# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM20/fasta_for_each_cluster/cluster_63.txt # target HMM database: merged_hmms/CBM20.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM20/CBM20_cluster_63.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: UTT38856.1|CBM20|GH13_32 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-33 100.1 1.0 6.2e-33 99.2 0.2 1.9 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.43 0.43 44 79 .. 375 410 .. 365 415 .. 0.67 2 ! 99.2 0.2 6.2e-33 6.2e-33 3 88 .. 498 582 .. 496 584 .. 0.96 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.43 CBM20.hmm 44 lWtvtvelpe.gttieYkyvkkdadgeevewesgenr 79 Wt + +e ++ + + +++da+ + +w+ g n+ UTT38856.1|CBM20|GH13_32 375 AWTCEQRQDEiTGMVGFNNAVGDAAVS-NWWDDGGNQ 410 566666666633566677777777644.688887776 PP == domain 2 score: 99.2 bits; conditional E-value: 6.2e-33 CBM20.hmm 3 vtFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpasg 87 v++ v+a+t g+++ +vG+ pelg+Wdpaka +l+ ++yp W++tv+lp+gt++eYkyvk+d++g+ +wesg+nr t++a+g UTT38856.1|CBM20|GH13_32 498 VRVAVTAQTVMGQNIRIVGNQPELGRWDPAKAPQLSAASYPSWSGTVDLPAGTQFEYKYVKYDQSGN-ATWESGANRIATVNADG 581 89999************************************************************99.************99987 PP CBM20.hmm 88 t 88 + UTT38856.1|CBM20|GH13_32 582 S 582 5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 55.83 // Query: UCN16558.1|CBM20|GH13_32 [L=614] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-34 102.5 2.1 6.2e-34 102.4 0.6 1.9 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.6 0.0 0.72 0.72 10 22 .. 85 97 .. 84 103 .. 0.80 2 ! 102.4 0.6 6.2e-34 6.2e-34 2 88 .. 521 605 .. 520 607 .. 0.96 Alignments for each domain: == domain 1 score: -3.6 bits; conditional E-value: 0.72 CBM20.hmm 10 ttqpgeelyvvGs 22 +t+p +e +vvG UCN16558.1|CBM20|GH13_32 85 QTSPPQEHAVVGG 97 7889999999986 PP == domain 2 score: 102.4 bits; conditional E-value: 6.2e-34 CBM20.hmm 2 kvtFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpas 86 +v F v+att +g+ lyvvG++++lg Wdpa+av+l+ ++yp+W++tv+lp gt ++Ykyv+k+ + +v+wesg+nrtlt+pas UCN16558.1|CBM20|GH13_32 521 QVAFGVTATTVWGQDLYVVGDHAALGGWDPARAVPLSSTTYPVWRATVTLPPGTAVQYKYVRKQGA--TVTWESGANRTLTVPAS 603 699*************************************************************94..5***************9 PP CBM20.hmm 87 gt 88 gt UCN16558.1|CBM20|GH13_32 604 GT 605 97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (614 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 106.27 // Query: WVS80264.1|CBM20|CBM25|GH13_32 [L=687] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-31 93.0 0.0 1.5e-30 91.6 0.0 1.8 1 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 91.6 0.0 1.5e-30 1.5e-30 4 89 .. 595 679 .. 593 680 .. 0.97 Alignments for each domain: == domain 1 score: 91.6 bits; conditional E-value: 1.5e-30 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 +F v+att pg+++ vvG++++lg W pa a++l ++yp+W+ +v+lp+gt++ Yky++kda+g+ v+wesg++rt t WVS80264.1|CBM20|CBM25|GH13_32 595 SFAVTATTVPGQTIHVVGDHAALGGWAPAAALKLDAAAYPVWKLDVKLPAGTSFAYKYIRKDASGN-VTWESGADRTAT 672 79**************************************************************99.************ PP CBM20.hmm 83 tpasgts 89 +pa+gt WVS80264.1|CBM20|CBM25|GH13_32 673 VPADGTV 679 ***9975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (687 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 118.46 // Query: XXH96104.1|CBM20|GH13_32 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-33 99.5 2.2 5.2e-33 99.4 0.5 1.9 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.45 0.45 44 79 .. 375 410 .. 366 415 .. 0.67 2 ! 99.4 0.5 5.2e-33 5.2e-33 3 87 .. 498 581 .. 496 584 .. 0.96 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.45 CBM20.hmm 44 lWtvtvelpe.gttieYkyvkkdadgeevewesgenr 79 Wt + +e ++ + + +++da+ + +w+ g n+ XXH96104.1|CBM20|GH13_32 375 AWTCEQRQDEiTGMVGFNNAVGDAAVS-NWWDDGGNQ 410 566666666633566677777777644.688887776 PP == domain 2 score: 99.4 bits; conditional E-value: 5.2e-33 CBM20.hmm 3 vtFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpasg 87 v+++v+a+t +g+++ +vG+ pelg+Wdpaka +l+ ++yp W++tv+lp+gt++eYkyvk+d++g+ +wesg+nr ++a+g XXH96104.1|CBM20|GH13_32 498 VSVEVTAQTVWGQNIRIVGNQPELGSWDPAKAPQLSAASYPSWSGTVDLPAGTQFEYKYVKYDQSGN-ATWESGANRIAAVNADG 581 78899************************************************************99.**********9999877 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.21 // Query: WAL76329.1|CBM20|CBM25|GH13_32 [L=658] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-32 97.5 0.2 2.1e-32 97.5 0.2 2.7 3 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.9 0.0 0.22 0.22 21 40 .. 243 266 .. 240 276 .. 0.60 2 ? -1.8 0.1 0.2 0.2 25 39 .. 471 485 .. 460 524 .. 0.75 3 ! 97.5 0.2 2.1e-32 2.1e-32 4 88 .. 566 649 .. 563 651 .. 0.97 Alignments for each domain: == domain 1 score: -1.9 bits; conditional E-value: 0.22 CBM20.hmm 21 Gsipe...lgnWdp.akavaltts 40 Gs+++ + nWd+ ++ +l+++ WAL76329.1|CBM20|CBM25|GH13_32 243 GSAQArtfVDNWDTeRNGSTLNYK 266 555555556788875555666653 PP == domain 2 score: -1.8 bits; conditional E-value: 0.2 CBM20.hmm 25 elgnWdpakavaltt 39 + g+W +a +va+ WAL76329.1|CBM20|CBM25|GH13_32 471 NGGSWTTAPGVAMDA 485 558888888888876 PP == domain 3 score: 97.5 bits; conditional E-value: 2.1e-32 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 +F vnatt+ g+++yvvG+++elg Wd++ka+ l+ ++yp+W+ +v l++gt i+Ykyv+kda+g+ v+wesg+nrt t WAL76329.1|CBM20|CBM25|GH13_32 566 SFAVNATTTVGQNIYVVGDAAELGGWDTSKALLLSSAAYPVWKLDVALNAGTAIQYKYVRKDAAGN-VTWESGANRTAT 643 7***************************************************************99.