# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM21/fasta_for_each_cluster/cluster_52.txt # target HMM database: merged_hmms/CBM21.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM21/CBM21_cluster_52.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 442683|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|GH15 [L=679] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-27 82.3 0.7 1.4e-16 47.2 0.1 2.4 2 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.3 0.0 2.9e-12 2.9e-12 4 75 .. 42 113 .. 39 122 .. 0.88 2 ! 47.2 0.1 1.4e-16 1.4e-16 5 107 .] 160 256 .. 156 256 .. 0.84 Alignments for each domain: == domain 1 score: 33.3 bits; conditional E-value: 2.9e-12 CBM21.hmm 4 kvvleslslsadkkvlvGtvkVknlafeKkvtvryt..ldnwktv 46 +vvl+ +s +d+++++G++ Vknlaf+K v+v y+ + +w+ 442683|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|GH15 42 EVVLQTYSFDSDNNQFTGSIWVKNLAFNKVVQVFYStpTVQWSPS 86 799********************************955679**** PP CBM21.hmm 47 seveaeYvksssesaetDrFkfkiklael 75 + v+a Y++s+ + ++ ++f+ a+l 442683|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|GH15 87 QFVNAAYSRSAAN--GYEVWSFNAAPASL 113 *********9999..6******9876665 PP == domain 2 score: 47.2 bits; conditional E-value: 1.4e-16 CBM21.hmm 5 vvleslslsadkkvlvGtvkVknlafeKkvtvrytldnwk..tvs 47 v++++++ +l+G + +kn+af+K v+v +++ + + + 442683|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|GH15 160 VQVQQYT--LVGGTLSGGLWIKNIAFNKIVNVIASTPSGSfvNAP 202 5566666..567799*******************97665511556 PP CBM21.hmm 48 eveaeYvksssesaetDrFkfkiklaelkaseekklefcirYevn 92 ++a+Y +++ + ++ ++f+ +++ ++ +f+++Ye+ 442683|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|GH15 203 TASASYFSTAAN--GYELWTFSGGVPNV----DNGSQFYVKYETG 241 677799999998..7**********997....67789******** PP CBM21.hmm 93 geeywdnnngkNYkv 107 ++++dnnn+kNY + 442683|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|GH15 242 TQTFYDNNNSKNYVI 256 *************86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (679 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.66 // Query: 625423|Clapol1_1_GeneCatalog_proteins_20180327.aa.fasta|CBM21|GH15 [L=614] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-16 47.1 3.3 3.2e-16 46.1 3.3 1.6 1 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.1 3.3 3.2e-16 3.2e-16 5 107 .] 34 130 .. 30 130 .. 0.84 Alignments for each domain: == domain 1 score: 46.1 bits; conditional E-value: 3.2e-16 CBM21.hmm 5 vvleslslsadkkvlvGtvkVknlafeKkvtvrytldnwktvs 47 v++ s+s +d k+l+G++k n+a++K+v v y+ + + 625423|Clapol1_1_GeneCatalog_proteins_20180327.aa.fasta|CBM21|GH15 34 VKVTSYS--YDGKTLSGNIKLLNIAYQKTVYVNYADLSQNWAY 74 5566666..99***********************955555567 PP CBM21.hmm 48 eveaeYvksssesaetDrFkfkiklaelkaseekklefcirYe 90 +++a+Y++ ++ ++++ ++f+ ++ + +f+++Y+ 625423|Clapol1_1_GeneCatalog_proteins_20180327.aa.fasta|CBM21|GH15 75 SCSASYSNGPDS-TNYEYWTFSCSIGSA-----GISQFYVEYD 111 788999886555.6**********9997.....789******* PP CBM21.hmm 91 vngeeywdnnng..kNYkv 107 v+g++y+dnn g NY+v 625423|Clapol1_1_GeneCatalog_proteins_20180327.aa.fasta|CBM21|GH15 112 VAGTKYYDNNGGygVNYQV 130 **********862268986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (614 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.11 // Query: 493477|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 [L=723] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-24 72.4 0.0 9.8e-14 38.1 0.0 2.3 2 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.1 0.0 7e-12 7e-12 4 94 .. 