# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM18/fasta_for_each_cluster/cluster_60.txt # target HMM database: merged_hmms/CBM18.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM18/CBM18_cluster_60.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 17839|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 [L=497] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-20 59.0 48.6 8.1e-13 34.7 19.9 2.4 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.7 19.9 8.1e-13 8.1e-13 2 36 .. 397 429 .. 396 434 .. 0.91 2 ! 30.0 20.7 2.4e-11 2.4e-11 2 36 .. 458 490 .. 455 495 .. 0.90 Alignments for each domain: == domain 1 score: 34.7 bits; conditional E-value: 8.1e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C++++CCs++G+CG t++YC+kgCqs 17839|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 397 CGP--GVAICASGYCCSQYGWCGKTAEYCDKGCQS 429 775..6799*************************9 PP == domain 2 score: 30.0 bits; conditional E-value: 2.4e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg g + C++++CCsk G+CG tsdYC++gCq+ 17839|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 458 CGD--GVAICASGYCCSKHGWCGKTSDYCSSGCQK 490 664..6699*************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (497 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 35.36 // Query: 702405|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18 [L=619] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-11 31.1 24.2 1.8e-11 30.4 24.2 1.4 1 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.4 24.2 1.8e-11 1.8e-11 2 36 .. 580 612 .. 578 617 .. 0.91 Alignments for each domain: == domain 1 score: 30.4 bits; conditional E-value: 1.8e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + +Cp+++CCsk+GyCGt YCg+gCqs 702405|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18 580 CGS--EYGKCPNGLCCSKYGYCGTETGYCGAGCQS 612 885..779**************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (619 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 57.10 // Query: 1189048|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18 [L=2587] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-27 80.0 68.1 1.3e-12 34.0 18.1 3.6 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.7 19.9 3.5e-12 3.5e-12 1 35 [. 24 57 .. 24 59 .. 0.92 2 ! 34.0 18.1 1.3e-12 1.3e-12 1 35 [. 79 113 .. 79 115 .. 0.97 3 ! 25.1 14.0 8.4e-10 8.4e-10 2 35 .. 177 211 .. 176 214 .. 0.84 Alignments for each domain: == domain 1 score: 32.7 bits; conditional E-value: 3.5e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cgk + C +++CCsk+GyCGt+++YCgkgCq 1189048|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18 24 RCGK-EFNRSCSEGYCCSKYGYCGTSEEYCGKGCQ 57 6997.5589*************************9 PP == domain 2 score: 34.0 bits; conditional E-value: 1.3e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cg++ g++ Cp+n+CCs +GyCGt++++Cg+gC+ 1189048|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18 79 RCGPSYGNTVCPNNKCCSRAGYCGTSKNHCGNGCK 113 6*********************************7 PP == domain 3 score: 25.1 bits; conditional E-value: 8.4e-10 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCg..kgCq 35 cg+ + +Cp+n +CCsk+G+CG t+++C+ +gC+ 1189048|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18 177 CGP--SYGRCPGNdLCCSKYGWCGLTDEHCNisSGCN 211 776..5689*9999****************7446886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (2587 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 129.77 // Query: 225866|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=943] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-27 79.5 98.8 7e-10 25.3 18.9 4.8 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.8 19.2 2.1e-09 2.1e-09 2 36 .. 629 662 .. 628 668 .. 0.85 2 ! 24.3 19.5 1.4e-09 1.4e-09 2 36 .. 714 747 .. 713 753 .. 0.85 3 ! 25.3 18.9 7e-10 7e-10 2 36 .. 797 830 .. 796 838 .. 0.89 4 ! 24.0 17.2 1.7e-09 1.7e-09 2 35 .. 903 935 .. 902 937 .. 0.85 Alignments for each domain: == domain 1 score: 23.8 bits; conditional E-value: 2.1e-09 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCgkgCqs 36 cg+ + C+ + +CCsk+ yCGt++++Cg+gCqs 225866|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 629 CGP--EYGACAREgQCCSKYNYCGTSDAHCGAGCQS 662 776..557896555*********************9 PP == domain 2 score: 24.3 bits; conditional E-value: 1.4e-09 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCgkgCqs 36 cg+ + C+ + +CCsk+ yCGt++++Cg+gCqs 225866|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 714 CGP--EYGACAREgQCCSKYNYCGTSDAHCGTGCQS 747 776..557896555*********************9 PP == domain 3 score: 25.3 bits; conditional E-value: 7e-10 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCgkgCqs 36 cg+ + C+l+ +CCsk+ yCGt++++Cg+gCqs 225866|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 797 CGP--EYGACALEgQCCSKYNYCGTSDAHCGTGCQS 830 776..567898888*********************9 PP == domain 4 score: 24.0 bits; conditional E-value: 1.7e-09 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCgkgCq 35 cg+ + C+ + +CCsk+ yCGt++++Cg+gCq 225866|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 903 CGP--EYGACAREgQCCSKYNYCGTSDAHCGTGCQ 935 776..557896555********************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (943 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.54 // Query: 1186699|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=395] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-30 90.3 101.3 2.8e-11 29.8 19.0 5.3 6 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.14 0.14 18 27 .. 155 164 .. 155 169 .. 0.81 2 ! 23.1 15.9 3.6e-09 3.6e-09 2 36 .. 160 198 .. 159 203 .. 0.80 3 ! 27.4 22.0 1.5e-10 1.5e-10 1 36 [. 239 274 .. 239 279 .. 0.88 4 ? 1.1 0.6 0.026 0.026 16 27 .. 272 283 .. 269 284 .. 0.79 5 ! 29.8 19.0 2.8e-11 2.8e-11 1 36 [. 300 335 .. 300 343 .. 0.90 6 ! 27.7 19.8 1.2e-10 1.2e-10 1 36 [. 353 388 .. 353 393 .. 0.89 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.14 CBM18.hmm 18 skwGyCGtts 27 s G CG+++ 1186699|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 155 STNGKCGIQP 164 6679999876 PP == domain 2 score: 23.1 bits; conditional E-value: 3.6e-09 CBM18.hmm 2 cgkqa..ggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg q + Cp+n+CC+ G CGt++d+C+ kgCq 1186699|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 160 CGIQPnkSYFVCPSNKCCNINGICGTSKDHCTvsKGCQT 198 66444224479********************75589**7 PP == domain 3 score: 27.4 bits; conditional E-value: 1.5e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cgk + +C +n+CCsk+GyCG +++YC+ kgCqs 1186699|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 239 RCGK--DFGKCSSNECCSKYGYCGKSDNYCSieKGCQS 274 6998..6699********************7669***9 PP == domain 4 score: 1.1 bits; conditional E-value: 0.026 CBM18.hmm 16 CCskwGyCGtts 27 C s++G C++ts 1186699|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 272 CQSEFGNCNSTS 283 778999999987 PP == domain 5 score: 29.8 bits; conditional E-value: 2.8e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cgk + +C +n+CCsk+GyCG+++++C+ kgCqs 1186699|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 300 RCGK--DFGKCSSNECCSKYGYCGISDEHCSieKGCQS 335 6998..6699********************7669***9 PP == domain 6 score: 27.7 bits; conditional E-value: 1.2e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cgk + +C +n+CCsk+GyCG ++++C+ kgCqs 1186699|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 353 RCGK--NFGKCSSNECCSKYGYCGRSDEHCSieKGCQS 388 6997..5699********************7669***9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (395 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 12.59 // Query: 449887|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18 [L=532] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-19 53.8 50.7 3.6e-12 32.7 21.5 3.1 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.7 21.5 3.6e-12 3.6e-12 2 36 .. 413 446 .. 412 451 .. 0.84 2 ? -0.4 0.1 0.077 0.077 18 25 .. 446 453 .. 446 454 .. 0.86 3 ! 26.5 20.4 3e-10 3e-10 2 36 .. 492 525 .. 491 530 .. 0.82 Alignments for each domain: == domain 1 score: 32.7 bits; conditional E-value: 3.6e-12 CBM18.hmm 2 cgkqaggntC.plnaCCskwGyCGttsdYCgkgCqs 36 cg+ + C + ++CCs++G+CG+t+dYCg+gCqs 449887|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18 413 CGP--EYGACaKAGLCCSQYGWCGSTEDYCGTGCQS 446 776..557894555*********************9 PP == domain 2 score: -0.4 bits; conditional E-value: 0.077 CBM18.hmm 18 skwGyCGt 25 s++G+CG 449887|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18 446 SEFGVCGK 453 799***95 PP == domain 3 score: 26.5 bits; conditional E-value: 3e-10 CBM18.hmm 2 cgkqaggntC.plnaCCskwGyCGttsdYCgkgCqs 36 cg+ + +C + + CCs+ G+CG t++YCg+gCqs 449887|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18 492 CGP--EYGRCiDADGCCSQHGWCGFTDAYCGTGCQS 525 775..4567864447********************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (532 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 26.46 // Query: 1289545|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=854] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-34 104.4 105.8 4.9e-12 32.2 20.4 4.4 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.6 19.3 1.6e-11 1.6e-11 2 36 .. 583 615 .. 582 620 .. 0.91 2 ! 32.2 20.4 5e-12 5e-12 2 36 .. 663 695 .. 662 700 .. 0.91 3 ! 32.2 20.4 4.9e-12 4.9e-12 2 36 .. 743 775 .. 742 780 .. 0.92 4 ! 28.1 21.8 9.7e-11 9.7e-11 2 36 .. 815 847 .. 814 852 .. 0.91 Alignments for each domain: == domain 1 score: 30.6 bits; conditional E-value: 1.6e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg ag + C++++CCsk+G+CG t +YCg+gCqs 1289545|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 583 CG--AGIAVCAPGYCCSKYGHCGKTFEYCGAGCQS 615 77..5789**************************9 PP == domain 2 score: 32.2 bits; conditional E-value: 5e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg ag + C++++CCsk+GyCG+t +YCg+gCqs 1289545|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 663 CG--AGVAICAPGYCCSKYGYCGNTFEYCGAGCQS 695 77..58899*************************9 PP == domain 3 score: 32.2 bits; conditional E-value: 4.9e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg ag + C++++CCsk+GyCG+t +YCg+gCqs 1289545|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 743 CG--AGVAICAPGYCCSKYGYCGNTFEYCGAGCQS 775 77..58899*************************9 PP == domain 4 score: 28.1 bits; conditional E-value: 9.7e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + + C++++CCs++GyCG +s+YC++gCq+ 1289545|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 815 CGK--NIAICAKGYCCSQYGYCGKSSKYCSSGCQK 847 886..5599*************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (854 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.54 // Query: 13158|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 [L=163] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-20 57.1 50.5 2.4e-12 33.2 20.7 2.7 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.2 20.7 2.4e-12 2.4e-12 1 36 [. 