# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM21/fasta_for_each_cluster/cluster_79.txt # target HMM database: merged_hmms/CBM21.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM21/CBM21_cluster_79.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 4581|Kazaf1_GeneCatalog_proteins_20150111.aa.fasta|CBM21 [L=466] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-29 87.6 14.9 3.9e-29 87.6 14.9 2.7 3 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.1 0.19 0.19 41 100 .. 19 82 .. 15 84 .. 0.65 2 ! 87.6 14.9 3.9e-29 3.9e-29 3 106 .. 149 257 .. 147 258 .. 0.92 3 ? -3.0 1.4 0.56 0.56 89 89 .. 397 397 .. 338 460 .. 0.63 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.19 CBM21.hmm 41 dnwktvseveaeYvksssesaetDrFkfkiklaelkaseekklefcirYevng 93 d+ ++ ++ + ++++++++ +++D+ + i+++++++ ++ +++ Y + + 4581|Kazaf1_GeneCatalog_proteins_20150111.aa.fasta|CBM21 19 DRTRKAHKKNVRFSTNLTSIKKFDKNAEPITISNENSPLNSPDLIALDYVTDD 71 66677777777888888888888887777777777444444444566776665 PP CBM21.hmm 94 ....eeywdnn 100 yw nn 4581|Kazaf1_GeneCatalog_proteins_20150111.aa.fasta|CBM21 72 adddDLYWFNN 82 55556788777 PP == domain 2 score: 87.6 bits; conditional E-value: 3.9e-29 CBM21.hmm 3 skvvleslslsadkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYvk 55 ++++l+s++ ++ +vG + V nl++eK+++v++t++nw+++++v+++Y + 4581|Kazaf1_GeneCatalog_proteins_20150111.aa.fasta|CBM21 149 NNIYLQSIQ--LIENEIVGYIVVDNLNYEKNIEVKITFNNWENIHYVNSVYYS 199 78999*999..67789************************************* PP CBM21.hmm 56 sssesa.......etDrFkfkiklaelkaseekklefcirYevngeeywdnnn 101 s+++++ + D+Fkf +kl++ +++++ +l+fc+rY+vn+e+y+dnn 4581|Kazaf1_GeneCatalog_proteins_20150111.aa.fasta|CBM21 200 SINSKKdkfrfviSLDKFKFFLKLKNIIQNNTLHLQFCCRYDVNNETYYDNNF 252 ***987788888888888888888888899*********************** PP CBM21.hmm 102 gkNYk 106 ++NY+ 4581|Kazaf1_GeneCatalog_proteins_20150111.aa.fasta|CBM21 253 YNNYQ 257 ****8 PP == domain 3 score: -3.0 bits; conditional E-value: 0.56 CBM21.hmm 89 Y 89 4581|Kazaf1_GeneCatalog_proteins_20150111.aa.fasta|CBM21 397 D 397 1 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (466 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 30.43 // Query: 488|Kazaf1_GeneCatalog_proteins_20150111.aa.fasta|CBM21 [L=621] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-30 91.7 10.3 2e-30 91.7 10.3 2.5 2 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.7 10.3 2e-30 2e-30 2 107 .] 164 283 .. 163 283 .. 0.95 2 ? -2.9 1.5 0.53 0.53 61 75 .. 547 565 .. 484 576 .. 0.60 Alignments for each domain: == domain 1 score: 91.7 bits; conditional E-value: 2e-30 CBM21.hmm 2 kskvvleslslsadkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYvk 55 +++++l+ ++ + ++ ++ G+++V+nl+feK +++++t+++w+++++v a+++k 488|Kazaf1_GeneCatalog_proteins_20150111.aa.fasta|CBM21 164 TQNIKLHTIT-QLNNYKILGLIYVNNLNFEKFIEIKFTFNDWNDIHYVAATFNK 216 6889999999.79999************************************** PP CBM21.hmm 56 sssesaetDrFkfkiklaelk.................aseekklefcirYevn 92 s+++ ++D+Fkf +++++l +++ ++e+c+rY+vn 488|Kazaf1_GeneCatalog_proteins_20150111.aa.fasta|CBM21 217 SIND--KIDEFKFILDFKSLEcllkfkkliyannnnadCHCKLNIELCCRYDVN 268 ****..7************999********999988887888************ PP CBM21.hmm 93 geeywdnnngkNYkv 107 ge+y+dnnn++NY++ 488|Kazaf1_GeneCatalog_proteins_20150111.aa.fasta|CBM21 269 GETYYDNNNYRNYQI 283 *************97 PP == domain 2 score: -2.9 bits; conditional E-value: 