43 129 .. 40 136 .. 0.87 2 ! 38.1 0.0 9.8e-14 9.8e-14 15 105 .. 190 277 .. 179 279 .. 0.85 Alignments for each domain: == domain 1 score: 32.1 bits; conditional E-value: 7e-12 CBM21.hmm 4 kvvleslslsadkkvlvGtvkVknlafeKkvtvryt..ld 41 +vvl+++s a++ v++G++ ++n+af+K v++ y+ 493477|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 43 NVVLQQYSYDAETGVFSGSIWIRNIAFNKVVNLFYStpAL 82 89**********************************4445 PP CBM21.hmm 42 nwktvseveaeYvksssesaetDrFkfkiklaelkaseek 81 w+t ++v+a Y+ +++ ++ ++f+ + a l + 493477|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 83 AWNTANKVDAAYSGPATN--GFEVWSFSSSPAAL----AA 116 8*************9999..7*******998887....57 PP CBM21.hmm 82 klefcirYevnge 94 +f+++Y+ n++ 493477|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 117 GSQFYLKYTGNHR 129 7789999987763 PP == domain 2 score: 38.1 bits; conditional E-value: 9.8e-14 CBM21.hmm 15 dkkvlvGtvkVknlafeKkvtvryt.ldnwktvseveaeY 53 l+G v Vknlaf K+vt+ ++ + + +++a+Y 493477|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 190 IGGALSGGVWVKNLAFSKAVTIIASsASGVFEGASTTATY 229 566899****************99846778899999**** PP CBM21.hmm 54 vksssesaetDrFkfkiklaelkaseekklefcirYevng 93 ++s+ + ++ ++f ++++ ++ +f+++Y+vng 493477|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 230 SSSAAN--GYELWTFLGSFPNA----GTGSKFYVKYDVNG 263 **9999..7*******999987....88899********* PP CBM21.hmm 94 eeywdnnng..kNY 105 +y+d+n g kNY 493477|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 264 VSYYDSNGGpdKNY 277 *******9744677 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (723 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 89.35 // Query: 489056|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 [L=707] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-35 107.1 0.1 5e-22 64.7 0.5 2.3 2 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.7 0.5 5e-22 5e-22 4 107 .] 43 142 .. 40 142 .. 0.94 2 ! 39.8 0.0 2.7e-14 2.7e-14 14 105 .. 183 271 .. 173 273 .. 0.83 Alignments for each domain: == domain 1 score: 64.7 bits; conditional E-value: 5e-22 CBM21.hmm 4 kvvleslslsadkkvlvGtvkVknlafeKkvtvryt..ld 41 +vvl+++s ad ++G++ Vknlaf+K v+v y+ 489056|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 43 NVVLQQFSYDADIGLFTGSIWVKNLAFNKVVSVFYStpAT 82 79*********************************96678 PP CBM21.hmm 42 nwktvseveaeYvksssesaetDrFkfkiklaelkaseek 81 +w+t ++v+a Y+ ss+ ++ ++f+ + +l + 489056|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 83 TWNTANKVDAAYSGPSSN--GYEIWSFTATPGSL----GV 116 9*************9999..7*******998887....99 PP CBM21.hmm 82 klefcirYevngeeywdnnngkNYkv 107 + +f+++Y+v+g++y+dnn ++NY + 489056|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 117 NSQFYLKYTVSGQNYYDNNGSRNYLI 142 ************************75 PP == domain 2 score: 39.8 bits; conditional E-value: 2.7e-14 CBM21.hmm 14 