75 108 .. 73 113 .. 0.90 2 ! 29.2 21.8 4.4e-11 4.4e-11 1 37 [. 121 155 .. 121 159 .. 0.92 Alignments for each domain: == domain 1 score: 33.2 bits; conditional E-value: 2.4e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+ + Cp+++CCs++G+CG t ++Cg+gCq+ 13158|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 75 RCGE--NYGLCPSGYCCSQYGWCGKTVEHCGAGCQK 108 5885..5689*************************7 PP == domain 2 score: 29.2 bits; conditional E-value: 4.4e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 +cg+ g C +++CCsk+G+CG+++d+C+ gCq+n 13158|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 121 RCGE--GYGVCREGYCCSKYGWCGSSNDHCSLGCQNN 155 5885..7799*************************87 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (163 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.12 // Query: 72749|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 [L=855] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-61 190.0 186.4 3.6e-15 42.2 21.1 8.1 8 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.5 13.5 3.9e-07 3.9e-07 1 31 [. 97 129 .. 97 136 .. 0.87 2 ? 1.8 2.5 0.016 0.016 11 26 .. 128 143 .. 127 145 .. 0.91 3 ! 40.6 21.0 1.2e-14 1.2e-14 1 36 [. 398 433 .. 398 438 .. 0.96 4 ! 40.8 21.2 1e-14 1e-14 1 36 [. 468 503 .. 468 508 .. 0.96 5 ! 42.2 21.1 3.6e-15 3.6e-15 1 36 [. 537 572 .. 537 577 .. 0.96 6 ! 39.9 19.8 1.9e-14 1.9e-14 1 36 [. 604 639 .. 604 644 .. 0.95 7 ! 24.2 19.9 1.5e-09 1.5e-09 1 36 [. 740 775 .. 740 780 .. 0.96 8 ! 26.6 17.4 2.8e-10 2.8e-10 1 36 [. 811 846 .. 811 849 .. 0.97 Alignments for each domain: == domain 1 score: 16.5 bits; conditional E-value: 3.9e-07 CBM18.hmm 1 qcgkqagg.ntCplnaCCsk.wGyCGttsdYCg 31 +cg+ g + Cp+n+CCs GyCG+t d+C+ 72749|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 97 RCGRFVGYvKICPGNQCCSYpGGYCGNTLDHCD 129 58888866699********889**********7 PP == domain 2 score: 1.8 bits; conditional E-value: 0.016 CBM18.hmm 11 CplnaCCskwGyCGtt 26 C+l +C ++G CG++ 72749|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 128 CDLRYCWESFGKCGSK 143 99************96 PP == domain 3 score: 40.6 bits; conditional E-value: 1.2e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg++ g++ Cp+n+CCsk+GyCGt++++CgkgCqs 72749|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 398 QCGPKYGNAICPSNECCSKYGYCGTSDAHCGKGCQS 433 7**********************************9 PP == domain 4 score: 40.8 bits; conditional E-value: 1e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg++ g++ Cp+n+CCsk+GyCGt++++CgkgCqs 72749|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 468 QCGPKYGNAVCPSNECCSKYGYCGTSDAHCGKGCQS 503 7**********************************9 PP == domain 5 score: 42.2 bits; conditional E-value: 3.6e-15 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg++ g++ Cp+n+CCsk+GyCGtt+++CgkgCqs 72749|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 537 QCGPKYGNAVCPSNKCCSKYGYCGTTDAHCGKGCQS 572 7**********************************9 PP == domain 6 score: 39.9 bits; conditional E-value: 1.9e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++ g++ Cp+n+CCsk+GyCGt++dYCg++C s 72749|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 604 KCGPKYGNAVCPSNECCSKYGYCGTSDDYCGSNCLS 639 6*********************************88 PP == domain 7 score: 24.2 bits; conditional E-value: 1.5e-09 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++ gg+ C ++CCsk G+CG + d+C +gCq+ 72749|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 740 RCGPKFGGQVCGFGECCSKDGVCGFGFDFCYEGCQK 775 6**********************************6 PP == domain 8 score: 26.6 bits; conditional E-value: 2.8e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++ gg++C ++CCsk G+CG + d+C +gCq+ 72749|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 811 RCGPKFGGQKCGFGECCSKDGVCGFGFDFCFEGCQK 846 6**********************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (855 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 34.70 // Query: 1474|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18 [L=233] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-13 36.5 19.4 2.2e-13 36.5 19.4 2.1 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.7 0.3 0.82 0.82 9 12 .. 140 143 .. 136 146 .. 0.55 2 ! 36.5 19.4 2.2e-13 2.2e-13 1 36 [. 193 226 .. 193 231 .. 0.92 Alignments for each domain: == domain 1 score: -3.7 bits; conditional E-value: 0.82 CBM18.hmm 9 ntCp 12 ++Cp 1474|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18 140 AQCP 143 4565 PP == domain 2 score: 36.5 bits; conditional E-value: 2.2e-13 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg ag ++C++++CCsk+G+CGt++d+Cg+gCq+ 1474|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18 193 RCG--AGVARCKSGLCCSKYGWCGTSKDHCGTGCQK 226 588..5889**************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (233 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 35.51 // Query: 673963|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18 [L=544] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-14 38.5 46.1 6.4e-11 28.6 22.5 3.5 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.4 0.1 0.66 0.66 27 34 .. 59 66 .. 58 67 .. 0.74 2 ? -2.8 2.3 0.42 0.42 7 24 .. 354 374 .. 348 378 .. 0.59 3 ! 24.0 15.7 1.7e-09 1.7e-09 1 36 [. 447 482 .. 447 487 .. 0.89 4 ! 28.6 22.5 6.4e-11 6.4e-11 1 36 [. 504 537 .. 504 542 .. 0.91 Alignments for each domain: == domain 1 score: -3.4 bits; conditional E-value: 0.66 CBM18.hmm 27 sdYCgkgC 34 +++C++++ 673963|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18 59 ETFCTENS 66 67999875 PP == domain 2 score: -2.8 bits; conditional E-value: 0.42 CBM18.hmm 7 ggntCpln...aCCskwGyCG 24 +++ C+++ +C +++ C+ 673963|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18 354 SKSVCKPKdnvVCGNSFSLCN 374 556674444566766677775 PP == domain 3 score: 24.0 bits; conditional E-value: 1.7e-09 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cgk + C ++ CCs G+CG+++++C+ kgCqs 673963|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18 447 RCGK--DFGVCREGFCCSILGWCGNSETHCKisKGCQS 482 6997..6699********************6559***9 PP == domain 4 score: 28.6 bits; conditional E-value: 6.4e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+ g +C ++ CCs G+CGt+++YCg+gCqs 673963|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18 504 RCGE--GFGRCGKGTCCSRLGWCGTSDAYCGTGCQS 537 5885..7799*************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (544 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 60.77 // Query: 1473|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 [L=247] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-24 70.7 48.1 3.7e-14 39.0 20.0 3.0 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.0 20.0 3.7e-14 3.7e-14 2 36 .. 149 181 .. 148 190 .. 0.93 2 ! 36.6 20.1 2.1e-13 2.1e-13 1 36 [. 207 240 .. 207 245 .. 0.93 Alignments for each domain: == domain 1 score: 39.0 bits; conditional E-value: 3.7e-14 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg ag ++C++++CCsk+GyCGtts+YCg+gCqs 1473|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 149 CG--AGVARCKPGLCCSKYGYCGTTSAYCGTGCQS 181 88..5889**************************9 PP == domain 2 score: 36.6 bits; conditional E-value: 2.1e-13 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg ag ++C++++CCsk+G+CGt++d+Cg+gCq+ 1473|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 207 QCG--AGVARCKTGLCCSKYGWCGTSKDHCGTGCQK 240 688..588***************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (247 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 40.08 // Query: 7953|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18 [L=144] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-11 31.0 10.9 1.2e-11 31.0 10.9 1.9 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 0.6 0.27 0.27 5 5 .. 24 24 .. 6 34 .. 0.57 2 ! 31.0 10.9 1.2e-11 1.2e-11 1 30 [. 52 79 .. 52 82 .. 0.93 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.27 CBM18.hmm 5 q 5 q 7953|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18 24 Q 24 2 PP == domain 2 score: 31.0 bits; conditional E-value: 1.2e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYC 30 +cgk g +Cp+++CCsk+G+CGt++ +C 7953|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18 52 RCGK--GLGKCPNGQCCSKYGWCGTSALHC 79 6997..889********************* PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (144 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.25 // Query: 872239|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=833] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-35 105.9 106.5 8.8e-14 37.8 18.6 4.6 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.8 18.6 8.8e-14 8.8e-14 2 36 .. 556 588 .. 555 593 .. 0.90 2 ! 31.4 19.1 8.7e-12 8.7e-12 2 36 .. 631 663 .. 628 668 .. 0.90 3 ! 31.9 20.0 6.2e-12 6.2e-12 2 36 .. 715 747 .. 713 752 .. 0.90 4 ! 23.1 24.8 3.3e-09 3.3e-09 1 36 [. 793 826 .. 793 831 .. 0.91 Alignments for each domain: == domain 1 score: 37.8 bits; conditional E-value: 8.8e-14 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk+GyCG+t++YCgkgCqs 872239|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 556 CGP--NVAICADGRCCSKYGYCGSTDEYCGKGCQS 588 786..4599*************************9 PP == domain 2 score: 31.4 bits; conditional E-value: 8.7e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk+GyCG t ++CgkgCqs 872239|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 631 CGP--NVAICAEGYCCSKYGYCGKTTAHCGKGCQS 663 665..4489*************************9 PP == domain 3 score: 31.9 bits; conditional E-value: 6.2e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk+GyCG ts++CgkgCqs 872239|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 715 CGP--NVAVCAEGYCCSKYGYCGKTSAHCGKGCQS 747 675..4589*************************9 PP == domain 4 score: 23.1 bits; conditional E-value: 3.3e-09 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+ + C++++CCsk+GyCG s+YC++gCq+ 872239|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 793 RCGS--SYGSCASGYCCSKYGYCGKDSNYCSSGCQK 826 5885..6689*************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (833 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.17 // Query: 214385|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 [L=84] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-13 34.7 26.5 1.5e-12 33.9 26.4 1.5 1 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.9 26.4 1.5e-12 1.5e-12 2 36 .. 45 77 .. 42 82 .. 