0.53 CBM21.hmm 61 a....etDrFkfkiklael 75 +D ++++ +l++ 488|Kazaf1_GeneCatalog_proteins_20150111.aa.fasta|CBM21 547 LintnIVDMWSLQCQLPSS 565 0233256777777776665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (621 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 47.15 // Query: 102953|Zygrou1_GeneCatalog_proteins_20210728.aa.fasta|CBM21 [L=661] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.5e-32 96.0 3.9 2.4e-31 94.7 3.9 1.7 1 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.7 3.9 2.4e-31 2.4e-31 3 107 .] 232 352 .. 230 352 .. 0.91 Alignments for each domain: == domain 1 score: 94.7 bits; conditional E-value: 2.4e-31 CBM21.hmm 3 skvvleslsls.adkkvlvGtvkVknlafeKkvtvrytldnwktvsevea 51 s++ l+sl+++ ++ ++ G+++V+nl+feK +++++t++nwk++++v+a 102953|Zygrou1_GeneCatalog_proteins_20210728.aa.fasta|CBM21 232 SNIRLHSLEQInNEFGKVLGLIYVNNLNFEKFIEIKLTFNNWKDIHYVTA 281 67888888876467789********************************* PP CBM21.hmm 52 eYvksssesaetDrFkfkiklaelk.................aseekkle 84 +Y++s+++ + D+Fkf i+l+ lk + + +++ 102953|Zygrou1_GeneCatalog_proteins_20210728.aa.fasta|CBM21 282 TYHRSITD--KLDEFKFVIDLNVLKyslqmrnllyynpalttTLCPLDVN 329 ********..7************99888888888888887777777**** PP CBM21.hmm 85 fcirYevngeeywdnnngkNYkv 107 +c+rY+vnge+++dnnn++NY++ 102953|Zygrou1_GeneCatalog_proteins_20210728.aa.fasta|CBM21 330 LCCRYDVNGETFYDNNNYENYQM 352 *********************95 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (661 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.09 // Query: UCS25385.1|CBM21 [L=682] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-31 92.7 10.4 9.7e-31 92.7 10.4 2.2 2 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.7 10.4 9.7e-31 9.7e-31 3 107 .] 178 297 .. 176 297 .. 0.94 2 ? -3.4 0.2 0.77 0.77 80 101 .. 344 365 .. 327 368 .. 0.51 Alignments for each domain: == domain 1 score: 92.7 bits; conditional E-value: 9.7e-31 CBM21.hmm 3 skvvleslslsadkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYvksssesaetDrFkfkiklaelk................... 76 s+++l++l+ +++++l+G+++V+nl+feK ++v+++++nwk++++++a+Y+ks+++ ++D+F+f+i++ + k UCS25385.1|CBM21 178 SNIKLHNLQ--KKTNKLKGLIYVNNLNFEKFIEVKFSFNNWKDIHYATATYNKSITD--HIDEFRFTIDVMTFKyilkskgliycdsysnedc 266 678899998..999*******************************************..8************999999999999999888777 PP CBM21.hmm 77 aseekklefcirYevngeeywdnnngkNYkv 107 + ++ ++++c+rY+vn+e+y+dnnn+kNY++ UCS25385.1|CBM21 267 TYCDLSMDLCCRYDVNNETYYDNNNYKNYHI 297 7777*************************97 PP == domain 2 score: -3.4 bits; conditional E-value: 0.77 CBM21.hmm 80 ekklefcirYevngeeywdnnn 101 + + +f + +++ ++ nn+ UCS25385.1|CBM21 344 SFQTDFLTTTTLSHNLFFHNNS 365 2233333333444466666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (682 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.91 // Query: 4930|Nakdel1_GeneCatalog_proteins_20160805.aa.fasta|CBM21 [L=903] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-30 91.5 5.4 5.3e-30 90.4 5.4 1.6 1 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.4 5.4 5.3e-30 5.3e-30 4 106 .. 248 362 .. 245 363 .. 