adkkvlvGtvkVknlafeKkvtvrytldn.wktvseveae 52 +l+G v Vkn+af K+v++ ++ + + ++ a+ 489056|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 183 FIGGSLSGGVWVKNIAFSKSVNIIASSTSgAFEGASTAAS 222 456789*****************9986550567788889* PP CBM21.hmm 53 YvksssesaetDrFkfkiklaelkaseekklefcirYevn 92 Y++s+ + ++ ++f+ +l++ + +f+++Y+vn 489056|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 223 YSSSAAN--GYELWTFSGSLPNV----GGGSKFYVKYDVN 256 **99999..7***********98....88899******** PP CBM21.hmm 93 geeywdnnng..kNY 105 g +y+d+n g +NY 489056|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 257 GVSYYDSNGGpdRNY 271 ********9744677 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (707 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 103.90 // Query: 958266|Clapol1_1_GeneCatalog_proteins_20180327.aa.fasta|CBM21|GH15 [L=628] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-16 47.3 1.8 2.6e-16 46.3 1.8 1.5 1 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.3 1.8 2.6e-16 2.6e-16 5 107 .] 30 126 .. 26 126 .. 0.86 Alignments for each domain: == domain 1 score: 46.3 bits; conditional E-value: 2.6e-16 CBM21.hmm 5 vvleslslsadkkvlvGtvkVknlafeKkvtvrytldnwktvs 47 v++ s++ +d +l+G++k n+a++K+v+v y+ k 958266|Clapol1_1_GeneCatalog_proteins_20180327.aa.fasta|CBM21|GH15 30 VKVTSYA--YDGAKLTGNIKLSNIAYQKSVAVNYADLAQKWGY 70 5555555..8999*********************977777789 PP CBM21.hmm 48 eveaeYvksssesaetDrFkfkiklaelkaseekklefcirYe 90 +++a+Y++ ++ ++++ ++f+ ++ + +f+++Y+ 958266|Clapol1_1_GeneCatalog_proteins_20180327.aa.fasta|CBM21|GH15 71 SCPASYNNGPDS-TNYEYWTFSCSIGSA-----GISQFYVQYN 107 99****986665.6**********9997.....789******* PP CBM21.hmm 91 vngeeywdnnng..kNYkv 107 v+g++y+dnn g NY+v 958266|Clapol1_1_GeneCatalog_proteins_20180327.aa.fasta|CBM21|GH15 108 VSGTSYYDNNGGygVNYQV 126 **********862268986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (628 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.66 // Query: 418737|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|GH15 [L=766] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-10 25.7 1.9 2e-08 21.0 1.9 2.6 1 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.0 1.9 2e-08 2e-08 8 106 .. 226 308 .. 219 309 .. 0.82 Alignments for each domain: == domain 1 score: 21.0 bits; conditional E-value: 2e-08 CBM21.hmm 8 eslslsadkkvlvGtvkVknlafeKkvtvryt..ldnwktvseve 50 +++ ++ +v+ G +k knl f K+v v + +w+ ++ ++ 418737|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|GH15 226 GNYQ--YRGNVFYGEIKLKNLGFTKTVDVNWQdkNGTWAATNTCK 268 4555..78899********************854557******** PP CBM21.hmm 51 aeYvksssesaetDrFkfkiklaelkaseekklefcirYevngee 95 a+Y + ++s +++ +kf+ +++ ++g+e 418737|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|GH15 269 AVYGSGPYQS-NFEVWKFTCTVPAS---------------ASGTE 297 ****998886.**********9986...............56777 PP CBM21.hmm 96 ywdnnngkNYk 106 y+d+n g NY 418737|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|GH15 298 YYDSNGGGNYP 308 77777777775 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (766 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 53.31 // Query: 153677|Ganpr1_GeneCatalog_proteins_20111215.aa.fasta|CBM21|GH15 [L=624] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-14 39.4 4.3 1e-13 38.0 4.3 1.7 1 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.0 4.3 1e-13 1e-13 17 107 .] 