************************************************************98 PP == domain 2 score: 93.9 bits; conditional E-value: 3.7e-31 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++tvyY kkg++++y+hy+++gg+Wt++pgvaM +++ +g++k+t+dlg+a+ql+a+Fn+gsg+WDNn+g nY f XHF18661.1|CBM20|CBM25|GH119 1170 NTATVYY---KKGYATPYIHYRPAGGTWTTAPGVAMaTAEVSGYAKHTVDLGSATQLEAVFNNGSGTWDNNGGLNYFF 1244 689****...******************************************************************98 PP == domain 3 score: 2.4 bits; conditional E-value: 0.014 CBM25.hmm 3 vtvyYngl..kkgasevylhygvggg.sWtavpgvaMekacdgwvkktidlgeasqlnaaF..ndgsg 65 +tv++n + + ++vy+ +v+ sW ++ + +++a+ +++ + l ++ ++ F +d ++ XHF18661.1|CBM20|CBM25|GH119 1357 ATVTFNVTasTVMGQNVYVVGNVAALgSWAPANAILLSAANYPTWSAAVGLPGSTAIEYKFikKDAAN 1424 577777775455567888888877655**********9999999*******77777777664366665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1451 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.92 // Query: WNS43625.1|CBM20|CBM25|GH119 [L=1259] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-57 178.9 6.6 4.1e-30 90.6 0.1 4.0 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.6 0.1 4.1e-30 4.1e-30 1 77 [. 904 978 .. 904 979 .. 0.98 2 ! 84.1 1.8 4.2e-28 4.2e-28 1 77 [. 1062 1138 .. 1062 1139 .. 0.97 3 ! 4.0 0.0 0.0041 0.0041 18 57 .. 1177 1215 .. 1172 1225 .. 0.77 Alignments for each domain: == domain 1 score: 90.6 bits; conditional E-value: 4.1e-30 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n+vt+yY k+g++++y+hy+++gg Wta+pgvaM +++ +g+ k+ti++g+a ql+a+Fn+gsg+WD+n+g+nY f WNS43625.1|CBM20|CBM25|GH119 904 NNVTIYY---KQGYATPYIHYRPAGGVWTAAPGVAMpAAEVAGYNKITINIGAAAQLEACFNNGSGTWDSNGGRNYLF 978 68*****...******************************************************************98 PP == domain 2 score: 84.1 bits; conditional E-value: 4.2e-28 CBM25.hmm 1 nevtvyYnglkkgasevylhygvggg.sWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++t+yY +++ +s+ y+hy+++g sWt+vpgv+M ++a++g+ ++ti lg+a +l+aaFn+gsg+WDNn+g+nY+f WNS43625.1|CBM20|CBM25|GH119 1062 NTATIYY--KNSAYSSSYIHYKLDGAsSWTTVPGVQMgASAYSGYSSATIALGNAAGLTAAFNNGSGTWDNNGGSNYHF 1138 689****..999************999***************************************************9 PP == domain 3 score: 4.0 bits; conditional E-value: 0.0041 CBM25.hmm 18 ylhygvgggsWtavpgv.aMekacdgwvkktidlgeasqln 57 yl ++ +sW+a++++ +++k++dg +++t++l ++ ++ WNS43625.1|CBM20|CBM25|GH119 1177 YLTGSF--NSWNAADSAyQLTKESDGTYSVTLNLPAGAAVQ 1215 667777..89**99876167************996665554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1259 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 130.55 // Query: XMS22522.1|CBM25|GH119 [L=1418] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-23 67.1 3.0 8.4e-23 67.1 3.0 5.1 5 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.4 0.1 0.056 0.056 7 35 .. 632 660 .. 625 666 .. 0.81 2 ? -3.7 0.0 1 1 45 64 .. 839 858 .. 833 860 .. 0.79 3 ! 67.1 3.0 8.4e-23 8.4e-23 4 77 .. 878 951 .. 876 952 .. 0.96 4 ? 0.1 2.3 0.071 0.071 33 74 .. 1156 1196 .. 1134 1198 .. 0.75 5 ? 2.4 7.5 0.013 0.013 30 74 .. 1338 1381 .. 1321 1383 .. 0.85 Alignments for each domain: == domain 1 score: 0.4 bits; conditional E-value: 0.056 CBM25.hmm 7 Yngl.kkgasevylhygvgggsWtavpgva 35 Y g +g +++++ ++v++++W ++++ + XMS22522.1|CBM25|GH119 632 Y-GYdVNGIQDIKVKVRVHKDKWATATDKT 660 3.44488999***************99865 PP == domain 2 score: -3.7 bits; conditional E-value: 1 CBM25.hmm 45 kktidlgeasqlnaaFndgs 64 ++t++l+e++++ ++ +d+ XMS22522.1|CBM25|GH119 839 SITVTLNERTTVSVTVTDSV 858 68999999999999888875 PP == domain 3 score: 67.1 bits; conditional E-value: 8.4e-23 CBM25.hmm 4 tvyYnglkkgasevylhygvggg.sWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 tvyY + ++g+ +v lhy v+g +Wt +pg aM++ +w++ t+dl +++ql+++ n+ sg+WDNn+g+nY++ XMS22522.1|CBM25|GH119 878 TVYY-QDNSGWGQVCLHYTVDGAvTWTVAPGEAMQSVGGNWYSLTVDLVDGTQLEFVANNCSGTWDNNGGQNYKV 951 8999.88**************99**************************************************86 PP == domain 4 score: 0.1 bits; conditional E-value: 0.071 CBM25.hmm 33 gvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnngan 74 ++aM+ d+ ++ ++l + + ++ F d +g W n g n XMS22522.1|CBM25|GH119 1156 TTAMDLVADNTWQLVVELDGQADQRFKF-DVNGDWGQNYGDN 1196 46899999999******98888888888.5666898888776 PP == domain 5 score: 2.4 bits; conditional E-value: 0.013 CBM25.hmm 30 avpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnngan 74 + ++ aM+ ++ +++t++ +++ ++ F d sg W Nn g n XMS22522.1|CBM25|GH119 1338 NWQTGAMSLVANNTWQTTVSFDGQNEQRFKF-DVSGDWSNNYGDN 1381 44567899999999*******999*99***9.7888*****9988 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1418 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 141.00 // Query: 146327|Chyhya1_GeneCatalog_proteins_20180531.aa.fasta|CBM25|CBM25|GH71 [L=630] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-29 86.6 19.7 1.6e-16 47.0 3.4 2.8 2 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 44.6 8.5 9e-16 9e-16 2 76 .. 23 95 .. 22 97 .. 0.86 2 ! 47.0 3.4 1.6e-16 1.6e-16 3 77 .. 112 185 .. 110 186 .. 0.77 Alignments for each domain: == domain 1 score: 44.6 bits; conditional E-value: 9e-16 CBM25.hmm 2 evtvyYnglkkgasevylhygvgggsWtavpgvaM.eka.. 39 +v+vyY k++++++ +h+++++ +Wt++ a +++ 146327|Chyhya1_GeneCatalog_proteins_20180531.aa.fasta|CBM25|CBM25|GH71 23 SVSVYY---KTSWKTASIHHSANQAAWTTTAMEASaSSNyp 60 699***...*******************9877666333222 PP CBM25.hmm 40 .cdgwvkktidlgeasqlnaaFndgsgnWDNnnganYs 76 ++gw++ t d+ s+l+++F+d++gnWDNnn++n+ 146327|Chyhya1_GeneCatalog_proteins_20180531.aa.fasta|CBM25|CBM25|GH71 61 pSKGWFQYTTDV---STLQFVFTDNNGNWDNNNQQNFY 95 369********9...89*******************96 PP == domain 2 score: 47.0 bits; conditional E-value: 1.6e-16 CBM25.hmm 3 vtvyYnglkkgasevylhygvgggsWtavpgvaMek.... 38 +tvyY k + ++++hy++ g +Wt + v+M++ 146327|Chyhya1_GeneCatalog_proteins_20180531.aa.fasta|CBM25|CBM25|GH71 112 ITVYY----KTVWSPKIHYSASGAAWTVS-PVSMTAstts 146 89***....556679*******99**854.4666441111 PP CBM25.hmm 39 ...acdgwvkktidlgeasqlnaaFndgsgnWDNnnganY 75 a++gw+++ i+ as+ +++F+dg+gnWDNn+g+nY 146327|Chyhya1_GeneCatalog_proteins_20180531.aa.fasta|CBM25|CBM25|GH71 147 yypASAGWYQHVIQ---ASTAEFVFTDGNGNWDNNGGKNY 183 22256788888888...7999******************* PP CBM25.hmm 76 sf 77 + 146327|Chyhya1_GeneCatalog_proteins_20180531.aa.fasta|CBM25|CBM25|GH71 184 FI 185 76 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (630 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.70 // Query: XKO63975.1|CBM25|GH14 [L=557] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-32 96.3 1.9 1.7e-31 95.0 1.9 1.8 1 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 95.0 1.9 1.7e-31 1.7e-31 1 77 [. 459 533 .. 459 534 .. 0.98 Alignments for each domain: == domain 1 score: 95.0 bits; conditional E-value: 1.7e-31 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++tvyY kkg+s++y+hy+++gg+Wtavpgv+M +++++g++k+t+++g+a+ql+aaFndg++nWD+n+ +nY f XKO63975.1|CBM25|GH14 459 NTATVYY---KKGYSSPYIHYRPAGGTWTAVPGVKMaDSEISGYAKITVNIGAATQLEAAFNDGNNNWDSNSMNNYFF 533 689****...******************************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (557 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 116.24 // Query: UPW17767.1|CBM25|GH119 [L=1418] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-23 68.5 1.8 3e-23 68.5 1.8 4.9 4 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.0 0.1 0.074 0.074 7 35 .. 632 660 .. 625 666 .. 0.81 2 ! 68.5 1.8 3e-23 3e-23 3 77 .. 877 951 .. 875 952 .. 0.96 3 ? -2.0 2.7 0.31 0.31 27 71 .. 1153 1193 .. 1130 1197 .. 0.72 4 ? 1.5 6.1 0.024 0.024 22 74 .. 1333 1381 .. 1318 1385 .. 0.75 Alignments for each domain: == domain 1 score: 0.0 bits; conditional E-value: 0.074 CBM25.hmm 7 Yngl.kkgasevylhygvgggsWtavpgva 35 Y g ++ +++++ ++v++++W ++++ + UPW17767.1|CBM25|GH119 632 Y-GYdVSNIQDIQVKVRVHKDKWATATDKT 660 3.444889999*************999865 PP == domain 2 score: 68.5 bits; conditional E-value: 3e-23 CBM25.hmm 3 vtvyYnglkkgasevylhygvggg.sWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 +t+yY + ++g+ +v lhy ++g +Wt++pg +M++ d+w++ t+dl+++sql++a n+ +g WD+n+g+nY++ UPW17767.1|CBM25|GH119 877 TTLYY-QDNSGWGQVCLHYTIDGAiTWTTAPGDPMHSLADNWYSLTVDLEDGSQLEFAANNCNGVWDSNGGQNYQV 951 67888.88**************99**************************************************97 PP == domain 3 score: -2.0 bits; conditional E-value: 0.31 CBM25.hmm 27 sWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnn 71 +W a +aM+ d+ ++ ++ + + ++ F d s+ W n UPW17767.1|CBM25|GH119 1153 GWAA---AAMNLVADNTWQLVVEFDGQANQRFKF-DVSNDWSQNY 1193 4443...578888899999999997777777887.6666887775 PP == domain 4 score: 1.5 bits; conditional E-value: 0.024 CBM25.hmm 22 gvgggsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnngan 74 + + ++W +++aM+ d+ +++t++ +++ ++ F d +g W n g n UPW17767.1|CBM25|GH119 1333 RGTANNW---QTTAMTLVADNTWRTTVSFDGQNDQRFKF-DVNGDWSTNFGDN 1381 4334555...5689*99************9999999999.5666897776665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1418 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 137.40 // Query: XRS37193.1|CBM20|CBM25|GH119 [L=1288] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-30 90.6 0.6 1.9e-29 88.4 0.6 2.3 1 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.4 0.6 1.9e-29 1.9e-29 3 77 .. 993 1066 .. 991 1067 .. 0.97 Alignments for each domain: == domain 1 score: 88.4 bits; conditional E-value: 1.9e-29 CBM25.hmm 3 vtvyYnglkkgasevylhygvgggsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 +tvyY l +g++++++hy+++gg+Wtavpgv+M++ac+gw++ t +lg+as+ +a+Fn+gsg+WDNn+g+nY++ XRS37193.1|CBM20|CBM25|GH119 993 ATVYY-RLPSGWNSANIHYSPTGGAWTAVPGVPMAAACSGWLSYTASLGSASSWQAVFNNGSGSWDNNGGKNYAL 1066 799**.99*****************************************************************87 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1288 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 172.13 // Query: UQZ32184.1|CBM20|CBM25|GH13 [L=992] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-57 178.1 17.7 9.1e-31 92.6 0.1 4.4 4 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.7 0.4 1 1 60 77 .. 193 209 .. 189 210 .. 0.75 2 ! 92.6 0.1 9.1e-31 9.1e-31 1 77 [. 648 722 .. 648 723 .. 0.98 3 ! 80.2 5.6 6.8e-27 6.8e-27 2 78 .] 