************ PP CBM20.hmm 83 tpasgt 88 +pasg+ WAL76329.1|CBM20|CBM25|GH13_32 644 VPASGE 649 ***986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (658 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 111.70 // Query: WGP08200.1|CBM20|CBM25|GH13_32 [L=687] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-34 103.4 0.0 8.5e-34 102.0 0.0 1.8 1 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 102.0 0.0 8.5e-34 8.5e-34 4 88 .. 595 678 .. 592 680 .. 0.97 Alignments for each domain: == domain 1 score: 102.0 bits; conditional E-value: 8.5e-34 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 +F+v+att+pg+++yvvG+ip+lg+W p a++l +++yp+W+ +++lp+gt ++Yky++kda+g+ v+wesg+nrt WGP08200.1|CBM20|CBM25|GH13_32 595 SFSVKATTAPGQNIYVVGNIPALGSWTPGAALKLDPASYPVWKLDLKLPAGTAFTYKYIRKDAAGN-VTWESGANRTAA 672 7***************************************************************99.************ PP CBM20.hmm 83 tpasgt 88 +p++gt WGP08200.1|CBM20|CBM25|GH13_32 673 VPTEGT 678 **9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (687 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 138.28 // Query: XOJ23190.1|CBM20|CBM25|GH13_32 [L=728] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-34 103.9 0.4 6.8e-34 102.3 0.4 1.9 1 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 102.3 0.4 6.8e-34 6.8e-34 4 88 .. 636 719 .. 634 721 .. 0.96 Alignments for each domain: == domain 1 score: 102.3 bits; conditional E-value: 6.8e-34 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 +F+v+att++g+++ vvGsip+lg+W pa++v+l+ s+yp+Wt+ v+lp+gtt++Ykyvk+d +g+ v+wesg nrt t XOJ23190.1|CBM20|CBM25|GH13_32 636 SFSVTATTTWGQTVHVVGSIPALGSWAPANGVPLSSSAYPVWTARVDLPAGTTFQYKYVKRDGGGN-VVWESGGNRTAT 713 7**************************************************************988.************ PP CBM20.hmm 83 tpasgt 88 + a+g+ XOJ23190.1|CBM20|CBM25|GH13_32 714 VGADGS 719 999886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (728 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 139.04 // Query: XCH30773.1|CBM20|CBM25|GH13_32 [L=735] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-35 105.4 0.4 7.2e-35 105.4 0.4 2.0 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.0 0.1 1 1 71 80 .. 434 443 .. 427 449 .. 0.73 2 ! 105.4 0.4 7.2e-35 7.2e-35 4 88 .. 643 726 .. 641 728 .. 0.96 Alignments for each domain: == domain 1 score: -4.0 bits; conditional E-value: 1 CBM20.hmm 71 vewesgenrt 80 +w+ g+n++ XCH30773.1|CBM20|CBM25|GH13_32 434 NWWDDGNNHV 443 5788888886 PP == domain 2 score: 105.4 bits; conditional E-value: 7.2e-35 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 +F+v+att++g++++vvGsip+lg+W pa++val+ ++yp+Wt+t++lp+gtt+eYkyvk+d +g+ v+wesg nrt t XCH30773.1|CBM20|CBM25|GH13_32 643 SFSVTATTTWGQNVLVVGSIPALGSWAPANGVALSAAGYPVWTATLDLPAGTTFEYKYVKRDGGGN-VVWESGGNRTAT 720 7**************************************************************988.************ PP CBM20.hmm 83 tpasgt 88 + ++g+ XCH30773.1|CBM20|CBM25|GH13_32 721 VGQDGS 726 999886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (735 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 128.48 // Query: XNP17974.1|CBM20|GH13_32 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-33 100.8 2.1 2.3e-33 100.6 0.5 2.0 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.43 0.43 44 79 .. 375 410 .. 365 415 .. 0.67 2 ! 100.6 0.5 2.3e-33 2.3e-33 3 88 .. 498 582 .. 496 584 .. 0.96 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.43 CBM20.hmm 44 lWtvtvelpe.gttieYkyvkkdadgeevewesgenr 79 Wt + +e ++ + + +++da+ + +w+ g n+ XNP17974.1|CBM20|GH13_32 375 AWTCEQRQDEiTGMVGFNNAVGDAAVS-NWWDDGGNQ 410 566666666633566677777777644.688887776 PP == domain 2 score: 100.6 bits; conditional E-value: 2.3e-33 CBM20.hmm 3 vtFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpasg 87 v++ v+a+t +g+++ +vG+ pelg+Wdpaka +l+ ++yp W++tv+lp+gt++eYkyvk+d++g+ wesg+nr t++a+g XNP17974.1|CBM20|GH13_32 498 VSVAVTAQTVWGQNIRIVGNQPELGSWDPAKAPQLSAASYPSWSGTVDLPAGTQFEYKYVKYDQSGN-AKWESGANRIATVNADG 581 77889************************************************************99.************99987 PP CBM20.hmm 88 t 88 + XNP17974.1|CBM20|GH13_32 582 S 582 5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 101.67 // Query: XAO82548.1|CBM20|CBM25|GH13_32 [L=773] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-29 87.6 0.4 1.2e-28 85.5 0.4 2.1 1 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 85.5 0.4 1.2e-28 1.2e-28 4 88 .. 682 764 .. 681 766 .. 0.95 Alignments for each domain: == domain 1 score: 85.5 bits; conditional E-value: 1.2e-28 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 F v at++ g+++yvvG+i++lg+W p +avalt ++++Wt+tv lp+gtt++Yky+k+ +g v+wesg+nrt t XAO82548.1|CBM20|CBM25|GH13_32 682 AFGVAATVSAGQSVYVVGDIAALGAWAPGNAVALTA-NGSTWTGTVGLPAGTTFQYKYIKRTTAGA-VTWESGANRTAT 758 5999*******************************9.779***********************986.************ PP CBM20.hmm 83 tpasgt 88 + a+g+ XAO82548.1|CBM20|CBM25|GH13_32 759 VGANGS 764 *99986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (773 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 141.70 // Query: WIV43105.1|CBM20|GH13_32 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-33 101.5 0.7 1.2e-33 101.5 0.7 1.9 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.45 0.45 44 79 .. 