0.92 Alignments for each domain: == domain 1 score: 90.4 bits; conditional E-value: 5.3e-30 CBM21.hmm 4 kvvleslsls.adkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYv 54 +++l sl++s + +++ G ++Vknl+feK ++ +yt++nwk++++ +a ++ 4930|Nakdel1_GeneCatalog_proteins_20160805.aa.fasta|CBM21 248 NIQLVSLAQSpDAGESILGRIMVKNLNFEKFIETKYTFNNWKDIHYSTAYFN 299 677777776667889************************************* PP CBM21.hmm 55 ksssesaetDrFkfkiklaelk.............aseekklefcirYevng 93 ks+s+ e+D+F+f+i+l++lk ++ ++e+c+rY+vng 4930|Nakdel1_GeneCatalog_proteins_20160805.aa.fasta|CBM21 300 KSISP--EIDEFAFNINLNSLKyilqfkkilefssNTAYLDMELCCRYDVNG 349 *****..7*************9999999999987777779************ PP CBM21.hmm 94 eeywdnnngkNYk 106 e+y+dnnn++NY+ 4930|Nakdel1_GeneCatalog_proteins_20160805.aa.fasta|CBM21 350 ETYYDNNNYNNYC 362 ************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (903 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 138.14 // Query: UCS31400.1|CBM21 [L=915] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-30 91.7 7.9 2.1e-30 91.7 7.9 2.1 2 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.0 0.32 0.32 19 75 .. 54 129 .. 43 142 .. 0.55 2 ! 91.7 7.9 2.1e-30 2.1e-30 9 106 .. 287 396 .. 280 397 .. 0.91 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.32 CBM21.hmm 19 lvGtvkVknlafeKkvtvrytldnwktvseveaeYvksssesa...................etDrFkfkiklael 75 l++ kn+ f ++t ++d+ ++ +++ e ++++++ + ++D F+ + +l+ l UCS31400.1|CBM21 54 LSTASSLKNVRFATNLTTVKSFDSNSEPISISHENSPTLKPLResessnvsstslnnvlylsDYDDFTKHQDLNFL 129 5555566777777777777777766665555554444444433444444445555555566666666666655555 PP == domain 2 score: 91.7 bits; conditional E-value: 2.1e-30 CBM21.hmm 9 slsls.adkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYvksssesaetDrFkfkiklaelk.............aseekklefci 87 sl++ + + ++vG++ Vknl++eK ++v+yt++nw+++++++a ++ks+s+ e+D+F+fki+l++lk +++ ++e+c+ UCS31400.1|CBM21 287 SLAQDsTIDDKIVGKILVKNLNYEKFIEVKYTFNNWNDIHYITAYFTKSISA--EIDEFEFKINLSSLKyilqfkrilqfksNDTYLNMELCC 377 44433366789****************************************9..8*************99******99998888889****** PP CBM21.hmm 88 rYevngeeywdnnngkNYk 106 rY+vnge+y+dnnn++NY+ UCS31400.1|CBM21 378 RYDVNGETYYDNNNYRNYN 396 ******************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (915 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 109.20 // Query: 118075|Metbi1_GeneCatalog_proteins_20120327.aa.fasta|CBM21 [L=641] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-31 93.2 1.1 1.3e-30 92.3 1.1 1.5 1 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.3 1.1 1.3e-30 1.3e-30 3 106 .. 300 401 .. 298 402 .. 0.94 Alignments for each domain: == domain 1 score: 92.3 bits; conditional E-value: 1.3e-30 CBM21.hmm 3 skvvleslslsadkkvlvGtvkVknlafeKkvtvrytldnwkt.vseveae 52 s+v+l+s+sl adk++l +v+++nlafeK+++v++t+++w++ + +++a 118075|Metbi1_GeneCatalog_proteins_20120327.aa.fasta|CBM21 300 SAVYLQSVSLAADKQSLELLVMCQNLAFEKNLSVKLTFNDWQSsMIYTSAA 350 689**************************************972567788* PP CBM21.hmm 53 YvksssesaetDrFkfkiklaelkaseekklefcirYevngeeywdnnngk 103 Y ks s++ ++D+Fkf+i+l++l + + +fci+Y vn++++wdnn+ + 118075|Metbi1_GeneCatalog_proteins_20120327.aa.fasta|CBM21 351 YCKSFSSV-NYDQFKFTIPLKHL--PSPLSAQFCIKYVVNNSTFWDNNDTN 398 ******98.************98..899*********************** PP CBM21.hmm 104 NYk 106 NY+ 118075|Metbi1_GeneCatalog_proteins_20120327.aa.fasta|CBM21 399 NYR 401 **7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (641 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 119.34 // Query: UCS35844.1|CBM21 [L=682] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-31 92.7 10.4 9.7e-31 92.7 10.4 2.2 2 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.7 10.4 9.7e-31 9.7e-31 3 107 .] 