796 872 .. 795 872 .. 0.97 4 ! 11.7 0.0 1.7e-05 1.7e-05 17 70 .. 909 959 .. 900 964 .. 0.86 Alignments for each domain: == domain 1 score: -3.7 bits; conditional E-value: 1 CBM25.hmm 60 FndgsgnWDNnnga.nYsf 77 Fn+ + W ng n+s+ UQZ32184.1|CBM20|CBM25|GH13 193 FNNPA--WYHHNGDiNWSL 209 88877..988887779986 PP == domain 2 score: 92.6 bits; conditional E-value: 9.1e-31 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n+vt+yY k+g+s++y+hy+++gg+Wt++pg+aM +++ +g+ k+tid+g+asql+aaFn+gsg+WD+n+g+nY f UQZ32184.1|CBM20|CBM25|GH13 648 NSVTIYY---KQGYSTPYIHYRPAGGAWTTAPGTAMpAAEFSGYNKITIDIGAASQLEAAFNNGSGTWDSNGGSNYLF 722 68*****...******************************************************************98 PP == domain 3 score: 80.2 bits; conditional E-value: 6.8e-27 CBM25.hmm 2 evtvyYnglkkgasevylhygvggg.sWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsfs 78 +vt+yY +++++s+ y+hy+++++ +Wt+vpgv+M + ++g+ +t++lg+a +l+aaFn+g+++WDNn+g+nY+fs UQZ32184.1|CBM20|CBM25|GH13 796 SVTIYY--KNTNFSNSYIHYKLDNStTWTTVPGVQMqGSSYSGYKTITVPLGSAAGLTAAFNNGNNTWDNNGGNNYHFS 872 79****..99************9999**********99***************************************95 PP == domain 4 score: 11.7 bits; conditional E-value: 1.7e-05 CBM25.hmm 17 vylhygvgggsWtav.pgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNn 70 vy+ ++ ++W+a+ p ++++k +dg++++t++l +++ ++ F+ g+ W N UQZ32184.1|CBM20|CBM25|GH13 909 VYISGSF--NNWNAAdPAYKLTKGSDGVYSITLNLPAGTAVTYKFTRGA--WTNV 959 7788888..89*998467889************************9998..9885 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (992 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 125.79 // Query: XUY91242.1|CBM25|GH119 [L=1418] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-23 68.8 1.0 2.6e-23 68.8 1.0 5.1 4 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.1 0.12 0.12 10 35 .. 634 660 .. 626 665 .. 0.80 2 ! 68.8 1.0 2.6e-23 2.6e-23 4 76 .. 878 950 .. 875 952 .. 0.96 3 ? -0.0 2.2 0.074 0.074 28 74 .. 1154 1196 .. 1135 1198 .. 0.77 4 ! 3.3 1.7 0.0067 0.0067 26 73 .. 1337 1380 .. 1320 1381 .. 0.77 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.12 CBM25.hmm 10 l.kkgasevylhygvgggsWtavpgva 35 ++ +++++ ++v++++W ++++ + XUY91242.1|CBM25|GH119 634 YdVSDIQDIKVKVRVHKDKWATATDKT 660 3478899999***********999865 PP == domain 2 score: 68.8 bits; conditional E-value: 2.6e-23 CBM25.hmm 4 tvyYnglkkgasevylhygvggg.sWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYs 76 +vyY + ++g+ +v lhy+++gg +Wt++pgvaM++ d+w++ +idl +a+ql+++ n sg WDNn+ganYs XUY91242.1|CBM25|GH119 878 SVYY-QDSNGWGQVCLHYSIDGGlTWTTAPGVAMQSLADNWYRLSIDLDNADQLEFVANSCSGAWDNNGGANYS 950 6999.779*****************************************************************8 PP == domain 3 score: -0.0 bits; conditional E-value: 0.074 CBM25.hmm 28 WtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnngan 74 W ++ aM+ d+ +++ +d +++ ++ F d +g W n g n XUY91242.1|CBM25|GH119 1154 W---QSSAMSLIADHTWQVLVDFDGQTEQRFKF-DVNGDWSQNYGDN 1196 4...4567888899999999**99999999999.5666999988877 PP == domain 4 score: 3.3 bits; conditional E-value: 0.0067 CBM25.hmm 26 gsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnga 73 ++W +++aM+ d+++++ti+ +s+ ++ F d g W n g XUY91242.1|CBM25|GH119 1337 NAW---QNTAMSLVRDNIWQVTISFDGQSGQRFKF-DTVGDWSYNLGD 1380 444...6689***************9999999999.566688777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1418 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 147.87 // Query: UPK43066.1|CBM25|GH119 [L=1300] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-57 177.3 0.6 3.7e-29 87.5 0.1 3.0 2 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.5 0.1 3.7e-29 3.7e-29 2 77 .. 988 1061 .. 987 1062 .. 0.98 2 ! 87.1 0.0 4.9e-29 4.9e-29 1 77 [. 1176 1250 .. 1176 1251 .. 0.98 Alignments for each domain: == domain 1 score: 87.5 bits; conditional E-value: 3.7e-29 CBM25.hmm 2 evtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 vt+yY k+g++++ +hy+++gg+Wt+ pgv M ++++ g+ k tid+g+a++l+a+Fn+gsg+WDNn+g+nY+f UPK43066.1|CBM25|GH119 988 VVTIYY---KQGYTNPSIHYRPTGGTWTTPPGVVMpAAEMPGYNKMTIDVGAATGLEAVFNNGSGTWDNNGGKNYQF 1061 59****...******************************************************************99 PP == domain 2 score: 87.1 bits; conditional E-value: 4.9e-29 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n+vt+yY k+g++++++hy+++gg+Wt+ pgv M ++++ g+ k+tid+g a +l+a+Fn+gsg+WDNn+g+nY f UPK43066.1|CBM25|GH119 1176 NSVTIYY---KQGYTSPNIHYRPTGGTWTTPPGVVMpAAEMPGYNKITIDVGMAAGLEAVFNNGSGTWDNNGGKNYLF 1250 68*****...******************************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1300 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 162.90 // Query: WEF31149.1|CBM20|CBM25|GH119 [L=1294] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-30 90.5 0.8 4.2e-30 90.5 0.8 2.5 2 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.5 0.8 4.2e-30 4.2e-30 3 77 .. 997 1070 .. 995 1071 .. 0.97 2 ? -2.1 0.1 0.32 0.32 17 60 .. 1153 1192 .. 1145 1198 .. 0.59 Alignments for each domain: == domain 1 score: 90.5 bits; conditional E-value: 4.2e-30 CBM25.hmm 3 vtvyYnglkkgasevylhygvgggsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 +tvyY +l +++s ++lhy + gg+Wtavpg++M++ac+gw+ t++lg+a++l+aaFn+gsgnWDNn+g+nY++ WEF31149.1|CBM20|CBM25|GH119 997 ATVYY-KLGTNWSIANLHYAPVGGTWTAVPGAPMATACSGWAMLTVNLGSATGLTAAFNNGSGNWDNNGGKNYAL 1070 69999.88*****************************************************************86 PP == domain 2 score: -2.1 bits; conditional E-value: 0.32 CBM25.hmm 17 vylhygvgggsWtavpgvaMekacdgwvkktidl.geasqlnaaF 60 + y+++ ++++avp+v+ +++ +t+++ ++s++++ F WEF31149.1|CBM20|CBM25|GH119 1153 AATTYSYTVKAFDAVPNVSAASTA-----ATVTTpASGSTCQVKF 1192 455677777888888887654443.....3444444555555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1294 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 160.96 // Query: UJF34425.1|CBM20|CBM25|GH13 [L=1034] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-61 188.7 15.4 1.6e-30 91.9 0.3 4.2 4 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.6 0.0 0.99 0.99 20 41 .. 454 475 .. 444 478 .. 0.72 2 ! 91.9 0.3 1.6e-30 1.6e-30 1 77 [. 648 722 .. 648 723 .. 0.98 3 ! 90.2 3.5 5.1e-30 5.1e-30 1 78 [] 838 914 .. 838 914 .. 0.97 4 ! 12.9 0.1 7.1e-06 7.1e-06 15 67 .. 949 998 .. 934 1006 .. 0.79 Alignments for each domain: == domain 1 score: -3.6 bits; conditional E-value: 0.99 CBM25.hmm 20 hygvgggsWtavpgvaMekacd 41 g + + W +++ +aM++ +d UJF34425.1|CBM20|CBM25|GH13 454 RTGKQREMWASANLYAMSRRID 475 4555567899999999977655 PP == domain 2 score: 91.9 bits; conditional E-value: 1.6e-30 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++t+yY k+g++++y+hy++ gg+Wt++pgv M +++++g+ k+ti+lg+a+ql+a+Fn+gsg+WDNnn++nY f UJF34425.1|CBM20|CBM25|GH13 648 NSATIYY---KQGFTTPYIHYRPVGGTWTTAPGVLMpAAEISGYNKITISLGAATQLEAVFNNGSGTWDNNNSNNYMF 722 689****...******************************************************************98 PP == domain 3 score: 90.2 bits; conditional E-value: 5.1e-30 CBM25.hmm 1 nevtvyYnglkkgasevylhygvggg.sWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsfs 78 ++vtvyY k+g++++y+hy+++g +Wt++pgvaM ++++ g+ k tid+g+a +l+aaFn+gs++WDNnng+nY+f+ UJF34425.1|CBM20|CBM25|GH13 838 QTVTVYY---KTGFTTPYMHYKIDGAsTWTTSPGVAMqSSEYPGYSKLTIDVGTAAGLTAAFNNGSNTWDNNNGQNYHFN 914 58*****...**************999**********99***************************************95 PP == domain 4 score: 12.9 bits; conditional E-value: 7.1e-06 CBM25.hmm 15 sevylhygvgggsWtav.pgvaMekacdgwvkktidlgeasqlnaaFndgsgnW 67 +++yl ++ +sW+a+ p+++++k+ dg +++t+++++++ ++ F+ g+ W UJF34425.1|CBM20|CBM25|GH13 949 ASIYLAGSL--NSWNAAdPSYKLTKNTDGTFSITLPISAGTAMQYKFTKGA--W 998 445555555..9**988478999*************************998..6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1034 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 132.07 // Query: WEM97108.1|CBM20|CBM25|GH119 [L=1291] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-29 86.9 1.5 5.5e-29 86.9 1.5 2.5 2 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 86.9 1.5 5.5e-29 5.5e-29 3 77 .. 995 1068 .. 993 1069 .. 0.96 2 ? -1.4 0.2 0.21 0.21 26 71 .. 1212 1263 .. 1207 1266 .. 0.65 Alignments for each domain: == domain 1 score: 86.9 bits; conditional E-value: 5.5e-29 CBM25.hmm 3 vtvyYnglkkgasevylhygvgggsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 ++vyY +l +g+s++++hy ++gg+Wt++pgvaM++ac+gw++ ++lg+a++l+a+Fn+++g+WDN +ganY++ WEM97108.1|CBM20|CBM25|GH119 995 ANVYY-KLPSGWSTANIHYAPNGGTWTTAPGVAMQAACSGWMSSVLNLGSATGLQAVFNNNAGTWDNHGGANYAL 1068 68999.88*****************************************************************87 PP == domain 2 score: -1.4 bits; conditional E-value: 0.21 CBM25.hmm 26 gsWtavpgvaMekacdgw...vkktidl..geasqlnaaFndg.sgnWDNnn 71 gsW ++g a++ + +g + t++l ++a q + + +g + +W +n+ WEM97108.1|CBM20|CBM25|GH119 1212 GSWAPASGFALTIQGSGAnvpWTGTVSLppNTAVQYKYVKWNGsTATWESNQ 1263 6788888888866555533337788888666666666665555156899987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1291 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 161.63 // Query: XRW40864.1|CBM20|CBM25|GH119 [L=1288] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-30 90.6 0.6 1.9e-29 88.4 0.6 2.3 1 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.4 0.6 1.9e-29 1.9e-29 3 77 .. 993 1066 .. 991 1067 .. 0.97 Alignments for each domain: == domain 1 score: 88.4 bits; conditional E-value: 1.9e-29 CBM25.hmm 3 vtvyYnglkkgasevylhygvgggsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 +tvyY l +g++++++hy+++gg+Wtavpgv+M++ac+gw++ t +lg+as+ +a+Fn+gsg+WDNn+g+nY++ XRW40864.1|CBM20|CBM25|GH119 993 ATVYY-RLPSGWNSANIHYSPTGGAWTAVPGVPMAAACSGWLSYTASLGSASSWQAVFNNGSGSWDNNGGKNYAL 1066 799**.99*****************************************************************87 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1288 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 174.72 // Query: XLW41720.1|CBM25|GH119 [L=1461] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-24 72.2 3.1 2.2e-24 72.2 3.1 3.8 4 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 72.2 3.1 2.2e-24 2.2e-24 3 77 .. 916 988 .. 914 989 .. 0.97 2 ? -3.1 0.1 0.68 0.68 42 64 .. 1055 1076 .. 1050 1078 .. 0.77 3 ? -3.4 0.2 0.88 0.88 35 51 .. 1194 1212 .. 