0.92 Alignments for each domain: == domain 1 score: 33.9 bits; conditional E-value: 1.5e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk g +C +++CCsk+GyCG ts+YCg+gCqs 214385|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 45 CGK--GYGRCSSGYCCSKYGYCGKTSEYCGNGCQS 77 886..889**************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (84 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 5.08 // Query: 284928|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 [L=150] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-16 46.1 55.9 5.7e-11 28.8 21.8 3.4 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.8 21.8 5.7e-11 5.7e-11 2 37 .. 41 76 .. 37 80 .. 0.87 2 ! 25.5 17.6 6.3e-10 6.3e-10 2 32 .. 82 110 .. 81 126 .. 0.80 3 ? -0.7 5.6 0.094 0.094 2 18 .. 123 137 .. 119 138 .. 0.76 Alignments for each domain: == domain 1 score: 28.8 bits; conditional E-value: 5.7e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqsn 37 cg+ g +C++++CCsk+GyCG t++YC+ k Cqs+ 284928|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 41 CGN--GYGKCNPEECCSKYGYCGKTAEYCSaeKECQSQ 76 785..789*********************84458**96 PP == domain 2 score: 25.5 bits; conditional E-value: 6.3e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgk 32 cgk + Cp+++CCsk G+CGtt d+C++ 284928|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 82 CGK--KFGNCPGGQCCSKLGFCGTTVDHCSD 110 997..5588********************97 PP == domain 3 score: -0.7 bits; conditional E-value: 0.094 CBM18.hmm 2 cgkqaggntCplnaCCs 18 cg+ + Cp aCC 284928|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 123 CGS--TFGNCPIYACCK 137 664..567899999995 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (150 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 6.43 // Query: 401807|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 [L=347] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-10 25.9 17.1 4.5e-10 25.9 17.1 2.2 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.5 0.35 0.35 23 32 .. 138 145 .. 137 150 .. 0.60 2 ! 25.9 17.1 4.5e-10 4.5e-10 1 35 [. 294 328 .. 294 334 .. 0.87 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.35 CBM18.hmm 23 CGttsdYCgk 32 CG +YC++ 401807|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 138 CGL--TYCSN 145 333..57875 PP == domain 2 score: 25.9 bits; conditional E-value: 4.5e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCq 35 +cg+ + +Cp+++CCsk GyCG t+ YC k Cq 401807|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 294 RCGP--KYGKCPTGECCSKKGYCGLTKSYCAiaKECQ 328 5886..6689********************7557898 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (347 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 51.35 // Query: 1316318|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=847] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-38 115.2 101.2 6e-13 35.1 20.3 4.6 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.2 19.3 1.1e-12 1.1e-12 2 36 .. 592 624 .. 591 629 .. 0.91 2 ! 32.5 20.0 3.9e-12 3.9e-12 2 36 .. 656 688 .. 655 693 .. 0.91 3 ! 35.1 20.3 6e-13 6e-13 2 36 .. 729 761 .. 728 766 .. 0.91 4 ! 31.6 17.5 7.6e-12 7.6e-12 9 36 .. 811 838 .. 801 841 .. 0.90 Alignments for each domain: == domain 1 score: 34.2 bits; conditional E-value: 1.1e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C++n CCsk+GyCGt+s YCgkgCqs 1316318|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 592 CGS--GVAICADNMCCSKYGYCGTSSVYCGKGCQS 624 884..7799*************************9 PP == domain 2 score: 32.5 bits; conditional E-value: 3.9e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg a+ + C ++ CCs +GyCGt+s+YCg+gCqs 1316318|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 656 CG--ANVAVCGNDMCCSRYGYCGTSSAYCGNGCQS 688 77..46699*************************9 PP == domain 3 score: 35.1 bits; conditional E-value: 6e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg a+ + C ++ CCsk+GyCGtts+YCg+gCqs 1316318|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 729 CG--ANVAVCGNDMCCSKYGYCGTTSAYCGNGCQS 761 77..46699*************************9 PP == domain 4 score: 31.6 bits; conditional E-value: 7.6e-12 CBM18.hmm 9 ntCplnaCCskwGyCGttsdYCgkgCqs 36 Cp+++CCsk+GyCG t++YC++gCq+ 1316318|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 811 GLCPDEYCCSKYGYCGKTAAYCSTGCQQ 838 68*************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (847 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 84.01 // Query: 1649418|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18 [L=527] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-07 17.8 11.3 3.8e-07 16.6 11.3 1.7 1 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.6 11.3 3.8e-07 3.8e-07 2 26 .. 498 520 .. 497 522 .. 0.85 Alignments for each domain: == domain 1 score: 16.6 bits; conditional E-value: 3.8e-07 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGtt 26 cg + +C +++CCsk+G+CG + 1649418|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18 498 CGD--SYGQCSEGYCCSKYGWCGKS 520 775..5689**************86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (527 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.04 // Query: 256572|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18 [L=351] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-38 116.0 102.7 3.6e-15 42.2 20.7 5.9 5 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.8 0.4 0.1 0.1 19 25 .. 6 12 .. 5 14 .. 0.80 2 ! 20.9 22.1 1.7e-08 1.7e-08 2 34 .. 52 84 .. 51 95 .. 0.79 3 ! 41.7 20.6 5.3e-15 5.3e-15 1 36 [. 186 221 .. 186 227 .. 0.96 4 ! 42.2 20.7 3.6e-15 3.6e-15 1 36 [. 254 289 .. 254 295 .. 0.96 5 ! 32.6 8.9 3.6e-12 3.6e-12 1 29 [. 320 348 .. 320 348 .. 0.96 Alignments for each domain: == domain 1 score: -0.8 bits; conditional E-value: 0.1 CBM18.hmm 19 kwGyCGt 25 ++G CG+ 256572|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18 6 SYGKCGS 12 7999*98 PP == domain 2 score: 20.9 bits; conditional E-value: 1.7e-08 CBM18.hmm 2 cgkqagg.ntCplnaCCskwGyCGttsdYCgkgC 34 cg g+ Cp+n+CCs++GyCG++ +YC+ +C 256572|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18 52 CGLIEGKvVVCPNNECCSNYGYCGSSYEYCN-NC 84 5643433378********************9.55 PP == domain 3 score: 41.7 bits; conditional E-value: 5.3e-15 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg++ g++ Cp+++CCsk+GyCG+t+++CgkgCqs 256572|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18 186 QCGPKYGNAICPSGKCCSKYGYCGITDAHCGKGCQS 221 7**********************************9 PP == domain 4 score: 42.2 bits; conditional E-value: 3.6e-15 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg++ g++ Cp+++CCsk+GyCG+t+++CgkgCqs 256572|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18 254 QCGPKFGNTVCPSGKCCSKYGYCGITNAHCGKGCQS 289 7**********************************9 PP == domain 5 score: 32.6 bits; conditional E-value: 3.6e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdY 29 qcg++ g++ Cp+++CCsk+GyCG+t+++ 256572|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18 320 QCGPKFGNAVCPSGQCCSKYGYCGITDAH 348 7*************************976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (351 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 17.44 // Query: 625692|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18 [L=313] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-19 54.9 53.7 2.3e-12 33.3 19.1 3.4 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.7 0.3 0.84 0.84 23 27 .. 137 141 .. 135 145 .. 0.64 2 ! 33.3 19.1 2.3e-12 2.3e-12 2 36 .. 203 235 .. 202 240 .. 0.90 3 ? 0.4 0.3 0.043 0.043 19 27 .. 270 278 .. 269 281 .. 0.75 4 ! 32.3 20.0 4.5e-12 4.5e-12 1 36 [. 273 306 .. 273 311 .. 0.91 Alignments for each domain: == domain 1 score: -3.7 bits; conditional E-value: 0.84 CBM18.hmm 23 CGtts 27 CG t+ 625692|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18 137 CGLTD 141 66665 PP == domain 2 score: 33.3 bits; conditional E-value: 2.3e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C++++CCsk+GyCGt++++Cg+gCqs 625692|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18 203 CGP--GIAICASGLCCSKYGYCGTSDTHCGSGCQS 235 775..6699*************************9 PP == domain 3 score: 0.4 bits; conditional E-value: 0.043 CBM18.hmm 19 kwGyCGtts 27 ++G+CG++ 625692|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18 270 STGQCGPGI 278 689***985 PP == domain 4 score: 32.3 bits; conditional E-value: 4.5e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ g + C++++CCsk+GyCG++++YCg+gCq+ 625692|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18 273 QCGP--GIAICAPGLCCSKYGYCGSSQAYCGSGCQK 306 6886..7799*************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (313 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 12.27 // Query: 1189716|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 [L=108] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-11 30.6 24.0 3e-11 29.7 23.7 1.7 1 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.7 23.7 3e-11 3e-11 1 36 [. 8 42 .. 8 47 .. 0.84 Alignments for each domain: == domain 1 score: 29.7 bits; conditional E-value: 3e-11 CBM18.hmm 1 qcgkqaggntCpln.aCCskwGyCGttsdYCgkgCqs 36 qcg+ + +C + CCs +GyCG+t++YCg gCqs 1189716|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 8 QCGP--KYGKCSNPkDCCSRYGYCGSTNAYCGYGCQS 42 6897..5578844448********************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (108 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 6.03 // Query: 328525|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|GH11|GH11|CBM18|CBM18 [L=838] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-25 75.0 55.1 9.1e-15 41.0 23.8 2.9 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.1 23.3 3.4e-14 3.4e-14 1 36 [. 614 649 .. 614 654 .. 0.96 2 ! 41.0 23.8 9.1e-15 9.1e-15 1 36 [. 796 831 .. 796 836 .. 0.96 Alignments for each domain: == domain 1 score: 39.1 bits; conditional E-value: 3.4e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cgk++g+++Cp+++CCsk+GyCG +++YC++gCqs 328525|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|GH11|GH11|CBM18|CBM18 614 KCGKKNGNAQCPKGYCCSKYGYCGKSDEYCKAGCQS 649 6**********************************9 PP == domain 2 score: 41.0 bits; conditional E-value: 9.1e-15 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cgk++g+++Cp+++CCsk+GyCG t+dYC++gCqs 328525|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|GH11|GH11|CBM18|CBM18 796 KCGKKNGNAQCPKGYCCSKYGYCGKTDDYCKSGCQS 831 6**********************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (838 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 87.54 // Query: 14211|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 [L=245] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-18 52.9 50.4 1.4e-11 30.8 21.9 3.1 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.8 21.9 1.4e-11 1.4e-11 2 37 .. 158 191 .. 