178 297 .. 176 297 .. 0.94 2 ? -3.4 0.2 0.77 0.77 80 101 .. 344 365 .. 327 368 .. 0.51 Alignments for each domain: == domain 1 score: 92.7 bits; conditional E-value: 9.7e-31 CBM21.hmm 3 skvvleslslsadkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYvksssesaetDrFkfkiklaelk................... 76 s+++l++l+ +++++l+G+++V+nl+feK ++v+++++nwk++++++a+Y+ks+++ ++D+F+f+i++ + k UCS35844.1|CBM21 178 SNIKLHNLQ--KKTNKLKGLIYVNNLNFEKFIEVKFSFNNWKDIHYATATYNKSITD--HIDEFRFTIDVMTFKyilkskgliycdsysnedc 266 678899998..999*******************************************..8************999999999999999888777 PP CBM21.hmm 77 aseekklefcirYevngeeywdnnngkNYkv 107 + ++ ++++c+rY+vn+e+y+dnnn+kNY++ UCS35844.1|CBM21 267 TYCDLSMDLCCRYDVNNETYYDNNNYKNYHI 297 7777*************************97 PP == domain 2 score: -3.4 bits; conditional E-value: 0.77 CBM21.hmm 80 ekklefcirYevngeeywdnnn 101 + + +f + +++ ++ nn+ UCS35844.1|CBM21 344 SFQTDFLTTTTLSHNLFFHNNS 365 2233333333444466666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (682 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.86 // Query: 4634|Ashgo1_1_GeneCatalog_proteins_20140830.aa.fasta|CBM21 [L=680] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-31 95.1 5.3 3.2e-31 94.3 5.3 1.5 1 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.3 5.3 3.2e-31 3.2e-31 3 106 .. 271 388 .. 269 389 .. 0.94 Alignments for each domain: == domain 1 score: 94.3 bits; conditional E-value: 3.2e-31 CBM21.hmm 3 skvvleslslsadkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeY 53 +++ l+++s +d ++++G+++V+nl+feK ++v++++d+wk++++v+a+Y 4634|Ashgo1_1_GeneCatalog_proteins_20140830.aa.fasta|CBM21 271 HNIRLNKVS-LVDMHTIKGSLYVTNLHFEKFIEVKFSFDEWKNIHYVTAQY 320 789999999.6999************************************* PP CBM21.hmm 54 vksssesaetDrFkfkiklaelk.................aseekklefci 87 k++++ ++D+F+f i+l++ k + + ++++c+ 4634|Ashgo1_1_GeneCatalog_proteins_20140830.aa.fasta|CBM21 321 LKTVTS--KVDEFQFIIDLSSYKyfmkvknllycvpgareTWCPVTMSLCC 369 *****9..7************99999999999998888877788******* PP CBM21.hmm 88 rYevngeeywdnnngkNYk 106 rY+vnge+y+dnnn++NY+ 4634|Ashgo1_1_GeneCatalog_proteins_20140830.aa.fasta|CBM21 370 RYDVNGETYYDNNNYENYQ 388 ******************8 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (680 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.12 // Query: 372|Nakbac1_GeneCatalog_proteins_20160804.aa.fasta|CBM21 [L=1095] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-31 92.9 7.1 6.4e-30 90.1 7.1 2.7 1 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.1 7.1 6.4e-30 6.4e-30 4 106 .. 370 482 .. 367 483 .. 0.91 Alignments for each domain: == domain 1 score: 90.1 bits; conditional E-value: 6.4e-30 CBM21.hmm 4 kvvleslsls.adkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYvk 55 ++ l l++s +d++++vG++ V+nl+feK +++++t++nwk++++v+a+Y+k 372|Nakbac1_GeneCatalog_proteins_20160804.aa.fasta|CBM21 370 NIRLYYLNQSkEDSSKIVGSILVTNLNFEKYIEIKFTFNNWKDIHYVTANYSK 422 566666665558999************************************** PP CBM21.hmm 56 sssesaetDrFkfkiklaelk...........aseekklefcirYevngeeyw 97 s+++ ++D+F f+i+la+lk + ++e+c+rY+vng +y+ 372|Nakbac1_GeneCatalog_proteins_20160804.aa.fasta|CBM21 423 SINS--RVDEFVFTIDLASLKyilqvkglinqFNPILNVELCCRYDVNGVTYY 473 ***9..8*************9999999988877778***************** PP CBM21.hmm 98 dnnngkNYk 106 dn+n+kNY+ 372|Nakbac1_GeneCatalog_proteins_20160804.aa.fasta|CBM21 474 DNDNYKNYT 482 ********8 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1095 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 120.10 // Query: 1428|Nakdel1_GeneCatalog_proteins_20160805.aa.fasta|CBM21 [L=712] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-28 85.5 6.8 5.6e-28 83.9 6.8 1.9 1 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.9 6.8 5.6e-28 5.6e-28 3 106 .. 