375 410 .. 366 415 .. 0.67 2 ! 101.5 0.7 1.2e-33 1.2e-33 3 88 .. 498 582 .. 496 584 .. 0.96 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.45 CBM20.hmm 44 lWtvtvelpe.gttieYkyvkkdadgeevewesgenr 79 Wt + +e ++ + + +++da+ + +w+ g n+ WIV43105.1|CBM20|GH13_32 375 AWTCEQRQDEiTGMVGFNNAVGDAAVS-NWWDDGGNQ 410 566666666633566677777777644.688887776 PP == domain 2 score: 101.5 bits; conditional E-value: 1.2e-33 CBM20.hmm 3 vtFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpasg 87 v+++v+a+t +g+++ +vG+ pelg+Wdpaka +l+ ++yp W++tv+lp+gt++eYkyvk+d++g+ +wesg+nr t++a+g WIV43105.1|CBM20|GH13_32 498 VSVEVTAQTVWGQNIRIVGNQPELGSWDPAKAPQLSAASYPSWSGTVDLPAGTQFEYKYVKYDQSGN-ATWESGANRIATVNADG 581 78899************************************************************99.************99987 PP CBM20.hmm 88 t 88 + WIV43105.1|CBM20|GH13_32 582 S 582 5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 119.17 // Query: UUX58089.1|CBM20|GH13_32 [L=594] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-34 102.7 1.7 8.5e-34 102.0 0.2 2.0 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.4 0.1 0.15 0.15 42 80 .. 373 411 .. 363 418 .. 0.74 2 ! 102.0 0.2 8.5e-34 8.5e-34 3 87 .. 501 584 .. 499 587 .. 0.95 Alignments for each domain: == domain 1 score: -1.4 bits; conditional E-value: 0.15 CBM20.hmm 42 yplWtvtvelpe.gttieYkyvkkdadgeevewesgenrt 80 + Wt + +e ++ + + +++da+ + +w+ g+n+ UUX58089.1|CBM20|GH13_32 373 SSSWTCEQRQDEiTGMVGFNNAVGDAAVS-KWWDDGSNQI 411 56777777777744778888888888755.8999999976 PP == domain 2 score: 102.0 bits; conditional E-value: 8.5e-34 CBM20.hmm 3 vtFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpasg 87 v++ v+a+t+ g+++ +vG+ pelg+Wdpakav+l++++yp Wt+t +lp+gt++eYky+k+d++g +wesg+nrt t++a+g UUX58089.1|CBM20|GH13_32 501 VSVAVTAETTMGQNIRIVGNQPELGSWDPAKAVQLSPANYPSWTGTADLPAGTQFEYKYIKYDQGGH-AVWESGSNRTATVQADG 584 77889***********************************************************876.************99987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (594 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 112.90 // Query: BFF23373.1|CBM20|GH13_32 [L=599] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-27 80.7 0.2 7.9e-27 79.6 0.2 1.6 1 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.6 0.2 7.9e-27 7.9e-27 10 87 .. 512 588 .. 504 590 .. 0.95 Alignments for each domain: == domain 1 score: 79.6 bits; conditional E-value: 7.9e-27 CBM20.hmm 10 ttqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpasg 87 t+ g+e+y+vGsip+lgnW p + l+ ++yp+W++tv +p+gt+++Ykyv+++++g+ ++wes nr+ t+p++g BFF23373.1|CBM20|GH13_32 512 GTSVGDEVYIVGSIPQLGNWTPIASAHLSGTGYPYWKATVAVPAGTSFQYKYVIVRSNGS-LTWESIGNRSATVPSTG 588 699*******************999*********************************98.**************986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (599 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 128.90 // Query: UTT58490.1|CBM20|CBM25|GH13_32 [L=728] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-34 103.7 0.5 8.5e-34 102.0 0.5 2.0 1 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 102.0 0.5 8.5e-34 8.5e-34 4 88 .. 636 719 .. 634 721 .. 0.96 Alignments for each domain: == domain 1 score: 102.0 bits; conditional E-value: 8.5e-34 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 +F+v+att++g+++ vvGsip+lg+W pa++v+l+ s+yp+Wt+ v+lp+gtt++Ykyvk+d +g+ v+wesg nrt t UTT58490.1|CBM20|CBM25|GH13_32 636 SFSVTATTTWGQTVHVVGSIPALGSWAPANGVPLSSSAYPVWTARVDLPAGTTFQYKYVKRDGGGN-VVWESGGNRTAT 713 79*************************************************************988.************ PP CBM20.hmm 83 tpasgt 88 + a+g+ UTT58490.1|CBM20|CBM25|GH13_32 714 VGADGS 719 999886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (728 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.91 // Query: UVY84761.1|CBM20|GH13_32 [L=625] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-33 99.5 0.1 1.3e-32 98.1 0.1 1.7 1 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.1 0.1 1.3e-32 1.3e-32 3 88 .. 533 617 .. 532 619 .. 0.96 Alignments for each domain: == domain 1 score: 98.1 bits; conditional E-value: 1.3e-32 CBM20.hmm 3 vtFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpasg 87 v+++v+att++g+++ +vGs+p+lg+W+pa++val +++yp Wt++v+lp+gtt+eYkyvk+d++g +wesg+nrt t+ a+g UVY84761.1|CBM20|GH13_32 533 VSVSVQATTTFGQNVRIVGSVPALGSWKPASGVALDPAGYPAWTGSVDLPAGTTFEYKYVKVDDSGA-AVWESGANRTATVGADG 616 78899***********************************************************986.************99987 PP CBM20.hmm 88 t 88 + UVY84761.1|CBM20|GH13_32 617 K 617 5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (625 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 132.13 // Query: BFT27969.1|CBM20|CBM25|GH13_32 [L=671] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-33 98.9 4.5 8.6e-33 98.8 0.1 3.1 3 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.2 0.1 0.065 0.065 26 47 .. 295 317 .. 285 343 .. 0.83 2 ? -1.5 0.2 0.16 0.16 27 52 .. 498 523 .. 484 554 .. 0.66 3 ! 98.8 0.1 8.6e-33 8.6e-33 4 88 .. 579 662 .. 576 664 .. 