156 195 .. 0.90 2 ! 26.6 20.6 2.7e-10 2.7e-10 2 36 .. 206 238 .. 205 243 .. 0.91 Alignments for each domain: == domain 1 score: 30.8 bits; conditional E-value: 1.4e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 cg+ g + C +++CCs++GyCG+ts+YC+ gCq++ 14211|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 158 CGE--GIAICYPGLCCSQYGYCGNTSEYCSGGCQKQ 191 774..6699*************************85 PP == domain 2 score: 26.6 bits; conditional E-value: 2.7e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C +++CCs++G+C +t+d+C+ gCq+ 14211|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 206 CGP--GVAICGGGLCCSQYGWCDSTKDHCTGGCQK 238 775..6699*************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (245 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 15.28 // Query: 295874|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=925] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-39 118.6 96.5 4.7e-13 35.5 16.8 4.5 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.8 18.7 1.6e-12 1.6e-12 1 36 [. 589 622 .. 589 627 .. 0.91 2 ! 33.8 18.7 1.6e-12 1.6e-12 1 36 [. 674 707 .. 674 712 .. 0.91 3 ! 34.0 18.3 1.3e-12 1.3e-12 1 36 [. 755 788 .. 755 793 .. 0.92 4 ! 35.5 16.8 4.7e-13 4.7e-13 1 36 [. 885 918 .. 885 920 .. 0.93 Alignments for each domain: == domain 1 score: 33.8 bits; conditional E-value: 1.6e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ g + C++++CCsk+G+CG t +YCg+gCqs 295874|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 589 QCGP--GIAVCAEGLCCSKYGWCGDTIEYCGTGCQS 622 6886..7799*************************9 PP == domain 2 score: 33.8 bits; conditional E-value: 1.6e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ g + C++++CCsk+G+CG t +YCg+gCqs 295874|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 674 QCGP--GIAVCAEGLCCSKYGWCGDTIEYCGTGCQS 707 6886..7799*************************9 PP == domain 3 score: 34.0 bits; conditional E-value: 1.3e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ g + C++++CCsk+G+CG t +YCg+gCqs 295874|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 755 QCGP--GIAVCAEGLCCSKYGWCGDTIEYCGTGCQS 788 6886..7799*************************9 PP == domain 4 score: 35.5 bits; conditional E-value: 4.7e-13 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ g + C++++CCsk+G+CGt+++YCg+gCq+ 295874|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 885 QCGS--GIAICASGLCCSKYGWCGTSDAYCGSGCQK 918 6885..779**************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (925 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 89.96 // Query: 295877|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=895] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-40 122.2 104.1 2.4e-13 36.4 19.7 4.8 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.4 19.7 2.4e-13 2.4e-13 2 36 .. 583 615 .. 582 620 .. 0.89 2 ! 33.4 22.3 2.1e-12 2.1e-12 2 36 .. 662 694 .. 661 701 .. 0.90 3 ! 34.9 17.8 7.2e-13 7.2e-13 2 36 .. 756 788 .. 755 793 .. 0.90 4 ! 35.5 20.3 4.4e-13 4.4e-13 2 36 .. 856 888 .. 855 893 .. 0.91 Alignments for each domain: == domain 1 score: 36.4 bits; conditional E-value: 2.4e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCs++GyCG+t++YCg+gCqs 295877|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 583 CGP--NIAVCATGLCCSQYGYCGSTDEYCGAGCQS 615 775..4589*************************9 PP == domain 2 score: 33.4 bits; conditional E-value: 2.1e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCs++GyCG t+dYCg+gCqs 295877|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 662 CGP--NVAVCATGYCCSQYGYCGKTNDYCGAGCQS 694 776..4599*************************9 PP == domain 3 score: 34.9 bits; conditional E-value: 7.2e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk+GyCGt++++Cg+gCqs 295877|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 756 CGP--NVAVCAKGLCCSKYGYCGTSAEHCGTGCQS 788 776..4599*************************9 PP == domain 4 score: 35.5 bits; conditional E-value: 4.4e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk+GyCG tsdYCgkgCqs 295877|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 856 CGP--NVAVCASGLCCSKYGYCGKTSDYCGKGCQS 888 886..5599*************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (895 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 48.45 // Query: 284322|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 [L=438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-12 31.7 21.1 6.8e-12 31.7 21.1 2.3 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.1 0.2 0.54 0.54 20 29 .. 235 244 .. 230 250 .. 0.69 2 ! 31.7 21.1 6.8e-12 6.8e-12 2 37 .. 365 399 .. 363 400 .. 0.87 Alignments for each domain: == domain 1 score: -3.1 bits; conditional E-value: 0.54 CBM18.hmm 20 wGyCGttsdY 29 + C ts+Y 284322|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 235 TNTCTFTSEY 244 5667777777 PP == domain 2 score: 31.7 bits; conditional E-value: 6.8e-12 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCgkgCqsn 37 cg+ + Cp++ +CCsk+GyCGtt+dYC++gCq+n 284322|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 365 CGP--NYGACPKSgYCCSKYGYCGTTDDYCKSGCQKN 399 775..557898777*********************86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (438 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 61.27 // Query: 1177967|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 [L=553] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-50 155.6 170.7 1.9e-11 30.3 17.8 8.5 8 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.5 19.8 5.9e-10 5.9e-10 2 36 .. 116 148 .. 115 153 .. 0.89 2 ! 23.7 8.9 2.3e-09 2.3e-09 9 35 .. 174 201 .. 168 203 .. 0.78 3 ! 26.3 21.5 3.4e-10 3.4e-10 1 35 [. 222 256 .. 222 262 .. 0.86 4 ? -2.1 0.0 0.26 0.26 20 25 .. 259 264 .. 257 266 .. 0.79 5 ! 29.2 18.0 4.3e-11 4.3e-11 1 36 [. 289 324 .. 289 329 .. 0.86 6 ! 29.2 18.0 4.3e-11 4.3e-11 1 36 [. 365 400 .. 365 405 .. 0.86 7 ! 27.1 19.4 1.9e-10 1.9e-10 1 36 [. 443 478 .. 443 483 .. 0.84 8 ! 30.3 17.8 1.9e-11 1.9e-11 2 35 .. 513 545 .. 512 547 .. 0.87 Alignments for each domain: == domain 1 score: 25.5 bits; conditional E-value: 5.9e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + C +n+CCsk+G+CG+t ++C++gC + 1177967|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 116 CGP--EFGSCGGNLCCSKYGFCGITMEHCSDGCRQ 148 786..5689************************86 PP == domain 2 score: 23.7 bits; conditional E-value: 2.3e-09 CBM18.hmm 9 ntC.plnaCCskwGyCGttsdYCgkgCq 35 +C +++CCs++GyCGt++ +C+ ++q 1177967|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 174 GRCiGEDECCSQFGYCGTSESHCNIKSQ 201 57855669***************87666 PP == domain 3 score: 26.3 bits; conditional E-value: 3.4e-10 CBM18.hmm 1 qcgkqaggntC.plnaCCskwGyCGttsdYCgkgCq 35 +cg++ g C ++n+CCs++GyCG ++d+C++gCq 1177967|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 222 RCGESF-GGACaKPNQCCSQFGYCGEGEDFCDAGCQ 256 699755.55675889********************9 PP == domain 4 score: -2.1 bits; conditional E-value: 0.26 CBM18.hmm 20 wGyCGt 25 +GyC++ 1177967|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 259 YGYCNP 264 899975 PP == domain 5 score: 29.2 bits; conditional E-value: 4.3e-11 CBM18.hmm 1 qcgkqaggntC.plnaCCskwGyCGttsdYCgkgCqs 36 +cg+ g C ++++CCs++GyCG ++++Cg gCqs 1177967|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 289 RCGS-MYGGACaDPDLCCSQYGYCGDSEEHCGVGCQS 324 5885.6788894556*********************9 PP == domain 6 score: 29.2 bits; conditional E-value: 4.3e-11 CBM18.hmm 1 qcgkqaggntC.plnaCCskwGyCGttsdYCgkgCqs 36 +cg+ g C ++++CCs++GyCG ++++Cg gCqs 1177967|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 365 RCGS-MYGGACaDPDLCCSQYGYCGDSEEHCGVGCQS 400 5885.6788894556*********************9 PP == domain 7 score: 27.1 bits; conditional E-value: 1.9e-10 CBM18.hmm 1 qcgkqaggntC.plnaCCskwGyCGttsdYCgkgCqs 36 +cg++ g C ++++CCs++GyCG ++++Cg gCqs 1177967|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 443 RCGRSF-GGACaDPDLCCSQYGYCGDSEQHCGVGCQS 478 699755.56673666*********************9 PP == domain 8 score: 30.3 bits; conditional E-value: 1.9e-11 CBM18.hmm 2 cgkqaggntC.plnaCCskwGyCGttsdYCgkgCq 35 cg a +C + n+CCs++GyCGt+++YCg+gCq 1177967|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 513 CG--ARFGKCaKANHCCSEYGYCGTNNKYCGAGCQ 545 77..4668996667********************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (553 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 18.43 // Query: 277794|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=759] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-36 111.0 104.3 7.8e-13 34.8 19.1 4.7 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.6 21.1 3.8e-12 3.8e-12 1 36 [. 480 513 .. 480 518 .. 0.92 2 ! 34.8 19.1 7.8e-13 7.8e-13 2 36 .. 556 588 .. 555 593 .. 0.91 3 ! 32.1 19.8 5.2e-12 5.2e-12 2 36 .. 631 663 .. 628 668 .. 0.89 4 ! 29.6 20.2 3.1e-11 3.1e-11 2 36 .. 720 752 .. 718 754 .. 0.91 Alignments for each domain: == domain 1 score: 32.6 bits; conditional E-value: 3.8e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ + Cp+++CCs +GyCG+t +YCgkgCqs 277794|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 480 QCGP--DYGVCPKGKCCSRYGYCGNTVAYCGKGCQS 513 6887..6699*************************9 PP == domain 2 score: 34.8 bits; conditional E-value: 7.8e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C +n+CCs +GyCG+t +YCgkgCqs 277794|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 556 CGP--GVAVCGNNLCCSRYGYCGNTVAYCGKGCQS 588 775..6799*************************9 PP == domain 3 score: 32.1 bits; conditional E-value: 5.2e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg g + C +n+CCsk+GyCG +s+YCgkgCqs 277794|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 631 CG--LGVAVCGSNLCCSKYGYCGDSSAYCGKGCQS 663 55..36689*************************9 PP == domain 4 score: 29.6 bits; conditional E-value: 3.1e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + Cp++ CCsk+GyCGt ++YCg+gC++ 277794|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 720 CGS--EYGICPNGGCCSKYGYCGTEAAYCGTGCKK 752 775..6789************************85 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (759 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.50 // Query: 1179373|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 [L=571] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-12 34.0 19.9 3.3e-12 32.7 19.9 1.7 1 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.7 19.9 3.3e-12 3.3e-12 2 35 .. 24 56 .. 23 66 .. 