185 303 .. 183 304 .. 0.94 Alignments for each domain: == domain 1 score: 83.9 bits; conditional E-value: 5.6e-28 CBM21.hmm 3 skvvleslslsadkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYv 54 ++++l+s++ +++++l G+++V+nl+feK +++++++++wk++++++a+++ 1428|Nakdel1_GeneCatalog_proteins_20160805.aa.fasta|CBM21 185 NNIKLHSFT--QKSNKLYGLLYVNNLNFEKFIELKFSFNGWKDIHYATASFK 234 678888888..9999************************************* PP CBM21.hmm 55 ksssesaetDrFkfkiklaelk...................aseekklefci 87 ks++e ++D+F+f i+l lk + ++ ++e+c+ 1428|Nakdel1_GeneCatalog_proteins_20160805.aa.fasta|CBM21 235 KSVTE--RIDEFQFCIDLMALKyilksknliycesldrdacTYCHLNMELCC 284 ****9..8************9999999999999998888888888******* PP CBM21.hmm 88 rYevngeeywdnnngkNYk 106 rY+vn+e+y+dnnn++NY+ 1428|Nakdel1_GeneCatalog_proteins_20160805.aa.fasta|CBM21 285 RYDVNNETYYDNNNYSNYH 303 ******************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (712 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 119.02 // Query: 2341|Klula1_GeneCatalog_proteins_20130227.aa.fasta|CBM21 [L=749] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-31 94.4 4.3 2.9e-31 94.4 4.3 2.7 3 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.2 0.17 0.17 62 92 .. 286 333 .. 267 360 .. 0.50 2 ? -2.8 2.9 0.51 0.51 38 76 .. 349 385 .. 328 419 .. 0.58 3 ! 94.4 4.3 2.9e-31 2.9e-31 3 107 .] 455 571 .. 453 571 .. 0.93 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.17 CBM21.hmm 62 etDrFkfkiklaelk.................aseekklefcirYevn 92 D F f +l++++ ++++ +f + Y + 2341|Klula1_GeneCatalog_proteins_20130227.aa.fasta|CBM21 286 PSDSFWFGTQLSKMNlplsksipkfslsdsdnDLDDSDSDFDVDYLND 333 566777776666665555555555554444433333455555555333 PP == domain 2 score: -2.8 bits; conditional E-value: 0.51 CBM21.hmm 38 ytldnwktvseveaeYvksssesaetDrFkfkiklaelk 76 ++ +n ++ ++v+++ ++s + + + Fkf+++ ++ + 2341|Klula1_GeneCatalog_proteins_20130227.aa.fasta|CBM21 349 FSSNNNSNSNSVPSSSSNSNTF--SHNSFKFRMNGSNDT 385 4444444444444433333222..456666666554443 PP == domain 3 score: 94.4 bits; conditional E-value: 2.9e-31 CBM21.hmm 3 skvvleslsls.adkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYv 54 ++++l++++ ++ +l+G+++V+nl+feK +++++++++wk++++v+a+++ 2341|Klula1_GeneCatalog_proteins_20130227.aa.fasta|CBM21 455 NNIKLHECNSLqLSQGKLTGLIYVNNLSFEKFIEIKFSFNGWKDIHYVTANFK 507 78999999865599*************************************** PP CBM21.hmm 55 ksssesaetDrFkfkiklaelk.............aseekklefcirYevnge 94 +++++ ++D+F+f i+l++ + + ++++c+rY+vnge 2341|Klula1_GeneCatalog_proteins_20130227.aa.fasta|CBM21 508 RTITD--TVDEFQFLINLSSFVyflkvknlilfnsLISPLTIQLCCRYDVNGE 558 *****..7************9999988888888776777************** PP CBM21.hmm 95 eywdnnngkNYkv 107 +y+dnnn++NY+v 2341|Klula1_GeneCatalog_proteins_20130227.aa.fasta|CBM21 559 TYYDNNNYENYQV 571 ***********98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (749 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 46.56 // Query: UCS20154.1|CBM21 [L=682] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-31 92.7 10.4 9.7e-31 92.7 10.4 2.2 2 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.7 10.4 9.7e-31 9.7e-31 3 107 .] 