1188 1234 .. 0.58 4 ? 0.9 0.2 0.038 0.038 20 51 .. 1372 1399 .. 1353 1422 .. 0.68 Alignments for each domain: == domain 1 score: 72.2 bits; conditional E-value: 2.2e-24 CBM25.hmm 3 vtvyYnglkkgasevylhygvgggsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 +t+yY ++++s+v lhy+v++g+Wt++pgv+M+ ++w++ t+d+g++s++++ nd s++WDNn+g+nY++ XLW41720.1|CBM25|GH119 916 ATIYY--YTTSWSSVCLHYRVDSGTWTTAPGVTMTDVGSDWFAYTVDMGSGSTVEFDTNDCSSTWDNNGGSNYEV 988 79**9..789***************************************************************97 PP == domain 2 score: -3.1 bits; conditional E-value: 0.68 CBM25.hmm 42 gwvkktidlgeasqlnaaFndgs 64 g + t++++++++++ + +d++ XLW41720.1|CBM25|GH119 1055 G-SSLTVTVNATQTITLTVTDNE 1076 4.678999999999999888876 PP == domain 3 score: -3.4 bits; conditional E-value: 0.88 CBM25.hmm 35 aMekacdgwvkktidl..g 51 aMe d+ +++t+ + XLW41720.1|CBM25|GH119 1194 AMELVADNTWQVTLAFsgT 1212 5666677777777766421 PP == domain 4 score: 0.9 bits; conditional E-value: 0.038 CBM25.hmm 20 hygvgggsWtavpgvaMekacdgwvkktidl.g 51 + +sW ++aMe d+ +++ti+ g XLW41720.1|CBM25|GH119 1372 RGTP--NSWG---TTAMELVADHTWQATITFtG 1399 4444..5554...46888888999999998742 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1461 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 151.03 // Query: WNG48981.1|CBM20|CBM25|GH119 [L=1265] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-29 89.3 4.9 6.2e-29 86.8 0.3 3.1 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.8 0.1 1 1 26 50 .. 103 128 .. 92 137 .. 0.58 2 ! 86.8 0.3 6.2e-29 6.2e-29 1 77 [. 984 1058 .. 984 1059 .. 0.98 3 ! 3.6 0.0 0.0057 0.0057 3 76 .. 1171 1251 .. 1169 1253 .. 0.75 Alignments for each domain: == domain 1 score: -3.8 bits; conditional E-value: 1 CBM25.hmm 26 g..sWtavpgvaM.ekacdgwvkktidl 50 sW + M ++a +g ++ +++ WNG48981.1|CBM20|CBM25|GH119 103 AymSWPGNVAADMnTNAPTG--QIHVTM 128 23577777777787777777..444443 PP == domain 2 score: 86.8 bits; conditional E-value: 6.2e-29 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++tvyY kkg++++y+h++++gg+Wt +pg++M +++ +g++k t++lg+a+ql+ +Fn+gsg+WDNnng+nY f WNG48981.1|CBM20|CBM25|GH119 984 NTTTVYY---KKGFATPYIHFRPAGGTWTVSPGYPMpDSEVSGYAKYTVNLGAATQLESVFNNGSGTWDNNNGSNYFF 1058 689****...******************************************************************98 PP == domain 3 score: 3.6 bits; conditional E-value: 0.0057 CBM25.hmm 3 vtvyYngl..kkgasevylhygvggg.sWtavpgvaMekacdgwvkktidl..geasqlnaaFndgsgn..WDNnngan 74 +tv++n++ ++ +++++ +++ sW ++++ a+ +++t++l ++a q + +dgsgn W + ++ WNG48981.1|CBM20|CBM25|GH119 1171 ATVTFNETasTAVGQNIFIVGSITALgSWAPGAAIPLSPANYPTWSVTLSLpgSTAIQYKYIKKDGSGNvtWESGTNRT 1249 688888885444456666666765545***************9********6666666777779998854488888877 PP CBM25.hmm 75 Ys 76 Y+ WNG48981.1|CBM20|CBM25|GH119 1250 YT 1251 76 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1265 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 151.91 // Query: XWU95330.1|CBM20|CBM25|GH119 [L=1451] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-58 180.4 8.4 1.1e-30 92.3 0.2 3.8 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.2 0.2 5.2e-30 5.2e-30 2 77 .. 985 1058 .. 984 1059 .. 0.98 2 ! 92.3 0.2 1.1e-30 1.1e-30 1 77 [. 1170 1244 .. 1170 1245 .. 0.98 3 ? 0.7 0.2 0.045 0.045 3 65 .. 1357 1424 .. 1355 1435 .. 0.75 Alignments for each domain: == domain 1 score: 90.2 bits; conditional E-value: 5.2e-30 CBM25.hmm 2 evtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 ++tvyY kkg++++y+hy+++gg+Wt++pgv M +++ +g++k t++lg+ +ql+a+Fn+gsg+WDNnng nY f XWU95330.1|CBM20|CBM25|GH119 985 TTTVYY---KKGFATPYIHYRPAGGTWTTAPGVLMpDAEVTGYAKYTVNLGSVQQLEAVFNNGSGTWDNNNGGNYLF 1058 689***...******************************************************************98 PP == domain 2 score: 92.3 bits; conditional E-value: 1.1e-30 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++tvyY kkg++++ylhy+++gg+Wt++pgvaM +++ +g++k t+dlg+a+ql+a+Fn+gsg+WDNn+g nY f XWU95330.1|CBM20|CBM25|GH119 1170 NTATVYY---KKGYATPYLHYRPAGGTWTTSPGVAMaTAEVSGYAKYTVDLGSATQLEAVFNNGSGTWDNNGGLNYFF 1244 689****...******************************************************************98 PP == domain 3 score: 0.7 bits; conditional E-value: 0.045 CBM25.hmm 3 vtvyYngl..kkgasevylhygvggg.sWtavpgvaMekacdgwvkktidlgeasqlnaaF..ndgsg 65 +tv++n + + ++vy+ +v++ sW+ ++ + +++++ + + + l ++ ++ F +d ++ XWU95330.1|CBM20|CBM25|GH119 1357 ATVTFNVTasTVMGQNVYVVGNVATLgSWSPANAILLSADNYPTWGAAVGLPGSTAIEYKFikKDAAN 1424 578887775455567888888887756**********9999999*****9977777776663356655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1451 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.68 // Query: BDU51305.1|CBM25|GH119 [L=1358] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-13 36.8 0.9 2.5e-13 36.8 0.9 6.2 7 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.1 0.1 0.077 0.077 7 33 .. 644 670 .. 637 675 .. 0.82 2 ? 1.8 0.1 0.02 0.02 13 65 .. 815 868 .. 808 874 .. 0.72 3 ! 36.8 0.9 2.5e-13 2.5e-13 2 71 .. 904 977 .. 903 986 .. 0.85 4 ? -1.6 0.1 0.23 0.23 21 47 .. 1023 1047 .. 1012 1082 .. 0.65 5 ? -0.8 0.1 0.13 0.13 17 47 .. 1109 1139 .. 1103 1174 .. 0.70 6 ? -0.3 0.3 0.091 0.091 33 54 .. 1200 1222 .. 1180 1248 .. 0.67 7 ? -1.1 0.1 0.16 0.16 36 53 .. 1291 1309 .. 1274 1335 .. 0.71 Alignments for each domain: == domain 1 score: -0.1 bits; conditional E-value: 0.077 CBM25.hmm 7 YnglkkgasevylhygvgggsWtavpg 33 Y ++g +++++ +++++++W + ++ BDU51305.1|CBM25|GH119 644 YAFDASGIQNIKVKIRTHSEKWADPKD 670 544599****************99877 PP == domain 2 score: 1.8 bits; conditional E-value: 0.02 CBM25.hmm 13 gasevylhygvgggsWtavpgvaMekacdgwvkktidl.geasqlnaaFndgsg 65 ++++v++ y ++gsW++++ + +a ++ ++ i+ +e+s+ ++ ++d++g BDU51305.1|CBM25|GH119 815 ESNSVNVEYVKEDGSWSSMKLMDSVSADPKYKHTVITFrSENSSTKIRYTDNNG 868 56789999999999***9998887777777666667778666666666666554 PP == domain 3 score: 36.8 bits; conditional E-value: 2.5e-13 CBM25.hmm 2 evtvyYnglkkgasevylhygvgg.......gsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnn 71 ++t+yY kga ++h+ +++ ++Wt +pg +M ++++ g+v+kt++lg +++ ++Fn + +nWD++ BDU51305.1|CBM25|GH119 904 TTTIYY----KGALGTNIHWAPTDeagtpieSEWTIAPGDPMeTSDIYGYVSKTLNLGMHNKAMVCFNQSGSNWDSDH 977 5799**....88889999998875222333257*********99*******************************975 PP == domain 4 score: -1.6 bits; conditional E-value: 0.23 CBM25.hmm 21 ygvgggsWtavpgvaMekacdgwvkkt 47 + ++ ++ ++ + M++ +g+++ BDU51305.1|CBM25|GH119 1023 W--DSAQYATSYKLYMSSSTNGVFNEI 1047 3..336777777788877777765543 PP == domain 5 score: -0.8 bits; conditional E-value: 0.13 CBM25.hmm 17 vylhygvgggsWtavpgvaMekacdgwvkkt 47 l ++ ++ ++ ++ + M++ +g+++ BDU51305.1|CBM25|GH119 1109 SELKISWDNAQYATSYKLYMSSSTNGVFNEI 1139 4556666667888888888888888866543 PP == domain 6 score: -0.3 bits; conditional E-value: 0.091 CBM25.hmm 33 gvaM.ekacdgwvkktidlgeas 54 + a+ + ++g +++ti++g+++ BDU51305.1|CBM25|GH119 1200 TDALtFNSSNGKWEITITTGNGD 1222 55554567889999999995543 PP == domain 7 score: -1.1 bits; conditional E-value: 0.16 CBM25.hmm 36 M.ekacdgwvkktidlgea 53 + + ++g +++t+++g++ BDU51305.1|CBM25|GH119 1291 LsFNSSTGKWEITVTTGNG 1309 5456778999999999654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1358 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 132.08 // Query: UQN42000.1|CBM25|GH119|3.2.1.1 [L=1418] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-23 69.8 3.1 1.2e-23 69.8 3.1 5.4 6 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.7 0.1 0.043 0.043 7 35 .. 632 660 .. 625 666 .. 0.81 2 ? -1.8 0.0 0.26 0.26 44 69 .. 838 863 .. 830 867 .. 0.81 3 ! 69.8 3.1 1.2e-23 1.2e-23 4 77 .. 878 951 .. 876 952 .. 0.96 4 ? -1.1 0.2 0.16 0.16 6 49 .. 1146 1172 .. 1136 1194 .. 0.58 5 ? -3.5 0.0 0.9 0.9 2 16 .. 1283 1295 .. 1282 1305 .. 0.66 6 ! 3.0 8.5 0.0087 0.0087 26 74 .. 1337 1381 .. 1320 1383 .. 0.81 Alignments for each domain: == domain 1 score: 0.7 bits; conditional E-value: 0.043 CBM25.hmm 7 Yngl.kkgasevylhygvgggsWtavpgva 35 Y g +g +++++ ++v++++W ++++ + UQN42000.1|CBM25|GH119|3.2.1.1 632 Y-GYdVSGIQDIKVKVRVHKDKWATATDKT 660 3.4458999****************99865 PP == domain 2 score: -1.8 bits; conditional E-value: 0.26 CBM25.hmm 44 vkktidlgeasqlnaaFndgsgnWDN 69 ++t++l+e++++ ++ +d+ g+ D+ UQN42000.1|CBM25|GH119|3.2.1.1 838 PSITVTLNERTTISVTVTDSVGQKDS 863 5789999********99999887665 PP == domain 3 score: 69.8 bits; conditional E-value: 1.2e-23 CBM25.hmm 4 tvyYnglkkgasevylhygvggg.sWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 t+yY + ++g+ +v lhy v+g +Wt++pg +M++ d+w++ t+dl++++ql+++ n+ sg WDNn+g+nY++ UQN42000.1|CBM25|GH119|3.2.1.1 878 TLYY-QDNNGWGKVCLHYTVDGAvTWTTAPGEEMQSLGDNWYSLTVDLEDGNQLEFVTNNCSGAWDNNGGQNYQI 951 6677.88**************99**************************************************97 PP == domain 4 score: -1.1 bits; conditional E-value: 0.16 CBM25.hmm 6 yYnglkkgasevylhygvgggsWtavpgvaMekacdgwvkktid 49 y+ g+++g+++ + + +++W+ + ++ UQN42000.1|CBM25|GH119|3.2.1.1 1146 YFRGTANGWATTAMDLVA-DHTWQ----------------VVVE 1172 555555555555555544.34554................4444 PP == domain 5 score: -3.5 bits; conditional E-value: 0.9 CBM25.hmm 2 evtvyYnglkkgase 16 ++tv+Yn++ g+++ UQN42000.1|CBM25|GH119|3.2.1.1 1283 TTTVTYNTA--GSHS 1295 7899**654..4443 PP == domain 6 score: 3.0 bits; conditional E-value: 0.0087 CBM25.hmm 26 gsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnngan 74 ++W +++aM+ ++++++++d +++ ++ F d +g W Nn g n UQN42000.1|CBM25|GH119|3.2.1.1 1337 NGW---QTTAMTLVANNVWQVSVDFDGQNNQRFKF-DVNGDWSNNYGDN 1381 445...5689*99************999*99***9.67779****9988 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1418 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 143.35 // Query: XKF24180.1|CBM20|CBM25|GH119 [L=1451] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-59 183.5 8.4 3.7e-31 93.9 0.3 4.0 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.9 0.2 6.3e-30 6.3e-30 2 77 .. 985 1058 .. 984 1059 .. 0.98 2 ! 93.9 0.3 3.7e-31 3.7e-31 1 77 [. 1170 1244 .. 1170 1245 .. 0.98 3 ? 2.4 0.2 0.014 0.014 3 65 .. 1357 1424 .. 1355 1435 .. 0.74 Alignments for each domain: == domain 1 score: 89.9 bits; conditional E-value: 6.3e-30 CBM25.hmm 2 evtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 ++tvyY kkg++++ylhy+++gg+Wt++pgv M +++ +g++k t++lg+ +ql+a+Fn+gsg+WDNnng nY f XKF24180.1|CBM20|CBM25|GH119 985 TTTVYY---KKGFATPYLHYRPAGGTWTTAPGVLMpDAEVTGYAKYTVNLGSVQQLEAVFNNGSGTWDNNNGVNYLF 1058 689***...