38 124 .. 27 124 .. 0.82 Alignments for each domain: == domain 1 score: 38.0 bits; conditional E-value: 1e-13 CBM21.hmm 17 kvlvGtvkVknlafeKkvtvrytldnwktvseveaeYvksssesae 62 +vl G++ V n a+ K+vtv y+ + + a+Y++ ++sa+ 153677|Ganpr1_GeneCatalog_proteins_20111215.aa.fasta|CBM21|GH15 38 NVLYGNITVYNYAYTKTVTVNYADLASSWSYTCAASYSSG-PNSAN 82 789*******************844444455567788775.5557* PP CBM21.hmm 63 tDrFkfkiklaelkaseekklefcirYevngeeywdnnng..kNYk 106 ++ + f+ ++ + +f+i+Y +ng++y+dnn g NYk 153677|Ganpr1_GeneCatalog_proteins_20111215.aa.fasta|CBM21|GH15 83 YEFWVFSCNVGSA-----GVSQFYISYVTNGNTYYDNNGGygVNYK 123 *********9987.....789*****************86226887 PP CBM21.hmm 107 v 107 v 153677|Ganpr1_GeneCatalog_proteins_20111215.aa.fasta|CBM21|GH15 124 V 124 6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (624 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.63 // Query: 490945|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 [L=759] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-32 98.5 0.0 6.3e-20 58.0 0.2 2.3 2 CBM21.hmm Domain annotation for each model (and alignments): >> CBM21.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.0 0.2 6.3e-20 6.3e-20 4 107 .] 43 143 .. 40 143 .. 0.94 2 ! 38.2 0.0 8.6e-14 8.6e-14 4 106 .. 196 294 .. 193 295 .. 0.87 Alignments for each domain: == domain 1 score: 58.0 bits; conditional E-value: 6.3e-20 CBM21.hmm 4 kvvleslslsadkkvlvGtvkVknlafeKkvtvryt..ld 41 +vvl+s+s +++ ++G++ ++nlaf K+v+v y+ + 490945|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 43 NVVLQSFSYDSESGLFSGNIWIRNLAFAKTVEVFYStpTG 82 89*********************************96678 PP CBM21.hmm 42 nwktvseveaeYvksssesaetDrFkfkiklaelkaseek 81 +w +++v+a Y+ + + +++ ++f+ + + + ++ 490945|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 83 QWVLTNKVNAAYSAPAAN--NFEVWSFNAPSPAN---LGA 117 9************99888..8*********9976...699 PP CBM21.hmm 82 klefcirYevngeeywdnnngkNYkv 107 +f+++Y v+g++++dnn +NY v 490945|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 118 GSQFYLKYVVAGQTFFDNNATRNYLV 143 99**********************76 PP == domain 2 score: 38.2 bits; conditional E-value: 8.6e-14 CBM21.hmm 4 kvvleslslsadkkvlvGtvkVknlafeKkvtvryt..ld 41 +v+++++s + vl+G + Vkn+af K vtv ++ l 490945|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 196 NVQVQQYS--FSGGVLAGGIFVKNIAFSKVVTVIASstLG 233 56677777..8899*******************9874467 PP CBM21.hmm 42 nwktvseveaeYvksssesaetDrFkfkiklaelkaseek 81 + + a+Y+ + + ++ + f+ l+ ++ 490945|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 234 IFDNAATTAATYSGPAAN--GYELWVFSAALPGV----GS 267 889999999****99998..7***********87....88 PP CBM21.hmm 82 klefcirYevngeeywdnnng..kNYk 106 +f++++++ng++++d+n g +NY 490945|Chylag1_GeneCatalog_proteins_20170110.aa.fasta|CBM21|CBM21|GH15 268 GSQFYVKFDANGQSFFDSNGGigRNYP 294 99*****************85338885 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (759 residues searched) Target model(s): 1 (107 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.86 // [ok]