0.92 Alignments for each domain: == domain 1 score: 32.7 bits; conditional E-value: 3.3e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg +g+ C++++CCsk+GyCGt+s+YC+ gCq 1179373|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 24 CGI-ENGKSCKKGYCCSKYGYCGTSSEYCDVGCQ 56 774.5789*************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (571 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.79 // Query: 329095|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 [L=730] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-21 61.7 40.1 4.7e-13 35.5 15.1 2.5 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.7 17.0 7.3e-12 7.3e-12 1 36 [. 586 621 .. 586 626 .. 0.96 2 ! 35.5 15.1 4.7e-13 4.7e-13 2 36 .. 691 723 .. 690 725 .. 0.90 Alignments for each domain: == domain 1 score: 31.7 bits; conditional E-value: 7.3e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg + ++ +C+ ++CCs+ +CGt+ d+Cg+gCqs 329095|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 586 RCGVKFDNRRCKAGECCSSHNWCGTSIDHCGAGCQS 621 6**********************************9 PP == domain 2 score: 35.5 bits; conditional E-value: 4.7e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk+G+CG t++YC++gCq+ 329095|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 691 CGP--NVAVCASGLCCSKYGWCGDTEKYCSNGCQK 723 775..4599*************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (730 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 61.77 // Query: 170150|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 [L=387] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-12 32.2 17.2 4.8e-12 32.2 17.2 2.8 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.8 0.5 0.1 0.1 2 13 .. 105 116 .. 104 118 .. 0.82 2 ? -4.1 0.2 1 1 8 16 .. 134 142 .. 131 142 .. 0.66 3 ! 32.2 17.2 4.8e-12 4.8e-12 2 35 .. 347 379 .. 346 382 .. 0.86 Alignments for each domain: == domain 1 score: -0.8 bits; conditional E-value: 0.1 CBM18.hmm 2 cgkqaggntCpl 13 c k+++gntC+ 170150|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 105 CSKNKEGNTCEI 116 8899999***75 PP == domain 2 score: -4.1 bits; conditional E-value: 1 CBM18.hmm 8 gntCplnaC 16 ++ C ++ C 170150|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 134 KANCRTKIC 142 567877776 PP == domain 3 score: 32.2 bits; conditional E-value: 4.8e-12 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCgkgCq 35 cg+ + +C+++ +CCsk+GyCG ts+YC++gCq 170150|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 347 CGP--SYGRCANSnLCCSKYGYCGKTSAYCDTGCQ 379 776..558997666********************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (387 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 54.65 // Query: 1180699|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 [L=296] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-12 33.7 21.7 5.1e-12 32.2 21.9 1.8 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.2 21.9 5.1e-12 5.1e-12 2 35 .. 24 56 .. 23 62 .. 0.91 2 ? -2.3 0.0 0.29 0.29 19 26 .. 58 65 .. 57 67 .. 0.76 Alignments for each domain: == domain 1 score: 32.2 bits; conditional E-value: 5.1e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg ++g+ C++++CCsk+GyCGt+s+YC+ gCq 1180699|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 24 CGI-KNGKSCKKGYCCSKYGYCGTSSEYCDVGCQ 56 774.579**************************9 PP == domain 2 score: -2.3 bits; conditional E-value: 0.29 CBM18.hmm 19 kwGyCGtt 26 k+G C+ + 1180699|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 58 KYGICNES 65 79999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (296 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 17.94 // Query: 35298|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 [L=438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-70 219.5 259.9 2.5e-13 36.3 21.8 10.9 10 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.5 19.9 3.6e-11 3.6e-11 2 36 .. 8 40 .. 7 45 .. 0.89 2 ! 24.1 22.1 1.6e-09 1.6e-09 1 37 [. 53 87 .. 51 91 .. 0.92 3 ! 8.9 8.7 9.1e-05 9.1e-05 1 24 [. 99 120 .. 99 122 .. 0.86 4 ! 34.5 16.0 9.4e-13 9.4e-13 11 36 .. 119 144 .. 118 146 .. 0.95 5 ! 24.9 22.6 9.6e-10 9.6e-10 1 37 [. 157 191 .. 155 195 .. 0.92 6 ! 28.5 22.1 7.2e-11 7.2e-11 1 37 [. 215 249 .. 215 253 .. 0.94 7 ! 27.0 19.1 2.1e-10 2.1e-10 1 37 [. 261 295 .. 261 299 .. 0.92 8 ! 27.1 22.0 2e-10 2e-10 2 37 .. 305 338 .. 298 342 .. 0.89 9 ! 36.3 21.8 2.5e-13 2.5e-13 2 36 .. 353 385 .. 350 387 .. 0.92 10 ! 35.5 18.4 4.6e-13 4.6e-13 2 36 .. 398 433 .. 397 436 .. 0.93 Alignments for each domain: == domain 1 score: 29.5 bits; conditional E-value: 3.6e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + C++++CCs++G+CG ++++Cg gCq+ 35298|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 8 CG--VNYGSCAPGLCCSQYGWCGKSDEHCGVGCQN 40 77..36689*************************6 PP == domain 2 score: 24.1 bits; conditional E-value: 1.6e-09 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 +cg ag Cp+++CCs++G+C + +++Cg gCq+n 35298|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 53 RCG--AGYGVCPSGQCCSQYGWCENADEHCGIGCQKN 87 588..5889**************************87 PP == domain 3 score: 8.9 bits; conditional E-value: 9.1e-05 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCG 24 +cg+ g + Cp+++CC ++G C 35298|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 99 RCGS--GIAVCPSGQCCRSYGSCA 120 5885..779**************5 PP == domain 4 score: 34.5 bits; conditional E-value: 9.4e-13 CBM18.hmm 11 CplnaCCskwGyCGttsdYCgkgCqs 36 C++++CCs++G+CGt+++YCg gCq+ 35298|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 119 CAPGLCCSQYGWCGTSEEYCGVGCQN 144 *************************6 PP == domain 5 score: 24.9 bits; conditional E-value: 9.6e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 +cg ag Cp+++CCs++G+C +++++Cg gCq+n 35298|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 157 RCG--AGYGVCPSGQCCSQYGWCENSDEHCGIGCQKN 191 588..5889**************************87 PP == domain 6 score: 28.5 bits; conditional E-value: 7.2e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 +cgk ++ +Cp+++CCs+ GyCG ++++Cg gCq+n 35298|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 215 RCGK--DNGKCPEGQCCSNKGYCGDSDAHCGVGCQKN 249 6998..89***************************87 PP == domain 7 score: 27.0 bits; conditional E-value: 2.1e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 +cgk + Cp+++CCs+ G+CG +YCg gCq+n 35298|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 261 RCGK--KYGICPKGKCCSSEGWCGKDVAYCGVGCQNN 295 6897..6699*************************86 PP == domain 8 score: 27.1 bits; conditional E-value: 2e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 cg+ g Cp+++CCs+ G+CGt++++Cg+gCq n 35298|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 305 CGP--GIGSCPEGQCCSSKGWCGTSDAHCGTGCQVN 338 664..6689*************************65 PP == domain 9 score: 36.3 bits; conditional E-value: 2.5e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + Cp+++CCsk+G+CGt++dYCg+gCq+ 35298|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 353 CGS--DYGSCPDGQCCSKYGWCGTGEDYCGDGCQQ 385 885..6799*************************7 PP == domain 10 score: 35.5 bits; conditional E-value: 4.6e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg.kgCqs 36 cg++++++ Cp+++CCsk+GyCG +dYC+ ++Cq+ 35298|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 398 CGPKNSNKICPEGYCCSKYGYCGKDNDYCSaDNCQK 433 *****************************9468*96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (438 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.01 // Query: 1177073|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 [L=892] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-36 111.2 124.2 1.7e-11 30.4 19.6 5.7 5 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.4 17.3 3.2e-10 3.2e-10 1 36 [. 506 543 .. 506 548 .. 0.93 2 ! 26.4 17.3 3.2e-10 3.2e-10 1 36 [. 589 626 .. 589 631 .. 0.93 3 ! 30.4 19.6 1.7e-11 1.7e-11 1 36 [. 670 707 .. 670 714 .. 0.94 4 ! 26.3 16.3 3.4e-10 3.4e-10 2 36 .. 754 788 .. 752 791 .. 0.85 5 ! 26.4 21.7 3.3e-10 3.3e-10 2 36 .. 851 885 .. 849 890 .. 0.85 Alignments for each domain: == domain 1 score: 26.4 bits; conditional E-value: 3.2e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cgk+ g++ C++++CCsk+G+C +++++C+ +gCq+ 1177073|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 506 RCGKEFGDAVCENDSCCSKYGWCDYSQAHCDinQGCQK 543 6*****************************86689*97 PP == domain 2 score: 26.4 bits; conditional E-value: 3.2e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cgk+ g++ C++++CCsk+G+C +++++C+ +gCq+ 1177073|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 589 RCGKEFGDAVCENDSCCSKYGWCDYSQAHCDinQGCQK 626 6*****************************86689*97 PP == domain 3 score: 30.4 bits; conditional E-value: 1.7e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cgk+ g+++C++++CCsk+G+CG+t+++C+ +gCq+ 1177073|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 670 RCGKEFGDAKCEDGSCCSKYGWCGYTQAHCDikQGCQE 707 6*****************************76689*96 PP == domain 4 score: 26.3 bits; conditional E-value: 3.4e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg g Cp+++CCsk+G+CGt+s +C+ gCq+ 1177073|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 754 CGD--GIGICPNGLCCSKYGWCGTSSGHCDieRGCQK 788 663..5589********************86579*96 PP == domain 5 score: 26.4 bits; conditional E-value: 3.3e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg + +Cp+++CCsk+G+CGt+s++C+ gCqs 1177073|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 851 CGG--EYGKCPNGQCCSKYGWCGTSSAHCDvnRGCQS 885 664..5589********************84459**9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (892 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.74 // Query: 9696|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18 [L=287] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-11 29.6 18.5 3.3e-11 29.6 18.5 2.2 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.8 0.3 0.2 0.2 23 31 .. 138 144 .. 134 150 .. 0.64 2 ! 29.6 18.5 3.3e-11 3.3e-11 2 35 .. 240 275 .. 239 281 .. 0.93 Alignments for each domain: == domain 1 score: -1.8 bits; conditional E-value: 0.2 CBM18.hmm 23 CGttsdYCg 31 CG +YC+ 9696|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18 138 CGL--TYCS 144 333..4676 PP == domain 2 score: 29.6 bits; conditional E-value: 3.3e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCq 35 cg + g+++Cp+++CCs GyCGtt+ +C ++Cq 9696|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18 240 CGAKYGNAKCPTGQCCSYKGYCGTTKSFCAiaNNCQ 275 9****************************7558999 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (287 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 41.60 // Query: 1181130|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18 [L=621] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-22 65.0 78.3 2.2e-10 26.9 25.8 3.7 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.4 18.2 6.5e-10 6.5e-10 2 35 .. 410 441 .. 409 443 .. 0.92 2 ! 24.2 18.2 1.5e-09 1.5e-09 2 35 .. 486 517 .. 485 519 .. 0.92 3 ! 26.9 25.8 2.2e-10 2.2e-10 1 36 [. 581 614 .. 581 619 .. 