0.97 Alignments for each domain: == domain 1 score: -0.2 bits; conditional E-value: 0.065 CBM20.hmm 26 lgnWdp.akavalttsdyplWtv 47 + nWd+ ++ +l++++++++t BFT27969.1|CBM20|CBM25|GH13_32 295 VDNWDTeRNGSTLNYKNGSTYTL 317 579***88889999999999986 PP == domain 2 score: -1.5 bits; conditional E-value: 0.16 CBM20.hmm 27 gnWdpakavalttsdyplWtvtvelp 52 g+W +a ++++ + + + tv+l BFT27969.1|CBM20|CBM25|GH13_32 498 GSWTTAPGIKMDSACTGWMKKTVDLG 523 78888888888774444334455554 PP == domain 3 score: 98.8 bits; conditional E-value: 8.6e-33 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 F vna+t+ g+++yv+G++++lg Wd++ka+ ++ ++yp+W+ +++lp+gt+++Yky++kda+g+ v+wesg+nrt t BFT27969.1|CBM20|CBM25|GH13_32 579 AFAVNASTTLGQNIYVAGDVAALGGWDTSKALLMSSASYPVWKLDLSLPAGTSFQYKYIRKDASGN-VTWESGANRTAT 656 69**************************************************************99.************ PP CBM20.hmm 83 tpasgt 88 +p+sg+ BFT27969.1|CBM20|CBM25|GH13_32 657 VPSSGE 662 ***986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (671 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 119.62 // Query: BFV59607.1|CBM20|CBM25|GH13_32 [L=687] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-34 103.2 1.7 9.2e-34 101.9 0.2 2.6 3 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.0 0.34 0.34 26 40 .. 298 313 .. 288 321 .. 0.58 2 ? -2.9 0.0 0.46 0.46 25 39 .. 509 523 .. 504 539 .. 0.78 3 ! 101.9 0.2 9.2e-34 9.2e-34 4 88 .. 595 678 .. 593 680 .. 0.96 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.34 CBM20.hmm 26 lgnWdp.akavaltts 40 + nWd+ ++ +l+++ BFV59607.1|CBM20|CBM25|GH13_32 298 VDNWDTeRNGSTLNYK 313 5677774444555553 PP == domain 2 score: -2.9 bits; conditional E-value: 0.46 CBM20.hmm 25 elgnWdpakavaltt 39 + g+W +a +v++ BFV59607.1|CBM20|CBM25|GH13_32 509 TGGSWTTAPGVTMDA 523 569999999999976 PP == domain 3 score: 101.9 bits; conditional E-value: 9.2e-34 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 +F vnatt+ g+++yvvG+ ++lg+Wdpa a+ l+ ++yp+W+ +v+lp+gt +eYkyv+kda+g v+wesg+nrt t BFV59607.1|CBM20|CBM25|GH13_32 595 SFAVNATTTTGQNIYVVGNNAALGAWDPAAALLLSSASYPVWKLDVTLPAGTAFEYKYVRKDAGGA-VTWESGANRTAT 672 79*************************************************************875.************ PP CBM20.hmm 83 tpasgt 88 +pasg+ BFV59607.1|CBM20|CBM25|GH13_32 673 VPASGK 678 ***997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (687 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 127.10 // Query: XPI93046.1|CBM20|CBM25|GH13_32 [L=729] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-30 91.0 1.6 2.8e-30 90.7 0.3 1.8 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 0.0 0.9 0.9 62 79 .. 416 432 .. 396 434 .. 0.59 2 ! 90.7 0.3 2.8e-30 2.8e-30 4 86 .. 638 719 .. 636 722 .. 0.95 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 0.9 CBM20.hmm 62 vkkdadgeevewesgenr 79 ++ + g + +w+ g n+ XPI93046.1|CBM20|CBM25|GH13_32 416 AVEGT-GVTSWWDDGGNH 432 44444.555788888887 PP == domain 2 score: 90.7 bits; conditional E-value: 2.8e-30 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 t++v+att++g+ + +vGs+pelg+W p+++v+l ++yp+Wt+tv+l+ gtt++Ykyvk++ +g+ v+wesg +rt t XPI93046.1|CBM20|CBM25|GH13_32 638 TVSVRATTTWGQDVRLVGSLPELGSWAPQQGVRLGADSYPTWTGTVDLAPGTTFTYKYVKVGGAGS-VVWESGGDRTAT 715 7789***********************************************************998.***********9 PP CBM20.hmm 83 tpas 86 + + XPI93046.1|CBM20|CBM25|GH13_32 716 VGPD 719 8765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (729 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 132.43 // Query: XCM79337.1|CBM20|CBM25|GH13_32 [L=680] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-30 91.8 0.7 6.6e-30 89.5 0.1 2.5 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.0 0.13 0.13 13 41 .. 287 317 .. 284 328 .. 0.65 2 ! 89.5 0.1 6.6e-30 6.6e-30 4 87 .. 588 670 .. 585 673 .. 0.96 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.13 CBM20.hmm 13 pgeelyvvGsipe.lgnWdp.akavalttsd 41 +g+ l+ G + + + nWd+ ++ +lt++ XCM79337.1|CBM20|CBM25|GH13_32 287 WGNGLLASGQARTfVDNWDTeRNGSTLTYKY 317 5666666666666458888856667777644 PP == domain 2 score: 89.5 bits; conditional E-value: 6.6e-30 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 +F vnatt g+++yvvG+ ++lg Wdpa+a +l+ ++yp+W+ +v+++ gt ++Yky++kda+g v+wesg+nrt t XCM79337.1|CBM20|CBM25|GH13_32 588 SFAVNATTVTGQSIYVVGDNAALGGWDPAQAKPLSSAAYPVWKLDVTMAGGTAFQYKYIRKDASGA-VTWESGANRTAT 665 7**************************************************************986.************ PP CBM20.hmm 83 tpasg 87 +pasg XCM79337.1|CBM20|CBM25|GH13_32 666 VPASG 670 **987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (680 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 133.26 // Query: BFD87348.1|CBM20 [L=219] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-59 184.8 0.6 1.5e-33 101.2 0.2 2.1 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 82.2 0.0 1.3e-27 1.3e-27 1 82 [. 25 106 .. 25 112 .. 0.94 2 ! 101.2 0.2 1.5e-33 1.5e-33 2 88 .. 124 211 .. 123 213 .. 0.95 Alignments for each domain: == domain 1 score: 82.2 bits; conditional E-value: 1.3e-27 CBM20.hmm 1 vkvtFqvnattqpgeelyvvGsipelgnWdpakavaltt..sdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 v+vtF+v+a ++ ge+l++ Gs+pelg+Wdpakav+l t s+yp+W+++v+lp+g t++Yky+k++++g+ v+wes +nrt t BFD87348.1|CBM20 25 VSVTFSVQAVME-GETLLLSGSAPELGAWDPAKAVPLGTtpSAYPHWSTSVQLPAGATVQYKYLKRSPAGT-VTWESIPNRTRT 106 78****999876.8***********************9999****************************98.