178 297 .. 176 297 .. 0.94 2 ? -3.4 0.2 0.77 0.77 80 101 .. 344 365 .. 327 368 .. 0.51 Alignments for each domain: == domain 1 score: 92.7 bits; conditional E-value: 9.7e-31 CBM21.hmm 3 skvvleslslsadkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYvksssesaetDrFkfkiklaelk................... 76 s+++l++l+ +++++l+G+++V+nl+feK ++v+++++nwk++++++a+Y+ks+++ ++D+F+f+i++ + k UCS20154.1|CBM21 178 SNIKLHNLQ--KKTNKLKGLIYVNNLNFEKFIEVKFSFNNWKDIHYATATYNKSITD--HIDEFRFTIDVMTFKyilkskgliycdsysnedc 266 678899998..999*******************************************..8************999999999999999888777 PP CBM21.hmm 77 aseekklefcirYevngeeywdnnngkNYkv 107 + ++ ++++c+rY+vn+e+y+dnnn+kNY++ UCS20154.1|CBM21 267 TYCDLSMDLCCRYDVNNETYYDNNNYKNYHI 297 7777*************************97 PP == domain 2 score: -3.4 bits; conditional E-value: 0.77 CBM21.hmm 80 ekklefcirYevngeeywdnnn 101 + + +f + +++ ++ nn+ UCS20154.1|CBM21 344 SFQTDFLTTTTLSHNLFFHNNS 365 2233333333444466666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (682 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 109.92 // Query: UCS36629.1|CBM21 [L=915] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-30 91.7 7.9 2.1e-30 91.7 7.9 2.1 2 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.0 0.32 0.32 19 75 .. 54 129 .. 43 142 .. 0.55 2 ! 91.7 7.9 2.1e-30 2.1e-30 9 106 .. 287 396 .. 280 397 .. 0.91 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.32 CBM21.hmm 19 lvGtvkVknlafeKkvtvrytldnwktvseveaeYvksssesa...................etDrFkfkiklael 75 l++ kn+ f ++t ++d+ ++ +++ e ++++++ + ++D F+ + +l+ l UCS36629.1|CBM21 54 LSTASSLKNVRFATNLTTVKSFDSNSEPISISHENSPTLKPLResessnvsstslnnvlylsDYDDFTKHQDLNFL 129 5555566777777777777777766665555554444444433444444445555555566666666666655555 PP == domain 2 score: 91.7 bits; conditional E-value: 2.1e-30 CBM21.hmm 9 slsls.adkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYvksssesaetDrFkfkiklaelk.............aseekklefci 87 sl++ + + ++vG++ Vknl++eK ++v+yt++nw+++++++a ++ks+s+ e+D+F+fki+l++lk +++ ++e+c+ UCS36629.1|CBM21 287 SLAQDsTIDDKIVGKILVKNLNYEKFIEVKYTFNNWNDIHYITAYFTKSISA--EIDEFEFKINLSSLKyilqfkrilqfksNDTYLNMELCC 377 44433366789****************************************9..8*************99******99998888889****** PP CBM21.hmm 88 rYevngeeywdnnngkNYk 106 rY+vnge+y+dnnn++NY+ UCS36629.1|CBM21 378 RYDVNGETYYDNNNYRNYN 396 ******************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (915 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 104.96 // Query: AAS54765.1|CBM21 [L=679] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-31 95.1 5.3 3.2e-31 94.3 5.3 1.5 1 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.3 5.3 3.2e-31 3.2e-31 3 106 .. 271 388 .. 269 389 .. 0.94 Alignments for each domain: == domain 1 score: 94.3 bits; conditional E-value: 3.2e-31 CBM21.hmm 3 skvvleslslsadkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYvksssesaetDrFkfkiklaelk.................as 78 +++ l+++s +d ++++G+++V+nl+feK ++v++++d+wk++++v+a+Y k++++ ++D+F+f i+l++ k + AAS54765.1|CBM21 271 HNIRLNKVS-LVDMHTIKGSLYVTNLHFEKFIEVKFSFDEWKNIHYVTAQYLKTVTS--KVDEFQFIIDLSSYKyfmkvknllycvpgareTW 360 789999999.6999******************************************9..7************999999999999988888777 PP CBM21.hmm 79 eekklefcirYevngeeywdnnngkNYk 106 + ++++c+rY+vnge+y+dnnn++NY+ AAS54765.1|CBM21 361 CPVTMSLCCRYDVNGETYYDNNNYENYQ 388 88*************************8 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (679 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 108.63 // Query: UCS26170.1|CBM21 [L=915] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-30 91.7 7.9 2.1e-30 91.7 7.9 2.1 2 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.0 0.32 0.32 19 75 .. 