******************************************************************98 PP == domain 2 score: 93.9 bits; conditional E-value: 3.7e-31 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++tvyY kkg++++y+hy+++gg+Wt++pgvaM +++ +g++k+t+dlg+a+ql+a+Fn+gsg+WDNn+g nY f XKF24180.1|CBM20|CBM25|GH119 1170 NTATVYY---KKGYATPYIHYRPAGGTWTTAPGVAMaTAEVSGYAKHTVDLGSATQLEAVFNNGSGTWDNNGGLNYFF 1244 689****...******************************************************************98 PP == domain 3 score: 2.4 bits; conditional E-value: 0.014 CBM25.hmm 3 vtvyYngl..kkgasevylhygvggg.sWtavpgvaMekacdgwvkktidlgeasqlnaaF..ndgsg 65 +tv++n + + ++vy+ +v+ sW ++ + +++a+ +++ + l ++ ++ F +d ++ XKF24180.1|CBM20|CBM25|GH119 1357 ATVTFNVTasTVMGQNVYVVGNVAALgSWAPANAILLSAANYPTWSAAVGLPGSTAIEYKFikKDAAN 1424 577777775455567888888877655**********9999999*******77777777664366665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1451 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 148.40 // Query: WAS88675.1|CBM20|CBM25|GH119 [L=1451] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-58 179.7 7.5 6.3e-30 89.9 0.2 3.9 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.9 0.2 6.3e-30 6.3e-30 2 77 .. 985 1058 .. 984 1059 .. 0.98 2 ! 89.7 0.1 7.6e-30 7.6e-30 1 77 [. 1170 1244 .. 1170 1245 .. 0.98 3 ? 2.2 0.2 0.016 0.016 4 66 .. 1358 1425 .. 1355 1435 .. 0.73 Alignments for each domain: == domain 1 score: 89.9 bits; conditional E-value: 6.3e-30 CBM25.hmm 2 evtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 ++tvyY kkg++++ylhy+++gg+Wt++pgv M +++ +g++k t++lg+ +ql+a+Fn+gsg+WDNnng nY f WAS88675.1|CBM20|CBM25|GH119 985 TTTVYY---KKGFATPYLHYRPAGGTWTTAPGVLMpDAEVTGYAKYTVNLGSVQQLEAVFNNGSGTWDNNNGVNYLF 1058 689***...******************************************************************98 PP == domain 2 score: 89.7 bits; conditional E-value: 7.6e-30 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++tvyY kkg++++y+h +++gg+Wt++pgvaM +++ +g++k+t+dlg+a+ql+a+Fn+gsg+WDNn+g nY f WAS88675.1|CBM20|CBM25|GH119 1170 NTATVYY---KKGYATPYIHSRPAGGTWTTAPGVAMaAAEVSGYAKHTVDLGSATQLEAVFNNGSGTWDNNGGLNYFF 1244 689****...**************************99**************************************98 PP == domain 3 score: 2.2 bits; conditional E-value: 0.016 CBM25.hmm 4 tvyYngl..kkgasevylhygvggg.sWtavpgvaMekacdgwvkktidlgeasqlnaaF..ndgsgn 66 tv++n + + ++vy+ +v+ sW ++ + +++a+ +++ + l ++ ++ F +d ++n WAS88675.1|CBM20|CBM25|GH119 1358 TVTFNVTasTVVGQNVYVVGNVAALgSWAPANAILLSAANYPTWSAAVGLPGSTAIEYKFikKDTANN 1425 77777764444457788887776645**********9999999*******777777776644666654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1451 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 160.19 // Query: WDD97629.1|CBM25|GH119 [L=1278] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-17 49.7 2.6 2.3e-17 49.7 2.6 4.8 4 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.1 0.1 0.071 0.071 38 65 .. 848 875 .. 844 876 .. 0.86 2 ! 49.7 2.6 2.3e-17 2.3e-17 3 77 .. 893 975 .. 891 976 .. 0.86 3 ? 2.2 0.1 0.015 0.015 17 72 .. 1086 1137 .. 1071 1141 .. 0.71 4 ? 0.4 0.4 0.056 0.056 11 55 .. 1183 1222 .. 1177 1242 .. 0.66 Alignments for each domain: == domain 1 score: 0.1 bits; conditional E-value: 0.071 CBM25.hmm 38 kacdgwvkktidlgeasqlnaaFndgsg 65 ++ ++ ++++i+++++++l ++ +d++g WDD97629.1|CBM25|GH119 848 STGENTAEINITVNTRTTLSVTVTDDKG 875 567888999************9999876 PP == domain 2 score: 49.7 bits; conditional E-value: 2.3e-17 CBM25.hmm 3 vtvyYnglkkgasevylhygvggg.sWtavpgvaMekacdgwvkktidl........geasqlnaaFndgsgnWDNnnganYsf 77 +++yY + +++ +v lhy++++g +Wt++pgvaM+ ++w++ t+ l +++ql ++ nd +++WDNn+g nY + WDD97629.1|CBM25|GH119 893 TSLYY-QDVSNWGQVCLHYSLDNGaTWTQAPGVAMTMLTNNWFEYTLVLnnsstdglPDEEQLIFVTNDCNNSWDNNGGLNYRL 975 45677.789*************999**********************9965433333346789999****************86 PP == domain 3 score: 2.2 bits; conditional E-value: 0.015 CBM25.hmm 17 vylhygvgggsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnng 72 + l+y+ ++++W++ aMe +d++++ i+ ++q ++ d +g W n g WDD97629.1|CBM25|GH119 1086 PRLYYRGTSNAWDT---SAMELVSDHLWQLDINFDGQDQQRFKL-DIHGDWSVNYG 1137 56788888888876...589999*********996666655442.55556655555 PP == domain 4 score: 0.4 bits; conditional E-value: 0.056 CBM25.hmm 11 kkgasevylhygvgggsWtavpgvaMekacdgwvkktidlgeasq 55 k+++++vy+ + +sW++ aMe +d+ ++ ++ ++q WDD97629.1|CBM25|GH119 1183 KANFNQVYFRGTA--NSWQT---SAMELVSDHSWQLMVNFDGREQ 1222 6667777766666..67765...5788888888888888744444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1278 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 145.92 // Query: XRW52666.1|CBM20|CBM25|GH119 [L=1288] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-29 86.8 0.8 2.4e-28 84.9 0.2 2.5 2 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 84.9 0.2 2.4e-28 2.4e-28 3 77 .. 993 1066 .. 991 1067 .. 0.97 2 ? -3.3 0.0 0.79 0.79 26 42 .. 1209 1225 .. 1204 1251 .. 0.70 Alignments for each domain: == domain 1 score: 84.9 bits; conditional E-value: 2.4e-28 CBM25.hmm 3 vtvyYnglkkgasevylhygvgggsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 +tvyY l +g++++++hy+++gg+Wt+vpgv+M+ ac+gw++ t +lg+a++ +a+Fn gsg+WDNn+g+nY++ XRW52666.1|CBM20|CBM25|GH119 993 ATVYY-RLPSGWNSANIHYSPTGGAWTTVPGVPMAPACSGWLSYTASLGAATGWQAVFNSGSGSWDNNGGKNYAL 1066 799**.99*****************************************************************87 PP == domain 2 score: -3.3 bits; conditional E-value: 0.79 CBM25.hmm 26 gsWtavpgvaMekacdg 42 gsWt ++g a++ + +g XRW52666.1|CBM20|CBM25|GH119 1209 GSWTPANGFALAIQGSG 1225 79999999998766655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1288 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 154.81 // Query: ULO08367.1|CBM20|CBM25|GH13 [L=981] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-51 158.0 13.4 2e-29 88.4 0.2 4.4 4 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.3 0.8 1 1 60 77 .. 193 209 .. 191 210 .. 0.74 2 ! 88.4 0.2 2e-29 2e-29 1 77 [. 648 722 .. 648 723 .. 0.98 3 ! 73.6 1.0 7.7e-25 7.7e-25 1 77 [. 784 860 .. 784 861 .. 0.97 4 ? 2.7 0.0 0.011 0.011 16 57 .. 897 937 .. 883 948 .. 0.79 Alignments for each domain: == domain 1 score: -4.3 bits; conditional E-value: 1 CBM25.hmm 60 FndgsgnWDNnnga.nYsf 77 Fn+ + W ng n+s+ ULO08367.1|CBM20|CBM25|GH13 193 FNNPA--WYHHNGDiNWSL 209 77777..988887779986 PP == domain 2 score: 88.4 bits; conditional E-value: 2e-29 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n+vt+yY k+g++++y+hy++ gg+Wt++pgva+ +++ +g+ k+ti++g+a ql+a+Fn+gsg+WD+n+g+nY f ULO08367.1|CBM20|CBM25|GH13 648 NNVTIYY---KQGYTTPYIHYRPVGGTWTTSPGVAIpASEVSGYNKITINIGSAAQLEACFNNGSGTWDSNGGSNYLF 722 68*****...******************************************************************98 PP == domain 3 score: 73.6 bits; conditional E-value: 7.7e-25 CBM25.hmm 1 nevtvyYnglkkgasevylhygvggg.sWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n+v+vyY ++ +s+ y+hy+++g+ Wt++pgv+M ++ +g++ + i+lg++ +l+aaFn+gsg+WD+n+g+nY+f ULO08367.1|CBM20|CBM25|GH13 784 NTVKVYY--KNVAFSNSYIHYKLDGStVWTTAPGVQMtTSGFAGYATADIPLGTSVGLTAAFNNGSGTWDSNGGSNYHF 860 689****..8999**********99989*********99**************************************99 PP == domain 4 score: 2.7 bits; conditional E-value: 0.011 CBM25.hmm 16 evylhygvgggsWtavpgv.aMekacdgwvkktidlgeasqln 57 +yl ++ +sW+a++ + +++k +dg+++++++l +++ ++ ULO08367.1|CBM20|CBM25|GH13 897 PIYLTGSF--NSWNAADAAyQLTKGSDGVYSIKLSLPAGTAVQ 937 57888889..8***99875167******999999997776665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (981 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 133.40 // Query: UJF33920.1|CBM25|GH14 [L=952] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-89 280.6 13.8 2.2e-32 97.8 0.4 4.0 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.7 1.7 8.9e-31 8.9e-31 1 77 [. 458 532 .. 458 533 .. 0.98 2 ! 96.8 0.4 4.5e-32 4.5e-32 1 77 [. 655 729 .. 655 730 .. 0.98 3 ! 97.8 0.4 2.2e-32 2.2e-32 1 77 [. 852 926 .. 852 927 .. 0.98 Alignments for each domain: == domain 1 score: 92.7 bits; conditional E-value: 8.9e-31 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n+vtvyY kkg++++y+hy+++gg+Wt++pg++M +++++g+ k+tid+g+a+ql+aaFndg+gnWD+n ++nY f UJF33920.1|CBM25|GH14 458 NKVTVYY---KKGYTTPYIHYRPAGGTWTTAPGAKMtDSEISGYTKTTIDIGTATQLEAAFNDGNGNWDSNATKNYFF 532 68*****...******************************************************************98 PP == domain 2 score: 96.8 bits; conditional E-value: 4.5e-32 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n+vtvyY kkg++++y+hy+++gg+Wt++pgv+M +++ +g++k+tid+g+a+ql+a+Fn+gsg+WDNn+++nY f UJF33920.1|CBM25|GH14 655 NSVTVYY---KKGYTTPYIHYRPAGGTWTTAPGVSMpAAEVSGYAKITIDIGSATQLEAVFNNGSGTWDNNSSENYLF 729 68*****...******************************************************************98 PP == domain 3 score: 97.8 bits; conditional E-value: 2.2e-32 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++t+yY kkg++++y+hy+++gg+Wtavpgv+M +++++g++k+ti+lg+a+ql+a+Fn+gsg+WDNn+g+nY f UJF33920.1|CBM25|GH14 852 NSITIYY---KKGYTTPYIHYRPAGGTWTAVPGVSMpAAEISGYAKITINLGSATQLEAVFNNGSGTWDNNGGQNYMF 926 689****...******************************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (952 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 133.25 // Query: CAJ1314893.1|CBM25|GH13 [L=607] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-30 91.4 6.0 7.7e-30 89.7 6.0 2.0 1 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.7 6.0 7.7e-30 7.7e-30 1 77 [. 38 112 .. 38 113 .. 0.98 Alignments for each domain: == domain 1 score: 89.7 bits; conditional E-value: 7.7e-30 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n+vtvyY kkg++++y+hy+ ++g+Wt++pg++M +++ +g+ k+t+++g++ ql+a+Fn+g+g+WDNnn++nY f CAJ1314893.1|CBM25|GH13 38 NSVTVYY---KKGFTTPYIHYRQADGNWTTAPGTKMaDSEVNGYTKITVNIGSTAQLEAVFNNGNGTWDNNNSKNYLF 112 68*****...******************************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (607 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 119.43 // Query: XCP95546.1|CBM25|GH119 [L=1299] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-55 171.9 0.1 6.2e-31 93.2 0.6 3.0 2 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.2 0.6 6.2e-31 6.2e-31 2 77 .. 