********9977 PP == domain 2 score: 101.2 bits; conditional E-value: 1.5e-33 CBM20.hmm 2 kvtFqvnattqpgeelyvvGsipelgnWdpakavaltt..sdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpasgt 88 + F+ +att++g++lyv+G++p+lg+Wdpa+a++ltt ++yplW++t +lp gt ++Yky+kk++dg+ ++we+g+nrt+ tp+ gt BFD87348.1|CBM20 124 PTVFHATATTTWGQSLYVCGNVPDLGAWDPARALPLTTdsAAYPLWSGTHQLPPGTAVQYKYLKKNPDGS-ITWENGDNRTVVTPSAGT 211 667999********************************88888*************************98.**************9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (219 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 57.18 // Query: 546486|Ptegra1_GeneCatalog_proteins_20151205.aa.fasta|GH13_32|CBM20|GH13_32 [L=599] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-32 97.8 0.2 5e-32 96.3 0.2 1.8 1 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 96.3 0.2 5e-32 5e-32 1 89 [. 504 591 .. 504 592 .. 0.97 Alignments for each domain: == domain 1 score: 96.3 bits; conditional E-value: 5e-32 CBM20.hmm 1 vkvtFqvnattqpgeelyvvGsipelgnWdpakavaltts 40 v+v+F+ +att +g++++vvGs+++lg+Wdpaka++l+ + 546486|Ptegra1_GeneCatalog_proteins_20151205.aa.fasta|GH13_32|CBM20|GH13_32 504 VSVNFRSTATTVYGQNIFVVGSLSQLGSWDPAKALPLSSA 543 78************************************** PP CBM20.hmm 41 dyplWtvtvelpegttieYkyvkkdadgeevewesgenrt 80 +yp Wt+tv++p++t +eYky++k+a+g+ v+w s++n + 546486|Ptegra1_GeneCatalog_proteins_20151205.aa.fasta|GH13_32|CBM20|GH13_32 544 SYPAWTATVSIPASTAFEYKYIRKEANGS-VVWSSDPNFR 582 ***************************98.********** PP CBM20.hmm 81 lttpasgts 89 +tt asg++ 546486|Ptegra1_GeneCatalog_proteins_20151205.aa.fasta|GH13_32|CBM20|GH13_32 583 VTTAASGSQ 591 **9999875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (599 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 124.97 // Query: XBS78139.1|CBM20|GH13_32 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-33 100.8 1.0 3.5e-33 100.0 0.2 1.9 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.43 0.43 44 79 .. 375 410 .. 365 415 .. 0.67 2 ! 100.0 0.2 3.5e-33 3.5e-33 3 88 .. 498 582 .. 496 584 .. 0.96 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.43 CBM20.hmm 44 lWtvtvelpe.gttieYkyvkkdadgeevewesgenr 79 Wt + +e ++ + + +++da+ + +w+ g n+ XBS78139.1|CBM20|GH13_32 375 AWTCEQRQDEiTGMVGFNNAVGDAAVS-NWWDDGGNQ 410 566666666633566677777777644.688887776 PP == domain 2 score: 100.0 bits; conditional E-value: 3.5e-33 CBM20.hmm 3 vtFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpasg 87 v++ v+a+t g+++ +vG+ pelg+Wdpaka +l+ ++yp W++tv+lp+gt++eYkyvk+d++g+ +wesg+nr t++a+g XBS78139.1|CBM20|GH13_32 498 VRVAVTAQTVMGQNIRIVGNQPELGSWDPAKAPQLSAASYPSWSGTVDLPAGTQFEYKYVKYDQSGN-ATWESGANRIATVNADG 581 89999************************************************************99.************99987 PP CBM20.hmm 88 t 88 + XBS78139.1|CBM20|GH13_32 582 S 582 5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 120.83 // Query: UJP39867.1|CBM20|GH13_32 [L=630] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-33 99.4 1.8 1.4e-32 98.0 0.9 2.2 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.4 0.0 0.16 0.16 45 63 .. 123 148 .. 111 164 .. 0.70 2 ! 98.0 0.9 1.4e-32 1.4e-32 2 88 .. 536 621 .. 535 623 .. 0.97 Alignments for each domain: == domain 1 score: -1.4 bits; conditional E-value: 0.16 CBM20.hmm 45 Wtv.......tvelpegttieYkyvk 63 W++ +ve + gt+ eYk ++ UJP39867.1|CBM20|GH13_32 123 WWTsyqpvsyKVESKLGTRAEYKAMI 148 55434444335555568999999876 PP == domain 2 score: 98.0 bits; conditional E-value: 1.4e-32 CBM20.hmm 2 kvtFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpas 86 +v+F vnatt +g++++vvG++++lg Wdpakav+l+ ++yp+W+++v+l g+t+ Ykyv+k+a+g+ v+we+g++rt+t+pas UJP39867.1|CBM20|GH13_32 536 AVSFGVNATTVWGQNVFVVGDVAALGGWDPAKAVPLSSATYPVWRASVTLTPGSTVAYKYVRKEANGS-VTWETGADRTVTVPAS 619 699***************************************************************98.***************9 PP CBM20.hmm 87 gt 88 gt UJP39867.1|CBM20|GH13_32 620 GT 621 97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (630 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 118.80 // Query: UED83242.1|CBM20|GH13_32 [L=584] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-33 99.2 3.1 6.4e-33 99.2 0.2 2.2 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.2 0.077 0.077 44 78 .. 371 405 .. 363 414 .. 0.78 2 ! 99.2 0.2 6.4e-33 6.4e-33 4 88 .. 491 575 .. 489 577 .. 0.95 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.077 CBM20.hmm 44 lWtvtvelpe.gttieYkyvkkdadgeevewesgen 78 Wt + pe ++ +e++ v ++++ + +w++g++ UED83242.1|CBM20|GH13_32 371 GWTCQHAWPEiESMVEFRNVSRGQSVT-DWWDNGND 405 588888899956899*****9999743.67777654 PP == domain 2 score: 99.2 bits; conditional E-value: 6.4e-33 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpasgt 88 +Fqv+a+t++ge++ vvGs+p+lg+W+p++av+l+ ++yp W++t+ lp gtt+eYky+++ +++ v+wesg+nrt t+p++g+ UED83242.1|CBM20|GH13_32 491 SFQVEAETAWGESVHVVGSVPQLGDWNPERAVRLSADTYPIWRATLALPTGTTFEYKYLRRVDGQPGVVWESGANRTGTVPQNGS 575 7***********************************************************8777667**************9986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (584 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 116.30 // Query: XUQ40707.1|CBM20|CBM25|GH13_32 [L=683] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-32 95.4 0.4 9.2e-32 95.4 0.4 2.8 3 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.0 0.37 0.37 28 61 .. 290 304 .. 278 311 .. 0.61 2 ? -1.2 0.3 0.13 0.13 24 45 .. 498 521 .. 482 551 .. 0.68 3 ! 95.4 0.4 9.2e-32 9.2e-32 4 87 .. 591 673 .. 588 676 .. 