0.92 Alignments for each domain: == domain 1 score: 25.4 bits; conditional E-value: 6.5e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ + +C +++CCsk+GyC ts++Cg gCq 1181130|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18 410 CGP--SYGKCSSGYCCSKYGYCDKTSQHCGVGCQ 441 786..5689************************9 PP == domain 2 score: 24.2 bits; conditional E-value: 1.5e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ + +C +++CCs +GyC ts++Cg gCq 1181130|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18 486 CGP--SYGKCGSGYCCSRYGYCDKTSQHCGVGCQ 517 786..5689************************9 PP == domain 3 score: 26.9 bits; conditional E-value: 2.2e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+ g C++++CCsk+GyCG +++YC++gCqs 1181130|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18 581 RCGS--GYGSCKSGYCCSKYGYCGKSNEYCEAGCQS 614 5885..889**************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (621 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 72.12 // Query: 291311|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18 [L=849] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.7e-32 95.4 73.8 7e-14 38.1 19.5 3.5 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.8 20.5 7.9e-13 7.9e-13 2 36 .. 591 623 .. 590 629 .. 0.88 2 ! 38.1 19.5 7e-14 7e-14 2 36 .. 663 695 .. 662 700 .. 0.90 3 ! 34.6 17.7 9e-13 9e-13 1 36 [. 809 842 .. 809 847 .. 0.92 Alignments for each domain: == domain 1 score: 34.8 bits; conditional E-value: 7.9e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + C +n+CCsk+G+CG+ts+YCgkgCqs 291311|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18 591 CGD--EIGICGDNLCCSKYGWCGNTSEYCGKGCQS 623 564..4478*************************9 PP == domain 2 score: 38.1 bits; conditional E-value: 7e-14 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCs++G+CG+tsdYCgkgCqs 291311|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18 663 CGP--NVAVCAKGLCCSQYGWCGSTSDYCGKGCQS 695 775..4599*************************9 PP == domain 3 score: 34.6 bits; conditional E-value: 9e-13 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ + + C++++CCsk+G+CG+ ++YCg+gCqs 291311|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18 809 QCGP--DVAVCAEGLCCSKYGWCGNDDAYCGAGCQS 842 6887..559**************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (849 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 90.98 // Query: 15138|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 [L=1271] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-20 57.4 66.0 1e-10 28.0 15.2 3.4 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.3 16.8 4.5e-07 4.5e-07 1 36 [. 1102 1137 .. 1102 1142 .. 0.87 2 ! 28.0 15.2 1e-10 1e-10 1 35 [. 1179 1213 .. 1179 1215 .. 0.88 3 ! 25.0 18.1 8.7e-10 8.7e-10 2 36 .. 1233 1267 .. 1232 1268 .. 0.87 Alignments for each domain: == domain 1 score: 16.3 bits; conditional E-value: 4.5e-07 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cgk + +C +++CCsk+G+CG + +C+ +gC s 15138|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 1102 RCGK--NIGRCIEGECCSKYGWCGRSIYHCKieEGCDS 1137 5887..5589********************76589*98 PP == domain 2 score: 28.0 bits; conditional E-value: 1e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCq 35 qcgk + Cp++ CCs+ G+CG t++YC +gCq 15138|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 1179 QCGK--DIGSCPDGFCCSQHGWCGKTDQYCRleEGCQ 1213 7998..5589********************65589*9 PP == domain 3 score: 25.0 bits; conditional E-value: 8.7e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cgk g C++++CC+++G+CG t++YC +gCq 15138|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 1233 CGK--GIGSCKEGYCCNQYGWCGKTDKYCRleEGCQP 1267 886..7799********************6558**95 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1271 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 106.62 // Query: 292216|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 [L=86] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-15 42.4 21.8 3.2e-15 42.4 21.8 1.9 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.9 0.1 0.22 0.22 9 14 .. 23 28 .. 18 30 .. 0.68 2 ! 42.4 21.8 3.2e-15 3.2e-15 1 36 [. 45 79 .. 45 84 .. 0.91 Alignments for each domain: == domain 1 score: -1.9 bits; conditional E-value: 0.22 CBM18.hmm 9 ntCpln 14 n+C++n 292216|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 23 NECNTN 28 567665 PP == domain 2 score: 42.4 bits; conditional E-value: 3.2e-15 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cgk+ + Cp+++CCsk+G+CGtt+dYC++gCq+ 292216|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 45 RCGKDF-RKSCPNGQCCSKYGWCGTTKDYCSTGCQK 79 699865.799*************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (86 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 15.41 // Query: 35000|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 [L=164] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-25 75.2 86.3 3.3e-13 36.0 19.5 5.2 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.0 19.5 3.3e-13 3.3e-13 2 36 .. 2 34 .. 1 39 [. 0.90 2 ! 26.6 20.7 2.8e-10 2.8e-10 2 36 .. 53 85 .. 52 90 .. 0.92 3 ? 1.9 0.7 0.015 0.015 16 25 .. 83 92 .. 83 97 .. 0.80 4 ! 17.7 32.7 1.6e-07 1.6e-07 2 36 .. 126 158 .. 89 163 .. 0.93 Alignments for each domain: == domain 1 score: 36.0 bits; conditional E-value: 3.3e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk GyCG+ts+YCg+gCqs 35000|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 2 CGE--NIAVCKKGLCCSKKGYCGSTSAYCGTGCQS 34 775..5599*************************9 PP == domain 2 score: 26.6 bits; conditional E-value: 2.8e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk g +tC++++CCs GyCG t+++Cgk C+s 35000|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 53 CGK--GVATCQEGLCCSYKGYCGKTNAHCGKDCKS 85 997..77**************************98 PP == domain 3 score: 1.9 bits; conditional E-value: 0.015 CBM18.hmm 16 CCskwGyCGt 25 C s++G CG+ 35000|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 83 CKSEFGKCGI 92 5589*****7 PP == domain 4 score: 17.7 bits; conditional E-value: 1.6e-07 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + C ++CCs++GyCGt+++YC++gC++ 35000|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 126 CGP--SYGVCRRGYCCSQYGYCGTSAQYCSTGCNK 158 665..5578999*********************86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (164 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 3.11 // Query: 617103|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18 [L=619] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-11 31.1 24.2 1.8e-11 30.4 24.2 1.4 1 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.4 24.2 1.8e-11 1.8e-11 2 36 .. 580 612 .. 578 617 .. 0.91 Alignments for each domain: == domain 1 score: 30.4 bits; conditional E-value: 1.8e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + +Cp+++CCsk+GyCGt YCg+gCqs 617103|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18 580 CGS--EYGKCPNGLCCSKYGYCGTETGYCGAGCQS 612 885..779**************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (619 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.75 // Query: 1191807|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 [L=454] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-21 62.2 52.4 2.2e-15 42.9 24.7 5.3 8 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.4 0.28 0.28 26 35 .. 49 68 .. 38 70 .. 0.70 2 ? -3.4 0.1 0.68 0.68 6 12 .. 99 105 .. 96 106 .. 0.73 3 ? -2.3 0.3 0.31 0.31 8 16 .. 131 139 .. 128 143 .. 0.58 4 ? -3.0 0.1 0.51 0.51 27 35 .. 213 231 .. 211 232 .. 0.58 5 ? -3.4 0.1 0.64 0.64 4 12 .. 260 268 .. 259 269 .. 0.76 6 ? -1.7 0.2 0.2 0.2 11 22 .. 297 307 .. 291 307 .. 0.63 7 ! 33.2 19.7 2.4e-12 2.4e-12 1 36 [. 356 392 .. 356 397 .. 0.90 8 ! 42.9 24.7 2.2e-15 2.2e-15 1 36 [. 412 447 .. 412 452 .. 0.96 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.28 CBM18.hmm 26 tsdYCgk..........gCq 35 +++C + Cq 1191807|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 49 DNEFCHNfifdyenaltECQ 68 57888876666666665666 PP == domain 2 score: -3.4 bits; conditional E-value: 0.68 CBM18.hmm 6 aggntCp 12 +gn+Cp 1191807|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 99 ENGNECP 105 5789998 PP == domain 3 score: -2.3 bits; conditional E-value: 0.31 CBM18.hmm 8 gntCplnaC 16 +++C + +C 1191807|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 131 NKQCRSTKC 139 556655544 PP == domain 4 score: -3.0 bits; conditional E-value: 0.51 CBM18.hmm 27 sdYCgk..........gCq 35 s++C++ Cq 1191807|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 213 SEHCQNfifsymdilpECQ 231 6788765555555555555 PP == domain 5 score: -3.4 bits; conditional E-value: 0.64 CBM18.hmm 4 kqaggntCp 12 k+ +g++Cp 1191807|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 260 KDENGKECP 268 567899998 PP == domain 6 score: -1.7 bits; conditional E-value: 0.2 CBM18.hmm 11 CplnaCCskwGy 22 C ++ Cs++Gy 1191807|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 297 CYSKM-CSEAGY 307 54443.788887 PP == domain 7 score: 33.2 bits; conditional E-value: 2.4e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgk..gCqs 36 +cgk ++g++Cp+++CCsk GyCGtt++YC+ gCqs 1191807|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 356 KCGK-NNGKKCPSDKCCSKHGYCGTTDKYCSVelGCQS 392 5996.789**********************96679**9 PP == domain 8 score: 42.9 bits; conditional E-value: 2.2e-15 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cgk++g+++Cp+n+CCsk+GyCGt+s+YCg+gCqs 1191807|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 412 KCGKKNGNQKCPSNECCSKYGYCGTKSNYCGNGCQS 447 6**********************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (454 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 50.61 // Query: 863862|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=1828] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-24 72.4 130.7 4.6e-11 29.1 25.3 6.5 6 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 4.8 8.9 0.0018 0.0018 2 19 .. 31 47 .. 30 64 .. 0.76 2 ? 0.3 1.0 0.046 0.046 8 26 .. 290 309 .. 286 311 .. 0.72 3 ! 23.3 19.6 3e-09 3e-09 2 36 .. 1603 1637 .. 1602 1642 .. 0.89 4 ! 21.8 16.9 9.1e-09 9.1e-09 1 36 [. 1656 1691 .. 1656 1696 .. 0.88 5 ! 23.1 19.9 3.4e-09 3.4e-09 2 36 .. 1711 1745 .. 1710 1750 .. 0.89 6 ! 29.1 25.3 4.6e-11 4.6e-11 1 36 [. 1787 1820 .. 1787 1825 .. 