988 1061 .. 987 1062 .. 0.98 2 ! 75.0 0.0 2.9e-25 2.9e-25 2 77 .. 1177 1250 .. 1176 1251 .. 0.98 Alignments for each domain: == domain 1 score: 93.2 bits; conditional E-value: 6.2e-31 CBM25.hmm 2 evtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 vt+yY k+g++++y+hy+++gg+Wt++pgv+M +++ +g+ k t+++g+a +l+a+Fn+gsg+WDNn+g+nY+f XCP95546.1|CBM25|GH119 988 VVTIYY---KQGYTNPYIHYRPTGGTWTTAPGVKMpAAEVAGYTKMTVNVGTAAGLEAVFNNGSGTWDNNGGKNYQF 1061 59****...******************************************************************99 PP == domain 2 score: 75.0 bits; conditional E-value: 2.9e-25 CBM25.hmm 2 evtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 +vtvyY k+g++++++hy++ gg Wt pgv++ ++ g+ k+t+d+g+a +l+a+Fn+gsg WDNn+g+nY f XCP95546.1|CBM25|GH119 1177 SVTVYY---KQGYTQPNIHYRPVGGIWTIPPGVPIpPSELPGYHKITVDVGTAAGLEAVFNNGSGIWDNNGGRNYIF 1250 79****...******************************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1299 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.98 // Query: XRX62282.1|CBM20|CBM25|GH119 [L=1192] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-31 94.0 0.2 2.6e-29 88.0 0.1 2.8 2 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.0 0.1 2.6e-29 2.6e-29 2 77 .. 903 976 .. 902 977 .. 0.97 2 ! 3.0 0.0 0.0084 0.0084 16 59 .. 1108 1150 .. 1094 1160 .. 0.75 Alignments for each domain: == domain 1 score: 88.0 bits; conditional E-value: 2.6e-29 CBM25.hmm 2 evtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 +tvyY k g++++y+hy+++gg+Wt++pg+aM +++++g+ k t+dlg+a++l+a+Fn+gsg+WDNn+g+nY f XRX62282.1|CBM20|CBM25|GH119 903 AATVYY---KPGYTTPYMHYRPAGGTWTTSPGTAMpASEIAGYHKLTVDLGAATSLEAVFNNGSGTWDNNGGKNYIF 976 68****...******************************************************************98 PP == domain 2 score: 3.0 bits; conditional E-value: 0.0084 CBM25.hmm 16 evylhygvgggsWtav.pgvaMekacdgwvkktidlgeasqlnaa 59 + y+ ++ +sW+ + p ++ k++dg + +t+++ e++ ++ XRX62282.1|CBM20|CBM25|GH119 1108 SLYVAGSF--NSWNPAdPASKLVKQSDGTYTVTLPIAEGTAVQYK 1150 55666666..899977356788***********999888887754 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1192 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 154.28 // Query: BEU02130.1|CBM25|GH119 [L=1418] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-23 69.8 3.1 1.2e-23 69.8 3.1 5.7 7 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.7 0.1 0.043 0.043 7 35 .. 632 660 .. 625 666 .. 0.81 2 ? -1.8 0.0 0.26 0.26 44 69 .. 838 863 .. 830 867 .. 0.81 3 ! 69.8 3.1 1.2e-23 1.2e-23 4 77 .. 878 951 .. 876 952 .. 0.96 4 ? -2.5 0.1 0.44 0.44 45 65 .. 1021 1041 .. 1014 1042 .. 0.80 5 ? -0.7 0.2 0.12 0.12 6 50 .. 1146 1173 .. 1136 1195 .. 0.56 6 ? -3.5 0.0 0.9 0.9 2 16 .. 1283 1295 .. 1282 1305 .. 0.66 7 ! 3.0 8.5 0.0087 0.0087 26 74 .. 1337 1381 .. 1320 1383 .. 0.81 Alignments for each domain: == domain 1 score: 0.7 bits; conditional E-value: 0.043 CBM25.hmm 7 Yngl.kkgasevylhygvgggsWtavpgva 35 Y g +g +++++ ++v++++W ++++ + BEU02130.1|CBM25|GH119 632 Y-GYdVSGIQDIKVKVRVHKDKWATATDKT 660 3.4458999****************99865 PP == domain 2 score: -1.8 bits; conditional E-value: 0.26 CBM25.hmm 44 vkktidlgeasqlnaaFndgsgnWDN 69 ++t++l+e++++ ++ +d+ g+ D+ BEU02130.1|CBM25|GH119 838 PSITVTLNERTTISVTVTDSVGQKDS 863 5789999********99999887665 PP == domain 3 score: 69.8 bits; conditional E-value: 1.2e-23 CBM25.hmm 4 tvyYnglkkgasevylhygvggg.sWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 t+yY + ++g+ +v lhy v+g +Wt++pg +M++ d+w++ t+dl++++ql+++ n+ sg WDNn+g+nY++ BEU02130.1|CBM25|GH119 878 TLYY-QDNNGWGKVCLHYTVDGAvTWTTAPGEEMQSLGDNWYSLTVDLEDGNQLEFVTNNCSGAWDNNGGQNYQI 951 6677.88**************99**************************************************97 PP == domain 4 score: -2.5 bits; conditional E-value: 0.44 CBM25.hmm 45 kktidlgeasqlnaaFndgsg 65 ++t++++e++++ + +d++g BEU02130.1|CBM25|GH119 1021 SITVTVNETQTISLTVTDNQG 1041 689999999999999999886 PP == domain 5 score: -0.7 bits; conditional E-value: 0.12 CBM25.hmm 6 yYnglkkgasevylhygvgggsWtavpgvaMekacdgwvkktidl 50 y+ g+++g+++ aM+ d+ +++ +d BEU02130.1|CBM25|GH119 1146 YFRGTANGWATT-----------------AMDLVADHTWQVVVDF 1173 444444444444.................4555555555555554 PP == domain 6 score: -3.5 bits; conditional E-value: 0.9 CBM25.hmm 2 evtvyYnglkkgase 16 ++tv+Yn++ g+++ BEU02130.1|CBM25|GH119 1283 TTTVTYNTA--GSHS 1295 7899**654..4443 PP == domain 7 score: 3.0 bits; conditional E-value: 0.0087 CBM25.hmm 26 gsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnngan 74 ++W +++aM+ ++++++++d +++ ++ F d +g W Nn g n BEU02130.1|CBM25|GH119 1337 NGW---QTTAMTLVANNVWQVSVDFDGQNNQRFKF-DVNGDWSNNYGDN 1381 445...5689*99************999*99***9.67779****9988 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1418 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 125.96 // Query: XUZ05984.1|CBM25|GH119 [L=1418] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-23 68.8 1.0 2.6e-23 68.8 1.0 5.1 4 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.1 0.12 0.12 10 35 .. 634 660 .. 626 665 .. 0.80 2 ! 68.8 1.0 2.6e-23 2.6e-23 4 76 .. 878 950 .. 875 952 .. 0.96 3 ? -0.0 2.2 0.074 0.074 28 74 .. 1154 1196 .. 1135 1198 .. 0.77 4 ! 3.6 1.4 0.0054 0.0054 26 73 .. 1337 1380 .. 1322 1381 .. 0.77 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.12 CBM25.hmm 10 l.kkgasevylhygvgggsWtavpgva 35 ++ +++++ ++v++++W ++++ + XUZ05984.1|CBM25|GH119 634 YdVSDIQDIKVKVRVHKDKWATATDKT 660 3478899999***********999865 PP == domain 2 score: 68.8 bits; conditional E-value: 2.6e-23 CBM25.hmm 4 tvyYnglkkgasevylhygvggg.sWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYs 76 +vyY + ++g+ +v lhy+++gg +Wt++pgvaM++ d+w++ +idl +a+ql+++ n sg WDNn+ganYs XUZ05984.1|CBM25|GH119 878 SVYY-QDSNGWGQVCLHYSIDGGlTWTTAPGVAMQSLADNWYRLSIDLDNADQLEFVANSCSGAWDNNGGANYS 950 6999.779*****************************************************************8 PP == domain 3 score: -0.0 bits; conditional E-value: 0.074 CBM25.hmm 28 WtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnngan 74 W ++ aM+ d+ +++ +d +++ ++ F d +g W n g n XUZ05984.1|CBM25|GH119 1154 W---QSSAMSLIADHTWQVLVDFDGQTEQRFKF-DVNGDWSQNYGDN 1196 4...4567888899999999**99999999999.5666999988877 PP == domain 4 score: 3.6 bits; conditional E-value: 0.0054 CBM25.hmm 26 gsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnga 73 ++ +++aM+ d+++++ti+ +s+ ++ F d g W n g XUZ05984.1|CBM25|GH119 1337 NA---WQNTAMSLVRDNIWQVTISFDGQSGQRFKF-DTVGDWSYNLGD 1380 44...46789***************9999999999.566688777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1418 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 152.61 // Query: XQA22021.1|CBM20|CBM25|GH13 [L=1001] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-55 171.0 7.8 3.2e-29 87.7 0.1 4.6 4 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.0 0.44 0.44 35 65 .. 460 493 .. 450 508 .. 0.64 2 ! 87.7 0.1 3.2e-29 3.2e-29 1 77 [. 648 722 .. 648 723 .. 0.98 3 ! 72.4 1.3 1.9e-24 1.9e-24 1 77 [. 804 880 .. 804 881 .. 0.96 4 ! 11.3 0.0 2.1e-05 2.1e-05 16 69 .. 917 967 .. 902 973 .. 0.85 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.44 CBM25.hmm 35 aM.ekacdgwvkktidl..geasqlnaaFndgsg 65 +M ++++ +++ id+ +++++ +F ++s+ XQA22021.1|CBM20|CBM25|GH13 460 EMwAAQNLYAFSRRIDTgtNQGQEAISVFSNQSN 493 5544444455677777733344444456777664 PP == domain 2 score: 87.7 bits; conditional E-value: 3.2e-29 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n+vt+yY k+g++++y+hy++ gg+Wt++pgva+ ++ +g+ k+ti++g+asql+a+Fn+gsg+WD+n+g+nY f XQA22021.1|CBM20|CBM25|GH13 648 NSVTIYY---KQGYTSPYIHYRPVGGTWTTSPGVAIpVSDVAGYNKITINIGSASQLEACFNNGSGTWDSNGGSNYLF 722 68*****...******************************************************************98 PP == domain 3 score: 72.4 bits; conditional E-value: 1.9e-24 CBM25.hmm 1 nevtvyYnglkkgasevylhygvggg.sWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++t+yY +++ +s+ y+hy+++g Wt++pg ++ ++ g+ ++ti+lg+a +l+aaFn+gsg+WDNn+++nY+f XQA22021.1|CBM20|CBM25|GH13 804 NTATIYY--KNTAYSSSYIHYKLDGAtVWTTAPGEQLqASSFPGYKSITIQLGTAAGLTAAFNNGSGTWDNNGSSNYHF 880 689****..9999**********99989*********99999***********************************98 PP == domain 4 score: 11.3 bits; conditional E-value: 2.1e-05 CBM25.hmm 16 evylhygvgggsWtav.pgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDN 69 vyl + +sW+a+ p ++++k +dg++++t++l +++ ++ F+ g+ W N XQA22021.1|CBM20|CBM25|GH13 917 PVYLTGTF--NSWNAAdPAYQLTKGSDGVYSITLSLPAGTAVQYKFTRGA--WTN 967 68888888..8**998356788*************************998..887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1001 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 126.14 // Query: WPB80766.1|CBM20|CBM25|GH119 [L=1450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-59 183.8 5.3 8.6e-30 89.5 0.0 3.9 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.4 0.5 2e-29 2e-29 1 77 [. 983 1057 .. 983 1058 .. 0.98 2 ! 89.5 0.0 8.6e-30 8.6e-30 1 77 [. 1169 1243 .. 1169 1244 .. 0.97 3 ! 6.0 0.1 0.00099 0.00099 3 66 .. 1356 1424 .. 1354 1433 .. 0.70 Alignments for each domain: == domain 1 score: 88.4 bits; conditional E-value: 2e-29 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++tvyY kkg++++y+h++++gg+Wt +pg+aM +++ +g++k t++lg+a+ql+a+Fn+g g+WDNnng+nY f WPB80766.1|CBM20|CBM25|GH119 983 NTTTVYY---KKGFAAPYIHFRPTGGTWTVAPGYAMpDSEVSGYAKYTVNLGSATQLEAVFNNGGGTWDNNNGSNYFF 1057 689****...******************************************************************98 PP == domain 2 score: 89.5 bits; conditional E-value: 8.6e-30 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n vtvyY kkg++++y+hy+++gg+Wt++pgv+M +++ +g++k ti lg+a+ql+a+Fn+gsg+WDNn+g nY + WPB80766.1|CBM20|CBM25|GH119 1169 NAVTVYY---KKGFTAPYIHYRPAGGTWTSSPGVPMpDAEVAGYAKSTIYLGSATQLEAVFNNGSGTWDNNGGLNYFI 1243 579****...******************************************************************76 PP == domain 3 score: 6.0 bits; conditional E-value: 0.00099 CBM25.hmm 3 vtvyYngl..kkgasevylhygvggg.sWtavpgvaMekacdgwvkktidl..geasqlnaaFndgsgn 66 +tv++n++ + +++y+ +++ sW++++ ++++ a+ +++t++l ++a + + +dgsgn WPB80766.1|CBM20|CBM25|GH119 1356 ATVTFNETasTVVGQNIYVVGSIAALgSWNTANAIQLSPANYPTWSVTLSLpgSTAFEYKYIKKDGSGN 1424 578888874333446666666665544************************444444444444666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1450 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 159.07 // Query: WNG18264.1|CBM20|CBM25|GH119 [L=1267] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-27 80.3 4.7 5.1e-26 77.4 1.2 3.0 2 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 77.4 1.2 5.1e-26 5.1e-26 1 77 [. 