54 129 .. 43 142 .. 0.55 2 ! 91.7 7.9 2.1e-30 2.1e-30 9 106 .. 287 396 .. 280 397 .. 0.91 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.32 CBM21.hmm 19 lvGtvkVknlafeKkvtvrytldnwktvseveaeYvksssesa...................etDrFkfkiklael 75 l++ kn+ f ++t ++d+ ++ +++ e ++++++ + ++D F+ + +l+ l UCS26170.1|CBM21 54 LSTASSLKNVRFATNLTTVKSFDSNSEPISISHENSPTLKPLResessnvsstslnnvlylsDYDDFTKHQDLNFL 129 5555566777777777777777766665555554444444433444444445555555566666666666655555 PP == domain 2 score: 91.7 bits; conditional E-value: 2.1e-30 CBM21.hmm 9 slsls.adkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYvksssesaetDrFkfkiklaelk.............aseekklefci 87 sl++ + + ++vG++ Vknl++eK ++v+yt++nw+++++++a ++ks+s+ e+D+F+fki+l++lk +++ ++e+c+ UCS26170.1|CBM21 287 SLAQDsTIDDKIVGKILVKNLNYEKFIEVKYTFNNWNDIHYITAYFTKSISA--EIDEFEFKINLSSLKyilqfkrilqfksNDTYLNMELCC 377 44433366789****************************************9..8*************99******99998888889****** PP CBM21.hmm 88 rYevngeeywdnnngkNYk 106 rY+vnge+y+dnnn++NY+ UCS26170.1|CBM21 378 RYDVNGETYYDNNNYRNYN 396 ******************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (915 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 108.99 // Query: UCS30615.1|CBM21 [L=682] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.7e-31 92.7 10.4 9.7e-31 92.7 10.4 2.2 2 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.7 10.4 9.7e-31 9.7e-31 3 107 .] 178 297 .. 176 297 .. 0.94 2 ? -3.4 0.2 0.77 0.77 80 101 .. 344 365 .. 327 368 .. 0.51 Alignments for each domain: == domain 1 score: 92.7 bits; conditional E-value: 9.7e-31 CBM21.hmm 3 skvvleslslsadkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYvksssesaetDrFkfkiklaelk................... 76 s+++l++l+ +++++l+G+++V+nl+feK ++v+++++nwk++++++a+Y+ks+++ ++D+F+f+i++ + k UCS30615.1|CBM21 178 SNIKLHNLQ--KKTNKLKGLIYVNNLNFEKFIEVKFSFNNWKDIHYATATYNKSITD--HIDEFRFTIDVMTFKyilkskgliycdsysnedc 266 678899998..999*******************************************..8************999999999999999888777 PP CBM21.hmm 77 aseekklefcirYevngeeywdnnngkNYkv 107 + ++ ++++c+rY+vn+e+y+dnnn+kNY++ UCS30615.1|CBM21 267 TYCDLSMDLCCRYDVNNETYYDNNNYKNYHI 297 7777*************************97 PP == domain 2 score: -3.4 bits; conditional E-value: 0.77 CBM21.hmm 80 ekklefcirYevngeeywdnnn 101 + + +f + +++ ++ nn+ UCS30615.1|CBM21 344 SFQTDFLTTTTLSHNLFFHNNS 365 2233333333444466666665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (682 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 102.40 // Query: 2670|Zygro1_GeneCatalog_proteins_20150128.aa.fasta|CBM21 [L=661] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.5e-32 96.0 3.9 2.4e-31 94.7 3.9 1.7 1 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.7 3.9 2.4e-31 2.4e-31 3 107 .] 232 352 .. 230 352 .. 