0.97 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.37 CBM20.hmm 28 nWdp.akavalttsdyplWtvtvelpegttieYky 61 nWd+ ++ +lt+ ky XUQ40707.1|CBM20|CBM25|GH13_32 290 NWDTeRNGSTLTY--------------------KY 304 5555444444444....................44 PP == domain 2 score: -1.2 bits; conditional E-value: 0.13 CBM20.hmm 24 pelgnWdpakavaltt..sdyplW 45 p+ g W +a +va+t +++ + XUQ40707.1|CBM20|CBM25|GH13_32 498 PTGGTWTTAPGVAMTAacTGWVKY 521 455777777777777644333333 PP == domain 3 score: 95.4 bits; conditional E-value: 9.2e-32 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 +F vnatt g+++yvvG+ ++lgnW++ +a+ l+ ++yp+W+ +v +++gt +eYky++kda+g+ v+wesg+nrt t XUQ40707.1|CBM20|CBM25|GH13_32 591 SFAVNATTVTGQNVYVVGNNAALGNWNTGSALLLSSAAYPVWKLDVAMAAGTAFEYKYIRKDASGN-VTWESGANRTAT 668 7***************************************************************99.************ PP CBM20.hmm 83 tpasg 87 +pasg XUQ40707.1|CBM20|CBM25|GH13_32 669 VPASG 673 **987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (683 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 118.27 // Query: UYQ76683.1|CBM20|GH13_32 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-31 94.1 2.0 4.4e-31 93.3 0.5 2.2 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.0 0.14 0.14 43 80 .. 374 411 .. 362 419 .. 0.73 2 ! 93.3 0.5 4.4e-31 4.4e-31 3 88 .. 498 582 .. 496 584 .. 0.96 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM20.hmm 43 plWtvtvelpe.gttieYkyvkkdadgeevewesgenrt 80 + Wt + +e ++ + + v++da+ + +w+ g n+ UYQ76683.1|CBM20|GH13_32 374 SAWTCEQRQDEiTGMVGFNNVVGDAAVS-NWWDDGGNQI 411 6677777777744778888899999754.7898888875 PP == domain 2 score: 93.3 bits; conditional E-value: 4.4e-31 CBM20.hmm 3 vtFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpasg 87 v++ ++a+t g+++ +vG+ pelg+Wdpaka +l+ +yp Wt+tv+lp++t++eYkyv +d++g+ +wesg+nrt t++a+g UYQ76683.1|CBM20|GH13_32 498 VSVAITAQTVMGQNIRMVGDQPELGSWDPAKAPQLSAVNYPSWTGTVNLPAETRFEYKYVTYDQSGN-ATWESGANRTATVNADG 581 67788************************************************************99.************99987 PP CBM20.hmm 88 t 88 + UYQ76683.1|CBM20|GH13_32 582 S 582 5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 117.17 // Query: XHM93942.1|CBM20 [L=55] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-10 27.7 0.0 1.4e-10 27.6 0.0 1.1 1 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.6 0.0 1.4e-10 1.4e-10 59 89 .. 18 47 .. 3 48 .. 0.83 Alignments for each domain: == domain 1 score: 27.6 bits; conditional E-value: 1.4e-10 CBM20.hmm 59 Ykyvkkdadgeevewesgenrtlttpasgts 89 ky++k++dg+ v+wesg+nrt t+p+sg+ XHM93942.1|CBM20 18 SKYIRKESDGS-VTWESGANRTATVPSSGNV 47 69*******98.***************9975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (55 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 23.63 // Query: WOI61997.1|CBM20|CBM25|GH13_32 [L=687] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-31 93.7 0.0 8.5e-31 92.4 0.0 1.8 1 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 92.4 0.0 8.5e-31 8.5e-31 4 89 .. 595 679 .. 593 680 .. 0.97 Alignments for each domain: == domain 1 score: 92.4 bits; conditional E-value: 8.5e-31 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 +F v+att pg+++ vvG++++lg W pa a++l ++yp+W+ +v+lp+gt+++Yky++kda+g+ v+wesg++rt t WOI61997.1|CBM20|CBM25|GH13_32 595 SFAVTATTVPGQTIHVVGDHAALGGWAPAAALKLDAAAYPVWKLDVKLPAGTSFTYKYIRKDASGN-VTWESGADRTAT 672 79**************************************************************99.************ PP CBM20.hmm 83 tpasgts 89 +pa+gt WOI61997.1|CBM20|CBM25|GH13_32 673 VPADGTV 679 ***9975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (687 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 139.36 // Query: UKJ65633.1|CBM20|CBM25|GH13_32 [L=737] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-34 104.1 0.2 6e-34 102.5 0.2 1.9 1 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 102.5 0.2 6e-34 6e-34 4 87 .. 645 727 .. 643 730 .. 0.95 Alignments for each domain: == domain 1 score: 102.5 bits; conditional E-value: 6e-34 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 +F v+att++g+ +yvvGsip+lg+W p+++val+ ++yp+Wt+t++lp+gtt+ Ykyvk+d +g+ v+wesg+nrt t UKJ65633.1|CBM20|CBM25|GH13_32 645 SFAVTATTAWGQGVYVVGSIPALGSWAPSNGVALSAASYPVWTATLDLPAGTTFAYKYVKRDGAGN-VVWESGANRTAT 722 79**************************************************************99.************ PP CBM20.hmm 83 tpasg 87 + +g UKJ65633.1|CBM20|CBM25|GH13_32 723 VGPDG 727 87766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (737 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.29 // Query: XRA54242.1|CBM20|GH13_32 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-33 99.5 2.2 5.2e-33 99.4 0.5 1.9 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.45 0.45 44 79 .. 375 410 .. 366 415 .. 0.67 2 ! 99.4 0.5 5.2e-33 5.2e-33 3 87 .. 498 581 .. 496 584 .. 0.96 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.45 CBM20.hmm 44 lWtvtvelpe.gttieYkyvkkdadgeevewesgenr 79 Wt + +e ++ + + +++da+ + +w+ g n+ XRA54242.1|CBM20|GH13_32 375 AWTCEQRQDEiTGMVGFNNAVGDAAVS-NWWDDGGNQ 410 566666666633566677777777644.688887776 PP == domain 2 score: 99.4 bits; conditional E-value: 5.2e-33 CBM20.hmm 3 vtFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpasg 87 v+++v+a+t +g+++ +vG+ pelg+Wdpaka +l+ ++yp W++tv+lp+gt++eYkyvk+d++g+ +wesg+nr ++a+g XRA54242.1|CBM20|GH13_32 498 VSVEVTAQTVWGQNIRIVGNQPELGSWDPAKAPQLSAASYPSWSGTVDLPAGTQFEYKYVKYDQSGN-ATWESGANRIAAVNADG 581 78899************************************************************99.