984 1059 .. 984 1060 .. 0.97 2 ! 3.1 0.1 0.0081 0.0081 20 66 .. 1195 1241 .. 1163 1250 .. 0.71 Alignments for each domain: == domain 1 score: 77.4 bits; conditional E-value: 5.1e-26 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++tvyY ++++++ y+h+++g+g+Wt+vpg M +++ g++k t++lg+a+ql+++Fndg+g+WDNn+g nY + WNG18264.1|CBM20|CBM25|GH119 984 NSATVYY--SNNNFTLKYIHFRIGSGAWTTVPGNVMaNSEVPGYAKYTVNLGAATQLECVFNDGKGTWDNNKGTNYLL 1059 689****..99*****************************************************************86 PP == domain 2 score: 3.1 bits; conditional E-value: 0.0081 CBM25.hmm 20 hygvgggsWtavpgvaMekacdgwvkktidlgeasqlnaaF..ndgsgn 66 h + g+W++ + +++a+ +++t++l ++ l+ + +dgsgn WNG18264.1|CBM20|CBM25|GH119 1195 HAAI--GNWNTGAAILLSSASYPKWSVTLSLPGSTALEYKYikKDGSGN 1241 5566..7**********9999999*******555555544322777664 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1267 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 161.19 // Query: XHF07464.1|CBM20|CBM25|GH119 [L=1450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-58 181.9 7.1 2.8e-30 91.1 0.1 4.0 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.0 0.5 5.3e-29 5.3e-29 1 77 [. 983 1057 .. 983 1058 .. 0.97 2 ! 91.1 0.1 2.8e-30 2.8e-30 2 77 .. 1170 1243 .. 1169 1244 .. 0.98 3 ! 5.5 0.2 0.0014 0.0014 3 64 .. 1356 1422 .. 1354 1433 .. 0.70 Alignments for each domain: == domain 1 score: 87.0 bits; conditional E-value: 5.3e-29 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n+ tvyY kkg++++y+h++++gg+Wt +pg+aM +++ +g++k t++lg+a+ql+a+Fn+gsg+WDNnng nY f XHF07464.1|CBM20|CBM25|GH119 983 NTSTVYY---KKGFATPYIHFRPAGGTWTVSPGYAMpDSEVSGYAKYTVNLGSATQLEAVFNNGSGSWDNNNGTNYFF 1057 5789***...******************************************************************98 PP == domain 2 score: 91.1 bits; conditional E-value: 2.8e-30 CBM25.hmm 2 evtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 +vtvyY kkg++++y+hy+++gg+Wt++pgvaM +++ +g++k t++lg+a+ql+++Fn+gsg+WDNn+g nY + XHF07464.1|CBM20|CBM25|GH119 1170 SVTVYY---KKGFTTPYIHYRPAGGTWTTSPGVAMpDSEVAGYAKYTVNLGSATQLECVFNNGSGTWDNNGGLNYFI 1243 79****...******************************************************************76 PP == domain 3 score: 5.5 bits; conditional E-value: 0.0014 CBM25.hmm 3 vtvyYngl..kkgasevylhygvggg.sWtavpgvaMekacdgwvkktidlgeasqlnaaF..ndgs 64 +tv++n++ + +++y+ +++ sW++++ ++++ a+ +++t++l +++++ + +dg+ XHF07464.1|CBM20|CBM25|GH119 1356 ATVTFNETasTVVGQNIYVVGSIAALgSWSTASAIQLSPANYPTWSVTLSLPGSTSFEYKYikKDGN 1422 578888874333446666666665544************************6666666544225544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1450 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 152.90 // Query: XMN13954.1|CBM25|GH119 [L=1299] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-57 176.1 7.5 6e-30 90.0 0.3 3.3 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.7 0.6 1 1 6 49 .. 97 140 .. 94 157 .. 0.67 2 ! 90.0 0.3 6e-30 6e-30 1 77 [. 987 1061 .. 987 1062 .. 0.98 3 ! 89.6 0.0 8e-30 8e-30 1 77 [. 1176 1250 .. 1176 1251 .. 0.98 Alignments for each domain: == domain 1 score: -3.7 bits; conditional E-value: 1 CBM25.hmm 6 yYnglkkgasevylhygvgggsWtavpgvaMekacdgwvkktid 49 yY+ +k + + ++v+g+ ++ p + M+ +++g v +++ XMN13954.1|CBM25|GH119 97 YYSHHAKTGAYLNWPWQVAGDLRNNHPAAGMQVTMSGSVLNNVN 140 55444666666666777777777788888888888887776666 PP == domain 2 score: 90.0 bits; conditional E-value: 6e-30 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n vt+yY k g+ ++y+hy+++gg+Wt++pgv+M ++++ g+ k t+++g+a++l+a+Fn+gsg+WDNn+g+nY+f XMN13954.1|CBM25|GH119 987 NAVTIYY---KLGYPNPYIHYRPTGGTWTTAPGVKMmAAEMPGYTKMTVNVGTATGLEAVFNNGSGTWDNNGGKNYQF 1061 579****...**************************9***************************************99 PP == domain 3 score: 89.6 bits; conditional E-value: 8e-30 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n+vt+yY k+g++++++hy+++gg+Wt+ pgva+ +++ +g+ k+tid+g+a++l+a+Fn+gsg+WDNn g+nY f XMN13954.1|CBM25|GH119 1176 NSVTIYY---KQGFAQPNIHYRPAGGNWTTPPGVAIpASELTGYNKITIDVGTATGLEAVFNNGSGTWDNNAGRNYLF 1250 68*****...******************************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1299 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.30 // Query: XPC80190.1|CBM20|CBM25|GH119 [L=1477] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-55 172.5 18.1 1.2e-30 92.3 1.9 3.6 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.3 1.9 1.2e-30 1.2e-30 3 77 .. 995 1068 .. 993 1069 .. 0.96 2 ! 88.6 3.2 1.7e-29 1.7e-29 1 77 [. 1182 1256 .. 1182 1257 .. 0.97 3 ? -1.0 0.3 0.15 0.15 23 63 .. 1396 1441 .. 1372 1452 .. 0.64 Alignments for each domain: == domain 1 score: 92.3 bits; conditional E-value: 1.2e-30 CBM25.hmm 3 vtvyYnglkkgasevylhygvgggsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 +tv+Y + + +s+vylhy ++gg+Wt+vpgvaM++ac+gw + t++lg+a++l aaFn+gsg+WDNn+++nYs+ XPC80190.1|CBM20|CBM25|GH119 995 ATVFY-KVPTTWSSVYLHYAPTGGTWTTVPGVAMSSACSGWNSYTVNLGSATGLAAAFNNGSGTWDNNSSKNYSL 1068 79***.7799***************************************************************97 PP == domain 2 score: 88.6 bits; conditional E-value: 1.7e-29 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++tvyY + ++++s+v++hyg+ +gsWt++pg aM+ ac+gw++kti lg+ + l a+Fn+gsg+WDNn+++nYs+ XPC80190.1|CBM20|CBM25|GH119 1182 NSATVYY-KPASSWSSVNIHYGI-NGSWTTSPGEAMTLACTGWYAKTIALGSYTALAATFNNGSGTWDNNSSKNYSL 1256 689****.88*************.69*************************************************97 PP == domain 3 score: -1.0 bits; conditional E-value: 0.15 CBM25.hmm 23 vgggsWtavpgvaMekacdgw...vkktidl..geasqlnaaFndg 63 ++ g+Wt ++g a++ + +g + t++l g+a q + + +g XPC80190.1|CBM20|CBM25|GH119 1396 TALGNWTPASGFALTIQGSGAnvpWTGTVSLplGTAVQYKYVKWNG 1441 55689*****999987776642236666666546665555554444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1477 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.75 // Query: WAG56757.1|CBM25|CBM26|GH31_10 [L=1346] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 95.7 21.2 9.5e-28 83.0 2.6 5.2 5 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 7.1 0.2 0.00043 0.00043 3 63 .. 814 873 .. 812 876 .. 0.76 2 ? -2.1 0.1 0.35 0.35 47 69 .. 913 935 .. 904 937 .. 0.75 3 ! 83.0 2.6 9.5e-28 9.5e-28 2 77 .. 1006 1079 .. 1005 1080 .. 0.97 4 ? -1.6 0.0 0.23 0.23 15 44 .. 1100 1129 .. 1092 1167 .. 0.61 5 ! 16.2 0.7 6.5e-07 6.5e-07 3 65 .. 1185 1246 .. 1183 1252 .. 0.87 Alignments for each domain: == domain 1 score: 7.1 bits; conditional E-value: 0.00043 CBM25.hmm 3 vtvyYnglkkgasevylhygvggg.sWtavpgvaM.ekacdgwvkktidl..geasqlnaaFndg 63 +tvy k++as+++l y++++g +W++ ++aM +++ g++++ ++ +++ +++ + dg WAG56757.1|CBM25|CBM26|GH31_10 814 TTVYV---KDSASSANLQYSLDNGnTWSS--SQAMtKSDKIGYFQTDLNYtlTSSYPVKVRYSDG 873 66766...99***********87767876..5688788999999999987556666666666666 PP == domain 2 score: -2.1 bits; conditional E-value: 0.35 CBM25.hmm 47 tidlgeasqlnaaFndgsgnWDN 69 i +++++q++ + d++g+W + WAG56757.1|CBM25|CBM26|GH31_10 913 YIGTTTNNQVKLQYLDDNGKWSS 935 56667888999999999999965 PP == domain 3 score: 83.0 bits; conditional E-value: 9.5e-28 CBM25.hmm 2 evtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 vt+yY kkg++++y h+++ +g+Wt++pg++M +++++g+ k+t+++g+a++ +++Fndg+g WDNn+g+nY f WAG56757.1|CBM25|CBM26|GH31_10 1006 GVTIYY---KKGYTTPYTHWRPSTGTWTTSPGTKMqDSEIAGYSKATLNIGTATSAEVCFNDGNGIWDNNGGKNYIF 1079 69****...******************************************************************98 PP == domain 4 score: -1.6 bits; conditional E-value: 0.23 CBM25.hmm 15 sevylhygvgggsWtavpgvaMekacdgwv 44 s+ ++ ++++gg++ +++v++++ ++ + WAG56757.1|CBM25|CBM26|GH31_10 1100 SQLTVAVDIKGGTYALAQTVKLTASSTASI 1129 555555556666666666666655444333 PP == domain 5 score: 16.2 bits; conditional E-value: 6.5e-07 CBM25.hmm 3 vtvyYnglkkgasevylhygvggg..sWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsg 65 +tv Y ++ +++ +++l+y +++ + ++ pg++M+++ + w++ ti+ + s+ ++ Fndg+ WAG56757.1|CBM25|CBM26|GH31_10 1185 TTVHY-KNPSSWGAPNLYYYDASKvlTSSTWPGIKMNSDGNSWYSYTIQ--NCSTAKVIFNDGKH 1246 79999.7789999999988776664677789*****************9..89*********985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1346 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 141.01 // Query: UQZ32183.1|CBM20|CBM25|GH119 [L=1264] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-56 173.6 7.3 1.9e-31 94.8 0.1 4.2 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.8 0.1 1.9e-31 1.9e-31 1 77 [. 904 978 .. 904 979 .. 0.98 2 ! 73.1 3.4 1.1e-24 1.1e-24 4 77 .. 1070 1143 .. 1068 1144 .. 0.96 3 ! 4.4 0.0 0.0032 0.0032 16 58 .. 1180 1221 .. 1164 1231 .. 0.79 Alignments for each domain: == domain 1 score: 94.8 bits; conditional E-value: 1.9e-31 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n+vt+yY k+g+s++y+hy+++gg+Wt++pgv+M +++ +g+ k+ti++g+a+ql+a+Fn+gsg+WD+n+g+nY f UQZ32183.1|CBM20|CBM25|GH119 904 NNVTIYY---KQGYSSPYIHYRPAGGTWTTAPGVPMpASELSGYNKITINIGAATQLEACFNNGSGTWDSNGGSNYLF 978 68*****...******************************************************************98 PP == domain 2 score: 73.1 bits; conditional E-value: 1.1e-24 CBM25.hmm 4 tvyYnglkkgasevylhygvggg.sWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 ++yY +++ +s+ y+hy++++ +Wt+vpg+aM ++a +g+ i+lg a++l+aaFn+gsg+WDNn+g+nYsf UQZ32183.1|CBM20|CBM25|GH119 1070 NIYY--KNTAFSNSYIHYKLNNAaNWTTVPGTAMqSSAFTGYKFLAIPLGGATGLTAAFNNGSGTWDNNGGNNYSF 1143 79**..999***********9999**********999**************************************9 PP == domain 3 score: 4.4 bits; conditional E-value: 0.0032 CBM25.hmm 16 evylhygvgggsWtav.pgvaMekacdgwvkktidlgeasqlna 58 vyl ++ +sW+a+ p +++ k +dg++++t++l ++++++ UQZ32183.1|CBM20|CBM25|GH119 1180 PVYLSGSF--NSWNAAdPAYKLVKGSDGVYSITLNLPAGTEVQY 1221 57888888..8**998467889**************88888775 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1264 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 155.39 // Query: XGZ04522.1|CBM20|CBM25|GH13 [L=999] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-55 172.3 6.2 3.2e-29 87.7 0.1 4.5 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 87.7 0.1 3.2e-29 3.2e-29 1 77 [. 