0.92 Alignments for each domain: == domain 1 score: 4.8 bits; conditional E-value: 0.0018 CBM18.hmm 2 cgkqaggntCplnaCCsk 19 cg+ +g+ Cp+n+CCs+ 863862|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 31 CGS-ENGKNCPDNYCCSN 47 895.6799*********8 PP == domain 2 score: 0.3 bits; conditional E-value: 0.046 CBM18.hmm 8 gntCpln.aCCskwGyCGtt 26 +++C+ + C k+G+C+ t 863862|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 290 NKKCNIDkGCDAKFGFCNDT 309 6889777245556****876 PP == domain 3 score: 23.3 bits; conditional E-value: 3e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cgk g +C++n+CCsk+G+CG ++ +C+ +gCqs 863862|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 1603 CGK--GIGRCKKNECCSKYGWCGRSNSHCSieNGCQS 1637 886..7799********************76689**9 PP == domain 4 score: 21.8 bits; conditional E-value: 9.1e-09 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cgk g +C++n+CCsk+G+CG + +C+ +gCqs 863862|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 1656 RCGK--GIGRCKENECCSKFGWCGKLNIHCSveNGCQS 1691 5886..7799********************85579**9 PP == domain 5 score: 23.1 bits; conditional E-value: 3.4e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cgk g +C++n+CCsk+G+CG ++ +C+ +gCqs 863862|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 1711 CGK--GIGRCKENECCSKYGWCGRSNSHCSieNGCQS 1745 886..7799********************76689**9 PP == domain 6 score: 29.1 bits; conditional E-value: 4.6e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cgk + +C +++CCsk+GyCG +sdYCgkgCqs 863862|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 1787 RCGK--NYGKCSSGYCCSKYGYCGKSSDYCGKGCQS 1820 6997..6699*************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1828 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 110.94 // Query: 397613|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 [L=453] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-49 151.1 159.3 1.8e-12 33.6 19.1 6.8 6 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.4 23.2 1.6e-10 1.6e-10 2 36 .. 3 37 .. 2 42 .. 0.88 2 ! 31.4 16.8 8.8e-12 8.8e-12 1 36 [. 99 134 .. 99 137 .. 0.90 3 ! 31.8 16.5 6.4e-12 6.4e-12 1 36 [. 183 218 .. 183 220 .. 0.86 4 ! 33.6 19.1 1.8e-12 1.8e-12 1 37 [. 261 297 .. 261 301 .. 0.90 5 ! 30.8 20.0 1.4e-11 1.4e-11 2 36 .. 338 372 .. 335 381 .. 0.87 6 ! 27.1 23.6 1.9e-10 1.9e-10 2 36 .. 412 446 .. 411 451 .. 0.88 Alignments for each domain: == domain 1 score: 27.4 bits; conditional E-value: 1.6e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg+ g +C++++CCs++G+CG ++dYC+ kgCq+ 397613|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 3 CGE--GYGKCANGYCCSQYGWCGKSEDYCDvqKGCQE 37 885..779*********************75589*96 PP == domain 2 score: 31.4 bits; conditional E-value: 8.8e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYC..gkgCqs 36 +cgk + Cp+++CCsk+G+CG ts+YC ++gCq+ 397613|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 99 RCGK--EYGSCPDGECCSKYGWCGETSEYCfiNEGCQK 134 6997..6799********************7669**96 PP == domain 3 score: 31.8 bits; conditional E-value: 6.4e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYC..gkgCqs 36 +cgk + Cp+++CCsk+G+CG ts+YC + gCq+ 397613|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 183 RCGK--EYGSCPDGECCSKYGWCGKTSEYClvDGGCQK 218 6997..6799********************43358*96 PP == domain 4 score: 33.6 bits; conditional E-value: 1.8e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYC..gkgCqsn 37 +cgk ++ Cp+++CCsk+G+CG ts+YC ++gCq+n 397613|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 261 RCGK--DNGSCPDGECCSKYGWCGKTSEYCliNEGCQKN 297 6998..899*********************5559***87 PP == domain 5 score: 30.8 bits; conditional E-value: 1.4e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg + Cp+++CCsk+G+CG t+dYC+ gCq+ 397613|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 338 CGD--EYGSCPNGECCSKYGWCGKTNDYCSvsRGCQK 372 774..5689********************84459*96 PP == domain 6 score: 27.1 bits; conditional E-value: 1.9e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg+ g +Cp+++CCsk+G+CG +s+YC+ +gCqs 397613|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 412 CGE--GYGKCPNGQCCSKYGWCGQSSAYCSvsSGCQS 446 885..779*********************84469**9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (453 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 46.51 // Query: 622576|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=534] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-13 36.5 47.1 1.5e-10 27.4 20.0 6.5 5 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 4.4 23.1 0.0024 0.0024 14 36 .. 234 268 .. 224 273 .. 0.71 2 ? 1.0 0.4 0.028 0.028 14 25 .. 264 275 .. 262 278 .. 0.81 3 ! 27.4 20.0 1.5e-10 1.5e-10 2 36 .. 280 314 .. 279 319 .. 0.94 4 ? -9.6 18.4 1 1 2 35 .. 345 381 .. 343 393 .. 0.70 5 ! 23.3 19.0 3e-09 3e-09 2 37 .. 477 511 .. 476 512 .. 0.86 Alignments for each domain: == domain 1 score: 4.4 bits; conditional E-value: 0.0024 CBM18.hmm 14 n..........aCCskwGyCGttsdYCgk..gCqs 36 + +CCsk G CG+t+ +C+k +C+s 622576|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 234 GygfcdvstinSCCSKDGTCGYTDYHCSKrnKCNS 268 333333335569***************97436876 PP == domain 2 score: 1.0 bits; conditional E-value: 0.028 CBM18.hmm 14 naCCskwGyCGt 25 n+C s +G+C t 622576|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 264 NKCNSDYGVCST 275 789999****65 PP == domain 3 score: 27.4 bits; conditional E-value: 1.5e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg++ + C+ n+CC++ G+CGt+++YCg +Cqs 622576|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 280 CGPKYNYEVCQANECCGEDGVCGTGEEYCGVKCQS 314 9**99*****************************9 PP == domain 4 score: -9.6 bits; conditional E-value: 1 CBM18.hmm 2 cgkqaggntCplnaCCskwGyC...GttsdYCg..kgCq 35 cg+ g +C +CC + G+C + + C+ +gCq 622576|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 345 CGP--GYGRCSIFNCCTEDGQCvsaYSEKSQCQlsNGCQ 381 665..667888889********66533333454334555 PP == domain 5 score: 23.3 bits; conditional E-value: 3e-09 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCgkgCqsn 37 cg+ + C ++ +CCsk+ +CGt++++Cg+gCq n 622576|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 477 CGP--NYGACSNSkYCCSKYDWCGTSDKHCGEGCQPN 511 776..557897777*********************65 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (534 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 13.57 // Query: 363451|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 [L=387] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-16 45.1 44.6 4.8e-12 32.2 17.2 4.5 5 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.9 0.13 0.13 27 38 .] 47 58 .. 45 60 .. 0.69 2 ? -2.7 0.3 0.39 0.39 2 12 .. 98 108 .. 97 110 .. 0.82 3 ? 0.3 0.1 0.046 0.046 7 16 .. 129 138 .. 125 142 .. 0.80 4 ! 26.6 19.4 2.8e-10 2.8e-10 1 35 [. 210 243 .. 210 245 .. 0.87 5 ! 32.2 17.2 4.8e-12 4.8e-12 2 35 .. 347 379 .. 346 382 .. 0.86 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.13 CBM18.hmm 27 sdYCgkgCqsnC 38 ++YC++ s+C 363451|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 47 NQYCTSFNSSKC 58 689998555555 PP == domain 2 score: -2.7 bits; conditional E-value: 0.39 CBM18.hmm 2 cgkqaggntCp 12 c k+ +++ C+ 363451|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 98 CEKDENNKMCN 108 88999999996 PP == domain 3 score: 0.3 bits; conditional E-value: 0.046 CBM18.hmm 7 ggntCplnaC 16 ++tC++++C 363451|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 129 INATCKNDKC 138 5799**9999 PP == domain 4 score: 26.6 bits; conditional E-value: 2.8e-10 CBM18.hmm 1 qcgkqaggntCpln.aCCskwGyCGttsdYCgkgCq 35 +cg+ + +C ++ CCs+ GyCGtt++YCg+gCq 363451|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 210 RCGP--KYGKCSKStDCCSSKGYCGTTNAYCGAGCQ 243 5886..5689977669*******************9 PP == domain 5 score: 32.2 bits; conditional E-value: 4.8e-12 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCgkgCq 35 cg+ + +C+++ +CCsk+GyCG ts+YC++gCq 363451|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 347 CGP--SYGRCANSnLCCSKYGYCGKTSAYCDTGCQ 379 776..558997666********************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (387 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 44.65 // Query: 18016|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 [L=126] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-19 54.2 54.3 1.6e-12 33.8 24.1 2.9 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 23.1 24.8 3.3e-09 3.3e-09 2 36 .. 41 73 .. 35 78 .. 0.88 2 ! 33.8 24.1 1.6e-12 1.6e-12 2 37 .. 87 120 .. 77 124 .. 0.91 Alignments for each domain: == domain 1 score: 23.1 bits; conditional E-value: 3.3e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + Cp+++CCs+ G CG t ++Cg+gCq+ 18016|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 41 CGG--NYGSCPSGYCCSQNGLCGKTGEHCGAGCQK 73 663..4489*************************7 PP == domain 2 score: 33.8 bits; conditional E-value: 1.6e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 cg+ + Cp+++CCsk+G+CG tsdYC++gCq n 18016|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 87 CGE--SYGVCPSGYCCSKYGWCGKTSDYCSSGCQRN 120 775..5689*************************86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (126 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 3.99 // Query: 1182615|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 [L=360] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-18 51.2 46.2 1.9e-11 30.3 18.1 3.0 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.7 20.1 5.1e-10 5.1e-10 2 36 .. 207 241 .. 206 246 .. 0.88 2 ! 30.3 18.1 1.9e-11 1.9e-11 1 36 [. 273 308 .. 273 318 .. 0.90 Alignments for each domain: == domain 1 score: 25.7 bits; conditional E-value: 5.1e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg+ ++ Cp+++CCsk+G+CG ++ YC+ gCqs 1182615|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 207 CGP--EDGVCPSGQCCSKYGWCGKSEGYCKieYGCQS 241 886..7899********************7557***9 PP == domain 2 score: 30.3 bits; conditional E-value: 1.9e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cg+ ++ Cp+++CCsk+G+CG ++d+C+ +gCqs 1182615|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 273 RCGP--KDGVCPSGECCSKYGWCGKSKDHCKieNGCQS 308 5886..7899********************76589**9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (360 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 50.83 // Query: 330233|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=880] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-33 98.5 105.4 1e-11 31.2 19.8 4.9 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.1 20.8 2.2e-11 2.2e-11 2 36 .. 587 620 .. 586 625 .. 0.84 2 ! 31.2 19.8 1e-11 1e-11 2 36 .. 672 705 .. 671 714 .. 0.85 3 ! 28.5 19.4 7e-11 7e-11 2 36 .. 756 789 .. 755 794 .. 0.86 4 ! 26.6 21.5 2.7e-10 2.7e-10 2 36 .. 840 873 .. 839 878 .. 