**********9999877 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 124.11 // Query: XAZ33867.1|CBM20|GH13_32 [L=594] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-34 102.7 1.7 8.5e-34 102.0 0.2 2.1 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.1 0.14 0.14 42 80 .. 373 411 .. 363 418 .. 0.74 2 ! 102.0 0.2 8.5e-34 8.5e-34 3 87 .. 501 584 .. 499 587 .. 0.95 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.14 CBM20.hmm 42 yplWtvtvelpe.gttieYkyvkkdadgeevewesgenrt 80 + Wt + +e ++ + + +++da+ + +w+ g+n+ XAZ33867.1|CBM20|GH13_32 373 SSSWTCEQRQDEiTGMVGFNNAVGDAAVS-NWWDDGSNQI 411 56777777777744778888888888754.7999999976 PP == domain 2 score: 102.0 bits; conditional E-value: 8.5e-34 CBM20.hmm 3 vtFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpasg 87 v++ v+a+t+ g+++ +vG+ pelg+Wdpakav+l++++yp Wt+t +lp+gt++eYky+k+d++g +wesg+nrt t++a+g XAZ33867.1|CBM20|GH13_32 501 VSVAVTAETTMGQNIRIVGNQPELGSWDPAKAVQLSPANYPSWTGTADLPAGTQFEYKYIKYDQGGH-AVWESGSNRTATVQADG 584 77889***********************************************************876.************99987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (594 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 115.95 // Query: WBO75734.1|CBM20|CBM25|GH13_32 [L=688] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-34 103.4 0.1 8.6e-34 102.0 0.1 1.8 1 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 102.0 0.1 8.6e-34 8.6e-34 4 88 .. 596 679 .. 594 681 .. 0.97 Alignments for each domain: == domain 1 score: 102.0 bits; conditional E-value: 8.6e-34 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 +F vnatt ge++yvvG+ ++lgnW pa a++l +++yp+W+ +v+lp+gt++eYky++kda+g+ v+wesg+nrt t WBO75734.1|CBM20|CBM25|GH13_32 596 SFAVNATTVLGENIYVVGDKAALGNWAPAAALKLDPAAYPVWKLDVDLPAGTSFEYKYIRKDASGN-VTWESGANRTAT 673 79**************************************************************99.************ PP CBM20.hmm 83 tpasgt 88 +p++g+ WBO75734.1|CBM20|CBM25|GH13_32 674 VPTDGK 679 **9886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (688 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 135.71 // Query: XAO45089.1|CBM20|GH13_32 [L=594] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-34 103.9 2.6 3.8e-34 103.1 0.6 2.2 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.079 0.079 41 80 .. 372 411 .. 361 419 .. 0.75 2 ! 103.1 0.6 3.8e-34 3.8e-34 3 88 .. 501 585 .. 499 587 .. 0.96 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.079 CBM20.hmm 41 dyplWtvtvelpe.gttieYkyvkkdad.geevewesgenrt 80 d + Wt + +e ++ + + +++da+ g +w+ g+n+ XAO45089.1|CBM20|GH13_32 372 DSSSWTCEQRQDEiTGMVGFNNAVGDAAvG--NWWDDGSNQI 411 556788888887744778888899999855..5999999986 PP == domain 2 score: 103.1 bits; conditional E-value: 3.8e-34 CBM20.hmm 3 vtFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpasg 87 v++ v+a+t g+++ +vG+ pelg+W+pakav+l+ ++yp Wt+tv+lp+gt++eYkyvk d++g+ +wesg+nrt t++a+g XAO45089.1|CBM20|GH13_32 501 VSVAVTAETVMGQNIRIVGNQPELGSWNPAKAVQLSAKNYPSWTGTVDLPAGTQFEYKYVKCDQSGN-TVWESGSNRTATVKADG 584 77889************************************************************99.************99987 PP CBM20.hmm 88 t 88 + XAO45089.1|CBM20|GH13_32 585 S 585 5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (594 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 116.66 // Query: XRV67462.1|CBM20|CBM25|GH13_32 [L=737] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-35 105.1 0.3 3.2e-34 103.3 0.3 2.0 1 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 103.3 0.3 3.2e-34 3.2e-34 4 87 .. 645 727 .. 643 730 .. 0.95 Alignments for each domain: == domain 1 score: 103.3 bits; conditional E-value: 3.2e-34 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 +F v+att++g+ +yvvGsip+lg+W pa++val+ ++yp+Wt+t++lp+gtt++Ykyvk+d +g+ v+wesg nrt t XRV67462.1|CBM20|CBM25|GH13_32 645 SFAVTATTTWGQGVYVVGSIPALGSWAPANGVALSAASYPVWTATLDLPAGTTFQYKYVKRDGGGN-VVWESGGNRTAT 722 79*************************************************************988.************ PP CBM20.hmm 83 tpasg 87 + +g XRV67462.1|CBM20|CBM25|GH13_32 723 VGPDG 727 87766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (737 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 140.38 // Query: UXN33223.1|CBM20|GH13_32 [L=592] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-32 98.0 3.1 1.5e-32 98.0 0.3 2.4 3 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.8 0.0 0.42 0.42 52 66 .. 267 281 .. 237 287 .. 0.75 2 ? -1.7 0.1 0.19 0.19 44 80 .. 375 411 .. 363 418 .. 0.68 3 ! 98.0 0.3 1.5e-32 1.5e-32 3 87 .. 499 582 .. 498 584 .. 0.96 Alignments for each domain: == domain 1 score: -2.8 bits; conditional E-value: 0.42 CBM20.hmm 52 pegttieYkyvkkda 66 g+++e+ y++ + UXN33223.1|CBM20|GH13_32 267 GSGDSFEFDYARQLK 281 467889999988655 PP == domain 2 score: -1.7 bits; conditional E-value: 0.19 CBM20.hmm 44 lWtvtvelpeg.ttieYkyvkkdadgeevewesgenrt 80 Wt + +e + + + +++da+ + +w+ g+n+ UXN33223.1|CBM20|GH13_32 375 AWTCEQRQEEIiGMVGFNNAVGDAAVS-NWWDDGNNQI 411 566666666633666777777888644.6888887765 PP == domain 3 score: 98.0 bits; conditional E-value: 1.5e-32 CBM20.hmm 3 vtFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpasg 87 v++ v+a+t+ g+++ +vG+ + lgnWdpaka+al+ ++yp Wt+tv+lp+gtt+eYky+k+d++g+ +wesg nrt t+ a+g UXN33223.1|CBM20|GH13_32 499 VSVAVTAETTLGQNIRIVGNQAMLGNWDPAKALALSSANYPSWTGTVDLPAGTTFEYKYIKYDQNGN-TSWESGGNRTATVGADG 582 67789************************************************************99.