648 722 .. 648 723 .. 0.98 2 ! 72.4 1.3 1.9e-24 1.9e-24 1 77 [. 802 878 .. 802 879 .. 0.96 3 ! 11.3 0.0 2.1e-05 2.1e-05 16 69 .. 915 965 .. 900 971 .. 0.85 Alignments for each domain: == domain 1 score: 87.7 bits; conditional E-value: 3.2e-29 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n+vt+yY k+g++++y+hy++ gg+Wt++pgva+ ++ +g+ k+ti++g+asql+a+Fn+gsg+WD+n+g+nY f XGZ04522.1|CBM20|CBM25|GH13 648 NSVTIYY---KQGYTSPYIHYRPVGGTWTTSPGVAIpVSDVAGYNKITINIGSASQLEACFNNGSGTWDSNGGSNYLF 722 68*****...******************************************************************98 PP == domain 2 score: 72.4 bits; conditional E-value: 1.9e-24 CBM25.hmm 1 nevtvyYnglkkgasevylhygvggg.sWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++t+yY +++ +s+ y+hy+++g Wt++pg ++ ++ g+ ++ti+lg+a +l+aaFn+gsg+WDNn+++nY+f XGZ04522.1|CBM20|CBM25|GH13 802 NTATIYY--KNTAYSSSYIHYKLDGAtVWTTAPGEQLqASSFPGYKSITIQLGTAAGLTAAFNNGSGTWDNNGSSNYHF 878 689****..9999**********99989*********99999***********************************98 PP == domain 3 score: 11.3 bits; conditional E-value: 2.1e-05 CBM25.hmm 16 evylhygvgggsWtav.pgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDN 69 vyl + +sW+a+ p ++++k +dg++++t++l +++ ++ F+ g+ W N XGZ04522.1|CBM20|CBM25|GH13 915 PVYLTGTF--NSWNAAdPAYQLTKGSDGVYSITLSLPAGTAVQYKFTRGA--WTN 965 68888888..8**998356788*************************998..887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (999 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 136.37 // Query: WDE10355.1|CBM25|GH119|3.2.1.1 [L=1278] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-18 51.3 15.3 7.7e-18 51.2 3.5 4.1 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 51.2 3.5 7.7e-18 7.7e-18 3 77 .. 893 975 .. 891 976 .. 0.91 2 ! 4.1 0.6 0.0038 0.0038 14 73 .. 1083 1138 .. 1070 1141 .. 0.72 3 ? 1.7 0.2 0.022 0.022 11 57 .. 1183 1224 .. 1168 1241 .. 0.67 Alignments for each domain: == domain 1 score: 51.2 bits; conditional E-value: 7.7e-18 CBM25.hmm 3 vtvyYnglkkgasevylhygvggg.sWtavpgvaMekacdgwvkktidl........geasqlnaaFndgsgnWDNnng 72 +t+yY +++++v lhy++++ +Wt++pgvaM++ ++w++ t++l +++ql ++ nd +++WDNn g WDE10355.1|CBM25|GH119|3.2.1.1 893 TTLYY-RDVNNWQQVCLHYSLDNAvTWTQAPGVAMTALTNNWFEYTLNLtdslgnglANGEQLVFVTNDCNSQWDNNAG 970 67888.7799************99************************9887776666789999999************ PP CBM25.hmm 73 anYsf 77 +Y + WDE10355.1|CBM25|GH119|3.2.1.1 971 LDYRV 975 ***86 PP == domain 2 score: 4.1 bits; conditional E-value: 0.0038 CBM25.hmm 14 asevylhygvgggsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnga 73 ++ ++l+y+ ++++Wt+ +aMe +d++++ i+ ++q ++ d +g W n g WDE10355.1|CBM25|GH119|3.2.1.1 1083 SNFPQLYYRGTSNGWTS---TAMELVSDHLWQLDINFDGQNQQRFK-LDIHGDWSVNYGD 1138 45578899999999986...68**************9666665544.2666666666555 PP == domain 3 score: 1.7 bits; conditional E-value: 0.022 CBM25.hmm 11 kkgasevylhygvgggsWtavpgvaMekacdgwvkktidlgeasqln 57 k+++++vy+ + ++W++ aMe +d+ ++ ++ ++q + WDE10355.1|CBM25|GH119|3.2.1.1 1183 KANFNQVYFRGTA--NNWQT---SAMELVSDHHWQLAVNFDGGEQQR 1224 5666666666666..56654...578888888888888874444443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1278 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.08 // Query: WNS43624.1|CBM20|CBM25|GH13 [L=1015] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-55 170.5 14.7 2e-29 88.3 0.2 4.1 4 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.6 0.8 1 1 60 76 .. 193 208 .. 190 209 .. 0.72 2 ! 88.3 0.2 2e-29 2e-29 1 77 [. 648 722 .. 648 723 .. 0.98 3 ! 84.5 1.8 3.2e-28 3.2e-28 1 77 [. 818 894 .. 818 895 .. 0.97 4 ! 5.4 0.0 0.0015 0.0015 18 58 .. 933 972 .. 928 981 .. 0.79 Alignments for each domain: == domain 1 score: -4.6 bits; conditional E-value: 1 CBM25.hmm 60 FndgsgnWDNnnga.nYs 76 Fn+ + W ng n+s WNS43624.1|CBM20|CBM25|GH13 193 FNNPA--WYHHNGDiNWS 208 77777..88877766887 PP == domain 2 score: 88.3 bits; conditional E-value: 2e-29 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n+vt+yY k+g++++y+hy+++gg Wt++pgva+ +++ +g+ k+ti++g+a++l+a+Fn+gsg+WD+n+g+nY+f WNS43624.1|CBM20|CBM25|GH13 648 NNVTIYY---KQGYATPYIHYRPAGGVWTTAPGVAIpAAEVAGYNKITINIGAATGLEACFNNGSGTWDSNGGSNYTF 722 68*****...*******************************************************************9 PP == domain 3 score: 84.5 bits; conditional E-value: 3.2e-28 CBM25.hmm 1 nevtvyYnglkkgasevylhygvggg.sWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++t+yY +++ +s+ y+hy+++g sWt+vpgv+M ++a++g+ ++ti lg+a +l+aaFn+gsg+WDNn+g+nY+f WNS43624.1|CBM20|CBM25|GH13 818 NTATIYY--KNSAYSSSYIHYKLDGAsSWTTVPGVQMgASAYSGYSSATIALGNAAGLTAAFNNGSGTWDNNGGSNYHF 894 689****..999************999***************************************************9 PP == domain 4 score: 5.4 bits; conditional E-value: 0.0015 CBM25.hmm 18 ylhygvgggsWtavpgv.aMekacdgwvkktidlgeasqlna 58 yl ++ +sW+a++++ +++k++dg +++t++l +++ ++ WNS43624.1|CBM20|CBM25|GH13 933 YLTGSF--NSWNAADSAyQLTKESDGTYSVTLNLPAGTAVQY 972 667777..89**99876167**************88777765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1015 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 133.43 // Query: WHY18680.1|CBM20|CBM25|GH13 [L=995] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.9e-54 166.2 8.0 3.1e-29 87.7 0.1 4.7 4 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.0 0.34 0.34 44 65 .. 470 493 .. 450 510 .. 0.57 2 ! 87.7 0.1 3.1e-29 3.1e-29 1 77 [. 648 722 .. 648 723 .. 0.98 3 ! 73.1 1.2 1.1e-24 1.1e-24 1 77 [. 798 874 .. 798 875 .. 0.96 4 ! 6.0 0.0 0.00097 0.00097 16 69 .. 911 961 .. 896 967 .. 0.76 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.34 CBM25.hmm 44 vkktidl..geasqlnaaFndgsg 65 +++ id+ +++++ +F ++s+ WHY18680.1|CBM20|CBM25|GH13 470 FSRRIDTgtNQGQEAISVFSNQSN 493 555566532333333345555553 PP == domain 2 score: 87.7 bits; conditional E-value: 3.1e-29 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n+vt+yY k+g++++y+hy++ gg+Wt++pgva+ ++ +g+ k+ti++g+asql+a+Fn+gsg+WD+n+g+nY f WHY18680.1|CBM20|CBM25|GH13 648 NSVTIYY---KQGYTSPYIHYRPVGGTWTTSPGVAIpVSDVAGYNKITINIGSASQLEACFNNGSGTWDSNGGSNYLF 722 68*****...******************************************************************98 PP == domain 3 score: 73.1 bits; conditional E-value: 1.1e-24 CBM25.hmm 1 nevtvyYnglkkgasevylhygvggg.sWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++t+yY +++ +s+ y+hy+++g+ Wt++pg ++ ++ g+ ++ti+lg+a +l+aaFn+gsg+WDNn+++nY+f WHY18680.1|CBM20|CBM25|GH13 798 NTATIYY--KNTAYSSSYIHYRLDGStVWTTAPGEQLqASSFPGYKSITIQLGTAAGLTAAFNNGSGTWDNNGSSNYHF 874 689****..9999**********99989*********99999***********************************99 PP == domain 4 score: 6.0 bits; conditional E-value: 0.00097 CBM25.hmm 16 evylhygvgggsWtav.pgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDN 69 vyl + +sW+a+ p ++++k +dg++++t++l +++ ++ + g+ W N WHY18680.1|CBM20|CBM25|GH13 911 PVYLTGTF--NSWNAAdPAYQLTKGSDGVYSITLSLPAGTAVQYKVTRGA--WTN 961 68888888..8**998356788************9977777765444333..655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (995 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 126.74 // Query: BFR74414.1|CBM25|GH119 [L=1300] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-57 178.2 1.1 5.9e-31 93.2 0.9 3.2 2 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 93.2 0.9 5.9e-31 5.9e-31 2 77 .. 988 1061 .. 987 1062 .. 0.97 2 ! 81.7 0.0 2.3e-27 2.3e-27 1 77 [. 1176 1250 .. 1176 1251 .. 0.98 Alignments for each domain: == domain 1 score: 93.2 bits; conditional E-value: 5.9e-31 CBM25.hmm 2 evtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 vtvyY k+g++++y+hy+++gg+Wt++pgv+M +++ g++k t+++g+a++l+a+Fn+gsg+WDNn+g+nY+f BFR74414.1|CBM25|GH119 988 VVTVYY---KQGYTNPYIHYRPTGGTWTTAPGVKMaVAEMPGYMKMTVNVGTATGLEAVFNNGSGTWDNNGGKNYQF 1061 59****...**************************99**************************************99 PP == domain 2 score: 81.7 bits; conditional E-value: 2.3e-27 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n+vt+yY k+g++++++hy+++gg+Wt+ pgv++ ++ g+ k+tid+g++++l+a+Fn+gsg+WDNn+g+nY f BFR74414.1|CBM25|GH119 1176 NSVTLYY---KQGYAQPNIHYRPAGGTWTTPPGVPIpVSDLPGYNKITIDVGTSTGLEAVFNNGSGTWDNNGGRNYVF 1250 689****...******************************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1300 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 160.00 // Query: WDM28080.1|CBM20|CBM25|GH119 [L=1235] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-30 90.4 0.2 3.7e-28 84.3 0.0 2.9 2 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 84.3 0.0 3.7e-28 3.7e-28 1 77 [. 945 1019 .. 945 1020 .. 0.98 2 ! 3.2 0.0 0.0075 0.0075 16 58 .. 1151 1192 .. 1137 1203 .. 0.75 Alignments for each domain: == domain 1 score: 84.3 bits; conditional E-value: 3.7e-28 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++tvyY k g++++y+hy+++gg+Wt++pg+ M +++++g+ k t+dlg++ +l+a+Fn+gsg+WDNn+g+nY f WDM28080.1|CBM20|CBM25|GH119 945 NSATVYY---KPGYTTPYMHYRPAGGTWTTSPGTVMpASEIAGYHKLTVDLGASASLEAVFNNGSGTWDNNGGKNYIF 1019 689****...******************************************************************98 PP == domain 2 score: 3.2 bits; conditional E-value: 0.0075 CBM25.hmm 16 evylhygvgggsWtav.pgvaMekacdgwvkktidlgeasqlna 58 + y+ ++ +sW+a+ p ++ k+ dg + +t+++ e++ ++ WDM28080.1|CBM20|CBM25|GH119 1151 SLYVAGSF--NSWNAAdPASKLVKQADGTYTVTLPIAEGTAVQY 1192 56666667..899998356678******9999999988887765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1235 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 166.52 // Query: WNG38505.1|CBM20|CBM25|GH119 [L=1265] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-29 88.7 2.6 3.8e-28 84.2 0.1 3.1 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.8 0.1 1 1 26 50 .. 103 128 .. 92 137 .. 0.58 2 ! 84.2 0.1 3.8e-28 3.8e-28 1 77 [. 984 1058 .. 984 1059 .. 0.98 3 ! 3.5 0.0 0.0059 0.0059 3 76 .. 1171 1251 .. 1169 1253 .. 