0.91 Alignments for each domain: == domain 1 score: 94.7 bits; conditional E-value: 2.4e-31 CBM21.hmm 3 skvvleslsls.adkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYv 54 s++ l+sl+++ ++ ++ G+++V+nl+feK +++++t++nwk++++v+a+Y+ 2670|Zygro1_GeneCatalog_proteins_20150128.aa.fasta|CBM21 232 SNIRLHSLEQInNEFGKVLGLIYVNNLNFEKFIEIKLTFNNWKDIHYVTATYH 284 67888888876467789************************************ PP CBM21.hmm 55 ksssesaetDrFkfkiklaelk.................aseekklefcirYe 90 +s+++ + D+Fkf i+l+ lk + + ++++c+rY+ 2670|Zygro1_GeneCatalog_proteins_20150128.aa.fasta|CBM21 285 RSITD--KLDEFKFVIDLNVLKyslqmrnllyynpalttTLCPLDVNLCCRYD 335 *****..7************99888888888888887777777********** PP CBM21.hmm 91 vngeeywdnnngkNYkv 107 vnge+++dnnn++NY++ 2670|Zygro1_GeneCatalog_proteins_20150128.aa.fasta|CBM21 336 VNGETFYDNNNYENYQM 352 ***************95 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (661 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 113.49 // Query: 4428|Torde1_GeneCatalog_proteins_20150128.aa.fasta|CBM21 [L=670] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-32 96.0 5.9 2.3e-31 94.8 5.9 1.7 1 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 94.8 5.9 2.3e-31 2.3e-31 3 107 .] 249 369 .. 247 369 .. 0.92 Alignments for each domain: == domain 1 score: 94.8 bits; conditional E-value: 2.3e-31 CBM21.hmm 3 skvvleslsls.adkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYv 54 s++ l+ l++s ++ ++vG+++V+nl+feK +++++t+++wk++++++a+Y+ 4428|Torde1_GeneCatalog_proteins_20150128.aa.fasta|CBM21 249 SNIRLHTLKQSkSEFGKIVGLIYVNNLNFEKFIEIKLTFNSWKDIHYITANYS 301 68899999987566689************************************ PP CBM21.hmm 55 ksssesaetDrFkfkiklaelk.................aseekklefcirYe 90 +s+++ ++D+Fkf i+l++lk + + ++++c+rY+ 4428|Torde1_GeneCatalog_proteins_20150128.aa.fasta|CBM21 302 RSVTK--KIDEFKFVIDLNSLKyalqvksliyaksnaetTLCPLNIDLCCRYD 352 ****9..7*************9999999999988777666667********** PP CBM21.hmm 91 vngeeywdnnngkNYkv 107 vn+e+++dnnn+ NY+v 4428|Torde1_GeneCatalog_proteins_20150128.aa.fasta|CBM21 353 VNNETFYDNNNYDNYQV 369 ***************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (670 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 113.13 // Query: UCS20939.1|CBM21 [L=915] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-30 91.7 7.9 2.1e-30 91.7 7.9 2.1 2 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.0 0.32 0.32 19 75 .. 54 129 .. 43 142 .. 0.55 2 ! 91.7 7.9 2.1e-30 2.1e-30 9 106 .. 287 396 .. 280 397 .. 0.91 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.32 CBM21.hmm 19 lvGtvkVknlafeKkvtvrytldnwktvseveaeYvksssesa...................etDrFkfkiklael 75 l++ kn+ f ++t ++d+ ++ +++ e ++++++ + ++D F+ + +l+ l UCS20939.1|CBM21 54 LSTASSLKNVRFATNLTTVKSFDSNSEPISISHENSPTLKPLResessnvsstslnnvlylsDYDDFTKHQDLNFL 129 5555566777777777777777766665555554444444433444444445555555566666666666655555 PP == domain 2 score: 91.7 bits; conditional E-value: 2.1e-30 CBM21.hmm 9 slsls.adkkvlvGtvkVknlafeKkvtvrytldnwktvseveaeYvksssesaetDrFkfkiklaelk.............aseekklefci 87 sl++ + + ++vG++ Vknl++eK ++v+yt++nw+++++++a ++ks+s+ e+D+F+fki+l++lk +++ ++e+c+ UCS20939.1|CBM21 287 SLAQDsTIDDKIVGKILVKNLNYEKFIEVKYTFNNWNDIHYITAYFTKSISA--EIDEFEFKINLSSLKyilqfkrilqfksNDTYLNMELCC 377 44433366789****************************************9..8*************99******99998888889****** PP CBM21.hmm 88 rYevngeeywdnnngkNYk 106 rY+vnge+y+dnnn++NY+ UCS20939.1|CBM21 378 RYDVNGETYYDNNNYRNYN 396 ******************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (915 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 113.05 // [ok]