************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (592 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 105.33 // Query: BFD95486.1|CBM20|CBM25|GH13_32 [L=694] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-34 102.7 0.8 1.4e-33 101.2 0.1 2.1 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.1 0.21 0.21 26 39 .. 522 535 .. 506 578 .. 0.73 2 ! 101.2 0.1 1.4e-33 1.4e-33 4 87 .. 602 684 .. 599 686 .. 0.97 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.21 CBM20.hmm 26 lgnWdpakavaltt 39 g+W ++ +va+ BFD95486.1|CBM20|CBM25|GH13_32 522 NGSWTTSPGVAMDA 535 47777777777765 PP == domain 2 score: 101.2 bits; conditional E-value: 1.4e-33 CBM20.hmm 4 tFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlt 82 +F+vnatt pg+++yvvGs+p lg W pa + +l +++yp+W+ +++lp+gt++eYkyv+kda+g+ v+wesg+nrt t BFD95486.1|CBM20|CBM25|GH13_32 602 SFTVNATTVPGQNVYVVGSLPVLGGWAPAAGAKLDPAAYPVWKLDLDLPAGTSFEYKYVRKDAAGN-VTWESGANRTAT 679 7***************************************************************99.************ PP CBM20.hmm 83 tpasg 87 +pa+g BFD95486.1|CBM20|CBM25|GH13_32 680 VPADG 684 **987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (694 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 123.67 // Query: UTM46543.1|CBM20|GH13_32 [L=591] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-33 101.5 0.7 1.2e-33 101.5 0.7 1.9 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.0 0.45 0.45 44 79 .. 375 410 .. 366 415 .. 0.67 2 ! 101.5 0.7 1.2e-33 1.2e-33 3 88 .. 498 582 .. 496 584 .. 0.96 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.45 CBM20.hmm 44 lWtvtvelpe.gttieYkyvkkdadgeevewesgenr 79 Wt + +e ++ + + +++da+ + +w+ g n+ UTM46543.1|CBM20|GH13_32 375 AWTCEQRQDEiTGMVGFNNAVGDAAVS-NWWDDGGNQ 410 566666666633566677777777644.688887776 PP == domain 2 score: 101.5 bits; conditional E-value: 1.2e-33 CBM20.hmm 3 vtFqvnattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttpasg 87 v+++v+a+t +g+++ +vG+ pelg+Wdpaka +l+ ++yp W++tv+lp+gt++eYkyvk+d++g+ +wesg+nr t++a+g UTM46543.1|CBM20|GH13_32 498 VSVEVTAQTVWGQNIRIVGNQPELGSWDPAKAPQLSAASYPSWSGTVDLPAGTQFEYKYVKYDQSGN-ATWESGANRIATVNADG 581 78899************************************************************99.************99987 PP CBM20.hmm 88 t 88 + UTM46543.1|CBM20|GH13_32 582 S 582 5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (591 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 116.12 // Query: UPW17232.1|CBM20|GH13_27 [L=571] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-29 85.8 2.6 9.3e-29 85.8 2.6 2.4 3 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.1 0.44 0.44 34 47 .. 60 74 .. 37 88 .. 0.60 2 ? -1.4 0.0 0.15 0.15 46 63 .. 317 334 .. 312 371 .. 0.58 3 ! 85.8 2.6 9.3e-29 9.3e-29 1 89 [. 476 567 .. 476 568 .. 0.94 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.44 CBM20.hmm 34 avaltt.sdyplWtv 47 a +l+ s++++W++ UPW17232.1|CBM20|GH13_27 60 APPLKSdSSNSQWWA 74 334444445555655 PP == domain 2 score: -1.4 bits; conditional E-value: 0.15 CBM20.hmm 46 tvtvelpegttieYkyvk 63 t+t ++p ++ + Y+++ UPW17232.1|CBM20|GH13_27 317 TITHDIPSNDGFRYQIMS 334 555556644444444332 PP == domain 3 score: 85.8 bits; conditional E-value: 9.3e-29 CBM20.hmm 1 vkvtFqv.nattqpgeelyvvGsipelgnWdpakavalttsdyplWtvtvelpegttieYkyvkkdadg..eevewesgenrtlt 82 v+v+F++ n++t+ g+++y vG+ ++lgnW++a+av l++s+yp+Wt+t++lp++t+ie+k++++++++ ++++w+sg n++++ UPW17232.1|CBM20|GH13_27 476 VNVSFTCnNGYTNMGDSVYAVGNNSALGNWQAANAVLLNPSSYPTWTATIQLPKSTDIEWKCIIRNESNpsNVIQWQSGGNNSVN 560 79**************************************************************999755699**********99 PP CBM20.hmm 83 tpasgts 89 t +++++ UPW17232.1|CBM20|GH13_27 561 TGTGTST 567 9888765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (571 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 107.56 // Query: 659227|Glopol1_GeneCatalog_proteins_20160812.aa.fasta|GH13|CBM20 [L=659] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-20 58.9 1.0 5.8e-20 57.6 0.3 2.1 2 CBM20.hmm Domain annotation for each model (and alignments): >> CBM20.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.6 0.0 0.74 0.74 32 49 .. 506 523 .. 502 530 .. 0.76 2 ! 57.6 0.3 5.8e-20 5.8e-20 1 84 [. 558 644 .. 558 649 .. 0.90 Alignments for each domain: == domain 1 score: -3.6 bits; conditional E-value: 0.74 CBM20.hmm 32 akavalttsdyplWtvtv 49 ++ +al +++++W+ t+ 659227|Glopol1_GeneCatalog_proteins_20160812.aa.fasta|GH13|CBM20 506 SRVLALYSAADGVWSSTT 523 555777888999999886 PP == domain 2 score: 57.6 bits; conditional E-value: 5.8e-20 CBM20.hmm 1 vkvtFqv.nattqpgeelyvvGsipelgnWdpakavaltt....s 40 v v+F+v ++t+ g++++v+Gsip+lg+W ++ a++l 659227|Glopol1_GeneCatalog_proteins_20160812.aa.fasta|GH13|CBM20 558 VIVNFSVsGVSTTVGQNIVVAGSIPQLGSWITTGALKLAAtncqG 602 5699************************************77644 PP CBM20.hmm 41 dyplWtvtvelpegttieYkyvkkdadgeevewesgenrtlttp 84 + +W+++v++p+gt +k v+++ + + +w+ g+n+++t 659227|Glopol1_GeneCatalog_proteins_20160812.aa.fasta|GH13|CBM20 603 SVCVWSGSVNIPAGTAASWKAVLVNGS--TARWQCGDNNSFTAS 644 449***********************4..59*********9954 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (659 residues searched) Target model(s): 1 (90 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 129.41 // [ok]