0.75 Alignments for each domain: == domain 1 score: -3.8 bits; conditional E-value: 1 CBM25.hmm 26 g..sWtavpgvaM.ekacdgwvkktidl 50 sW + M ++a +g ++ +++ WNG38505.1|CBM20|CBM25|GH119 103 AymSWPGNVAADMnTNAPTG--QIHVTM 128 23577777777787777777..444443 PP == domain 2 score: 84.2 bits; conditional E-value: 3.8e-28 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++tvyY kkg++++y+h++++gg+Wt +pg++M +++ +g++k t++lg+a+ql+++Fn+gsg+WDNn+g nY + WNG38505.1|CBM20|CBM25|GH119 984 NTTTVYY---KKGFATPYIHFRPAGGTWTVSPGYPMpDSEVAGYAKYTVNLGTATQLECVFNNGSGTWDNNGGLNYFI 1058 689****...******************************************************************76 PP == domain 3 score: 3.5 bits; conditional E-value: 0.0059 CBM25.hmm 3 vtvyYngl..kkgasevylhygvggg.sWtavpgvaMekacdgwvkktidl..geasqlnaaFndgsgn..WDNnngan 74 +tv++n++ ++ +++++ +++ sW ++++ a+ +++t++l ++a q + +dgsgn W + ++ WNG38505.1|CBM20|CBM25|GH119 1171 ATVTFNETasTAVGQNIFIVGSIAALgSWAPGAAIPLSPANYPTWSVTLSLpgSTAIQYKYIKKDGSGNvtWESGTNRT 1249 688888885444456666666665544***************9********6666666777779998854488888877 PP CBM25.hmm 75 Ys 76 Y+ WNG38505.1|CBM20|CBM25|GH119 1250 YT 1251 76 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1265 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 153.42 // Query: WNG27791.1|CBM20|CBM25|GH119 [L=1267] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-26 77.6 5.2 2.3e-25 75.3 1.0 3.0 2 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 75.3 1.0 2.3e-25 2.3e-25 1 77 [. 984 1059 .. 984 1060 .. 0.97 2 ! 3.0 0.2 0.0084 0.0084 20 66 .. 1195 1241 .. 1158 1250 .. 0.72 Alignments for each domain: == domain 1 score: 75.3 bits; conditional E-value: 2.3e-25 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++tvyY ++++++ y+h+++g+g+Wt++pg M +++ g++k t++lg+a+ql+++Fndg+g+WDNn+g nY + WNG27791.1|CBM20|CBM25|GH119 984 NSATVYY--SNNNFTLKYIHFRIGSGTWTTAPGNVMaNSEVPGYAKYTVNLGAATQLECVFNDGKGTWDNNKGINYLL 1059 689****..99*****************************************************************86 PP == domain 2 score: 3.0 bits; conditional E-value: 0.0084 CBM25.hmm 20 hygvgggsWtavpgvaMekacdgwvkktidlgeasqlnaaF..ndgsgn 66 h + g+W++ + +++a+ +++t++l ++ l+ + +dgsgn WNG27791.1|CBM20|CBM25|GH119 1195 HAAI--GNWNTGAAILLSSASYPKWSVTLSLPGSTALEYKYikKDGSGN 1241 5566..7**********9999999*******555555544322777664 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1267 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.49 // Query: XRW28701.1|CBM20|CBM25|GH119 [L=1288] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-30 90.6 0.6 1.9e-29 88.4 0.6 2.3 1 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.4 0.6 1.9e-29 1.9e-29 3 77 .. 993 1066 .. 991 1067 .. 0.97 Alignments for each domain: == domain 1 score: 88.4 bits; conditional E-value: 1.9e-29 CBM25.hmm 3 vtvyYnglkkgasevylhygvgggsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 +tvyY l +g++++++hy+++gg+Wtavpgv+M++ac+gw++ t +lg+as+ +a+Fn+gsg+WDNn+g+nY++ XRW28701.1|CBM20|CBM25|GH119 993 ATVYY-RLPSGWNSANIHYSPTGGAWTAVPGVPMAAACSGWLSYTASLGSASSWQAVFNNGSGSWDNNGGKNYAL 1066 799**.99*****************************************************************87 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1288 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 155.80 // Query: XUY83888.1|CBM25|GH119 [L=1418] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-23 68.8 1.0 2.6e-23 68.8 1.0 5.1 4 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.1 0.12 0.12 10 35 .. 634 660 .. 626 665 .. 0.80 2 ! 68.8 1.0 2.6e-23 2.6e-23 4 76 .. 878 950 .. 875 952 .. 0.96 3 ? -0.0 2.2 0.074 0.074 28 74 .. 1154 1196 .. 1135 1198 .. 0.77 4 ! 3.3 1.7 0.0067 0.0067 26 73 .. 1337 1380 .. 1320 1381 .. 0.77 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.12 CBM25.hmm 10 l.kkgasevylhygvgggsWtavpgva 35 ++ +++++ ++v++++W ++++ + XUY83888.1|CBM25|GH119 634 YdVSDIQDIKVKVRVHKDKWATATDKT 660 3478899999***********999865 PP == domain 2 score: 68.8 bits; conditional E-value: 2.6e-23 CBM25.hmm 4 tvyYnglkkgasevylhygvggg.sWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYs 76 +vyY + ++g+ +v lhy+++gg +Wt++pgvaM++ d+w++ +idl +a+ql+++ n sg WDNn+ganYs XUY83888.1|CBM25|GH119 878 SVYY-QDSNGWGQVCLHYSIDGGlTWTTAPGVAMQSLADNWYRLSIDLDNADQLEFVANSCSGAWDNNGGANYS 950 6999.779*****************************************************************8 PP == domain 3 score: -0.0 bits; conditional E-value: 0.074 CBM25.hmm 28 WtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnngan 74 W ++ aM+ d+ +++ +d +++ ++ F d +g W n g n XUY83888.1|CBM25|GH119 1154 W---QSSAMSLIADHTWQVLVDFDGQTEQRFKF-DVNGDWSQNYGDN 1196 4...4567888899999999**99999999999.5666999988877 PP == domain 4 score: 3.3 bits; conditional E-value: 0.0067 CBM25.hmm 26 gsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnga 73 ++W +++aM+ d+++++ti+ +s+ ++ F d g W n g XUY83888.1|CBM25|GH119 1337 NAW---QNTAMSLVRDNIWQVTISFDGQSGQRFKF-DTVGDWSYNLGD 1380 444...6689***************9999999999.566688777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1418 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 152.77 // Query: XRW34813.1|CBM20|CBM25|GH119 [L=1288] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-30 90.6 0.6 1.9e-29 88.4 0.6 2.3 1 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 88.4 0.6 1.9e-29 1.9e-29 3 77 .. 993 1066 .. 991 1067 .. 0.97 Alignments for each domain: == domain 1 score: 88.4 bits; conditional E-value: 1.9e-29 CBM25.hmm 3 vtvyYnglkkgasevylhygvgggsWtavpgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 +tvyY l +g++++++hy+++gg+Wtavpgv+M++ac+gw++ t +lg+as+ +a+Fn+gsg+WDNn+g+nY++ XRW34813.1|CBM20|CBM25|GH119 993 ATVYY-RLPSGWNSANIHYSPTGGAWTAVPGVPMAAACSGWLSYTASLGSASSWQAVFNNGSGSWDNNGGKNYAL 1066 799**.99*****************************************************************87 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1288 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 176.97 // Query: UJF34217.1|CBM20|CBM25 [L=155] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-15 42.9 6.1 2.3e-11 30.4 3.1 2.3 2 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.4 3.1 2.3e-11 2.3e-11 54 78 .] 11 35 .. 8 35 .. 0.93 2 ! 13.2 0.0 5.7e-06 5.7e-06 18 69 .. 71 121 .. 57 125 .. 0.80 Alignments for each domain: == domain 1 score: 30.4 bits; conditional E-value: 2.3e-11 CBM25.hmm 54 sqlnaaFndgsgnWDNnnganYsfs 78 ++l+a+Fndgsg+WDNn+g+nY f+ UJF34217.1|CBM20|CBM25 11 NGLTAVFNDGSGTWDNNGGNNYRFN 35 689*******************995 PP == domain 2 score: 13.2 bits; conditional E-value: 5.7e-06 CBM25.hmm 18 ylhygvgggsWtav.pgvaMekacdgwvkktidlgeasqlnaaFndgsgnWDN 69 ++ + + ++W+++ p+++M+k+ dg + ++++ +++l+ + gs WD+ UJF34217.1|CBM20|CBM25 71 DIYLSSNVNTWNTSdPSYKMTKNVDGTYVLKLQIPPGTNLEYKLTKGS--WDS 121 444555559**8764799****************99999998888777..997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (155 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 43.94 // Query: XHF25681.1|CBM20|CBM25|GH119 [L=1451] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-59 183.0 5.4 2.1e-30 91.5 0.1 3.8 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 0.2 6.1e-30 6.1e-30 2 77 .. 985 1058 .. 984 1059 .. 0.98 2 ! 91.5 0.1 2.1e-30 2.1e-30 1 77 [. 1170 1244 .. 1170 1245 .. 0.98 3 ? 1.8 0.1 0.021 0.021 3 65 .. 1357 1424 .. 1355 1435 .. 0.74 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.1e-30 CBM25.hmm 2 evtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 ++tvyY kkg++++ylhy+++gg+Wt++pgv M +++ +g++k t++lg+ +ql+a+Fn+gsg+WDNnng nY f XHF25681.1|CBM20|CBM25|GH119 985 TTTVYY---KKGFTTPYLHYRPAGGTWTTAPGVLMpDAEVAGYAKYTVNLGSVQQLEAVFNNGSGTWDNNNGGNYLF 1058 689***...******************************************************************98 PP == domain 2 score: 91.5 bits; conditional E-value: 2.1e-30 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++tvyY kkg++++ylhy+++gg+Wt++pgvaM +++ +g++k+t++lg+a+ql+a+Fn+gsg+WDNn+g nY f XHF25681.1|CBM20|CBM25|GH119 1170 NSATVYY---KKGYATPYLHYRPAGGTWTTSPGVAMaTAEVAGYAKVTVSLGSATQLEAVFNNGSGTWDNNGGLNYFF 1244 689****...******************************************************************98 PP == domain 3 score: 1.8 bits; conditional E-value: 0.021 CBM25.hmm 3 vtvyYngl..kkgasevylhygvggg.sWtavpgvaMekacdgwvkktidlgeasqlnaaF..ndgsg 65 +tv++n + + ++vy+ +v+ sW+ ++ v +++a+ + + + l ++ ++ F +d ++ XHF25681.1|CBM20|CBM25|GH119 1357 ATVTFNVTasTVMGQSVYVVGSVAALgSWSPASAVLLSAANYPTWGAAVGLPGSTAIEYKFikKDAAN 1424 577777775455567888888887655**********9999999*******77777776663366655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1451 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 148.79 // Query: WNG62929.1|CBM20|CBM25|GH119 [L=1416] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-58 179.1 5.4 6.1e-30 90.0 0.5 3.9 3 CBM25.hmm Domain annotation for each model (and alignments): >> CBM25.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.0 0.5 6.1e-30 6.1e-30 1 77 [. 949 1023 .. 949 1024 .. 0.98 2 ! 85.5 0.0 1.6e-28 1.6e-28 2 77 .. 1136 1209 .. 1135 1210 .. 0.97 3 ! 3.7 0.1 0.0052 0.0052 3 65 .. 1322 1389 .. 1320 1399 .. 0.72 Alignments for each domain: == domain 1 score: 90.0 bits; conditional E-value: 6.1e-30 CBM25.hmm 1 nevtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 n++tvyY kkg++++y+h++++gg+Wt +pg+aM +++ +g++k t++lg+a+ql+a+Fn+gsg+WDNnng+nY f WNG62929.1|CBM20|CBM25|GH119 949 NTTTVYY---KKGFAAPYIHFRPTGGTWTVAPGYAMpDSEVSGYAKYTVNLGSATQLEAVFNNGSGTWDNNNGSNYVF 1023 689****...******************************************************************98 PP == domain 2 score: 85.5 bits; conditional E-value: 1.6e-28 CBM25.hmm 2 evtvyYnglkkgasevylhygvgggsWtavpgvaM.ekacdgwvkktidlgeasqlnaaFndgsgnWDNnnganYsf 77 vtvyY kkg++++ +hy+++gg+Wt++pgv+M +++ +g++k ti l++a+ql+a+Fn+gsg+WDNn+g nY + WNG62929.1|CBM20|CBM25|GH119 1136 VVTVYY---KKGFTTPLIHYRPAGGTWTSSPGVPMpDAEVAGYAKSTIYLNSATQLEAVFNNGSGTWDNNGGLNYFI 1209 59****...******************************************************************76 PP == domain 3 score: 3.7 bits; conditional E-value: 0.0052 CBM25.hmm 3 vtvyYngl..kkgasevylhygvggg.sWtavpgvaMekacdgwvkktidlgeasqlnaaF..ndgsg 65 +tv++n++ ++ +++y+ +++ sW++++ ++++ a+ +++ ++l ++ ++ + +dgsg WNG62929.1|CBM20|CBM25|GH119 1322 ATVTFNETasTAVGQNIYVVGSIAALgSWNSANAIQLSPANYPTWSVALSLPGSTAFEYKYlkKDGSG 1389 689999885555556777777776545**********9999999**9999955555444332256655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1416 residues searched) Target model(s): 1 (78 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 154.29 // [ok]