0.85 Alignments for each domain: == domain 1 score: 30.1 bits; conditional E-value: 2.2e-11 CBM18.hmm 2 cgkqaggntC.plnaCCskwGyCGttsdYCgkgCqs 36 cg+ + C + ++CCsk+GyCG t+dYCg+gCqs 330233|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 587 CGP--EYGACsDAGHCCSKYGYCGVTDDYCGTGCQS 620 775..557895556*********************9 PP == domain 2 score: 31.2 bits; conditional E-value: 1e-11 CBM18.hmm 2 cgkqaggntC.plnaCCskwGyCGttsdYCgkgCqs 36 cg+ + C + ++CCsk+GyCG t+dYCg+gCqs 330233|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 672 CGP--EYGACsDAGHCCSKYGYCGVTDDYCGTGCQS 705 775..557895556*********************9 PP == domain 3 score: 28.5 bits; conditional E-value: 7e-11 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCgkgCqs 36 cg+ + C+ + +CCsk+GyCG t+++Cg+gCqs 330233|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 756 CGP--DFGACAHKgYCCSKYGYCGKTDAHCGTGCQS 789 776..557896666*********************9 PP == domain 4 score: 26.6 bits; conditional E-value: 2.7e-10 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCgkgCqs 36 cg+ + C+++ +CCsk+GyCG t+++Cg+gCqs 330233|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 840 CGP--EYGACAKSgYCCSKYGYCGKTDKHCGTGCQS 873 776..557896655*********************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (880 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 46.07 // Query: 622993|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 [L=878] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-38 114.7 137.1 7.1e-12 31.7 21.8 5.5 5 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.8 18.1 5e-10 5e-10 1 36 [. 594 627 .. 594 632 .. 0.92 2 ! 28.4 20.7 7.5e-11 7.5e-11 2 36 .. 650 682 .. 649 687 .. 0.90 3 ! 31.7 21.8 7.1e-12 7.1e-12 2 36 .. 715 747 .. 714 752 .. 0.91 4 ! 30.5 21.8 1.7e-11 1.7e-11 2 36 .. 780 812 .. 779 817 .. 0.90 5 ! 23.3 22.8 2.9e-09 2.9e-09 2 36 .. 838 871 .. 837 876 .. 0.92 Alignments for each domain: == domain 1 score: 25.8 bits; conditional E-value: 5e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+ g ++C+++ CC+ G+CG t+ YCg+gCqs 622993|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 594 RCGR--GIARCAEGWCCNIHGFCGKTEYYCGQGCQS 627 5886..779**************************9 PP == domain 2 score: 28.4 bits; conditional E-value: 7.5e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g Cp+++CCs++G CG+++++Cg gCqs 622993|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 650 CGQ--GIGSCPEGSCCSQYGTCGINPEHCGRGCQS 682 775..6689*************************9 PP == domain 3 score: 31.7 bits; conditional E-value: 7.1e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g +C+++ CCsk+GyCG++sdYCg+gCqs 622993|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 715 CGQ--GVGKCEKGFCCSKYGYCGISSDYCGQGCQS 747 885..679**************************9 PP == domain 4 score: 30.5 bits; conditional E-value: 1.7e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g +C+++ CCsk+GyCGt+sd+Cg+gCqs 622993|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 780 CGQ--GIGKCNEGFCCSKYGYCGTSSDHCGQGCQS 812 664..6689*************************9 PP == domain 5 score: 23.3 bits; conditional E-value: 2.9e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + g++C+++ CCs GyCG t+ YCg+gCq+ 622993|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 838 CG-AMYGQRCADGWCCSANGYCGKTEFYCGNGCQK 871 88.4789***************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (878 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.37 // Query: 871131|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 [L=786] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-26 77.1 78.3 4.5e-12 32.3 20.4 3.4 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.3 19.8 3.9e-11 3.9e-11 2 36 .. 594 626 .. 593 631 .. 0.91 2 ! 32.3 20.4 4.5e-12 4.5e-12 2 36 .. 675 707 .. 674 712 .. 0.91 3 ! 27.6 22.1 1.3e-10 1.3e-10 2 36 .. 747 779 .. 746 784 .. 0.91 Alignments for each domain: == domain 1 score: 29.3 bits; conditional E-value: 3.9e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg ag + C +++CCsk+G+CG t +YCg+gCqs 871131|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 594 CG--AGIAVCSPGYCCSKYGHCGKTFEYCGAGCQS 626 77..57899*************************9 PP == domain 2 score: 32.3 bits; conditional E-value: 4.5e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg ag + C++++CCsk+GyCG+t +YCg+gCqs 871131|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 675 CG--AGVAICAPGYCCSKYGYCGNTFEYCGAGCQS 707 77..58899*************************9 PP == domain 3 score: 27.6 bits; conditional E-value: 1.3e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + + C++++CCs++GyCG +s+YC++gCq+ 871131|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 747 CGK--NIAICAKGYCCSQYGYCGKSSNYCSSGCQK 779 886..5599*************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (786 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 86.24 // Query: 328357|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=417] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-34 102.6 118.4 4.4e-13 35.6 19.0 6.5 5 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.3 18.9 1.1e-12 1.1e-12 2 36 .. 25 59 .. 24 61 .. 0.97 2 ! 35.6 19.0 4.4e-13 4.4e-13 2 36 .. 120 154 .. 119 156 .. 0.97 3 ! 29.7 20.9 3e-11 3e-11 2 36 .. 228 262 .. 227 267 .. 0.96 4 ! 27.9 24.9 1.1e-10 1.1e-10 1 36 [. 337 372 .. 337 377 .. 0.96 5 ? -2.2 4.6 0.27 0.27 18 34 .. 372 393 .. 372 399 .. 0.79 Alignments for each domain: == domain 1 score: 34.3 bits; conditional E-value: 1.1e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg++ g+++Cp+++CCsk G+CG +++CgkgCqs 328357|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 25 CGPKYGNKKCPGSQCCSKDGQCGFDKKHCGKGCQS 59 9*********************************9 PP == domain 2 score: 35.6 bits; conditional E-value: 4.4e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg++ g+++Cp+++CCsk G+CG +++CgkgCqs 328357|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 120 CGPKYGNKKCPGSQCCSKDGQCGFDKEHCGKGCQS 154 **********************************9 PP == domain 3 score: 29.7 bits; conditional E-value: 3e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg++ g+++Cp+n+CC+ G+CG ++Cg+gCqs 328357|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 228 CGPKYGDKKCPDNQCCNADGQCGFDREHCGNGCQS 262 **********************************9 PP == domain 4 score: 27.9 bits; conditional E-value: 1.1e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++ g+++Cp+++CC++ G+CG +YCgkgCqs 328357|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 337 RCGPKYGNKKCPGDECCNSKGQCGFDRNYCGKGCQS 372 6**********************************9 PP == domain 5 score: -2.2 bits; conditional E-value: 0.27 CBM18.hmm 18 skwGyC...GttsdYCgk..gC 34 s++GyC G + C + gC 328357|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 372 SEFGYClpkGFEHAMCIQcvGC 393 789***9999999999854455 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (417 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 12.47 // Query: 324232|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=789] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-27 80.0 98.6 3.7e-10 26.2 16.5 4.6 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.9 21.0 4.4e-10 4.4e-10 1 36 [. 515 550 .. 515 555 .. 0.90 2 ! 26.2 16.5 3.7e-10 3.7e-10 2 36 .. 599 633 .. 598 635 .. 0.90 3 ! 24.0 18.4 1.8e-09 1.8e-09 2 36 .. 667 701 .. 666 703 .. 0.88 4 ! 22.0 18.7 7.7e-09 7.7e-09 2 37 .. 748 783 .. 747 787 .. 0.88 Alignments for each domain: == domain 1 score: 25.9 bits; conditional E-value: 4.4e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 qcg+ ++ C +++CCsk+G+CG t+d+C+ kgCq+ 324232|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 515 QCGS--TNGSCSEGYCCSKYGWCGKTQDHCDisKGCQE 550 7995..899*********************7669**96 PP == domain 2 score: 26.2 bits; conditional E-value: 3.7e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg ++ C +++CCsk+G+CG +d+C+ kgCq+ 324232|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 599 CGG--TNGSCSEGYCCSKYGWCGKEQDHCDivKGCQK 633 785..789*********************8779**96 PP == domain 3 score: 24.0 bits; conditional E-value: 1.8e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cgk + C +n+CCsk+G+CG ++++C+ +gCq+ 324232|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 667 CGK--DYGSCGNNECCSKSGWCGKSDKHCEisQGCQK 701 897..6689********************65589*96 PP == domain 4 score: 22.0 bits; conditional E-value: 7.7e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYC..gkgCqsn 37 cg+ g C ++ CCsk G+CGt+ ++C +kgCq n 324232|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 748 CGE--GHGVCSKGFCCSKLGWCGTSTEHCaiSKGCQTN 783 885..889*********************5559***86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (789 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 76.12 // Query: 1175145|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 [L=93] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-14 40.3 18.5 1.9e-14 39.9 18.5 1.1 1 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.9 18.5 1.9e-14 1.9e-14 1 35 [. 8 41 .. 8 43 .. 0.93 Alignments for each domain: == domain 1 score: 39.9 bits; conditional E-value: 1.9e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 qcgk + g+ C+ ++CCs++GyCG t++YC+ gCq 1175145|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 8 QCGK-KVGKSCKAGYCCSQYGYCGKTPEYCDVGCQ 41 7997.5589*************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (93 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 18.15 // Query: 526370|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18 [L=618] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-12 33.8 19.9 1.6e-12 33.8 19.9 2.5 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.2 0.69 0.69 17 21 .. 142 146 .. 133 147 .. 0.55 2 ! 33.8 19.9 1.6e-12 1.6e-12 2 36 .. 518 550 .. 517 559 .. 0.92 3 ? -3.0 0.1 0.51 0.51 6 16 .. 583 593 .. 579 597 .. 0.74 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.69 CBM18.hmm 17 CskwG 21 Cs+ G 526370|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18 142 CSSLG 146 56655 PP == domain 2 score: 33.8 bits; conditional E-value: 1.6e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C++++CCs++GyCG+t++YCg gCq+ 526370|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18 518 CGE--GVAICANGYCCSQYGYCGNTETYCGVGCQE 550 785..7799*************************6 PP == domain 3 score: -3.0 bits; conditional E-value: 0.51 CBM18.hmm 6 aggntCplnaC 16 +g+ C +++C 526370|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18 583 TTGMVCFKGLC 593 46789999999 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (618 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.80 // Query: 807842|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=845] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-38 115.4 101.3 6e-13 35.1 20.3 4.6 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.4 19.5 9.8e-13 9.8e-13 2 36 .. 590 622 .. 589 627 .. 0.92 2 ! 32.5 20.0 3.9e-12 3.9e-12 2 36 .. 654 686 .. 653 691 .. 0.91 3 ! 35.1 20.3 6e-13 6e-13 2 36 .. 727 759 .. 726 764 .. 0.91 4 ! 31.6 17.5 7.6e-12 7.6e-12 9 36 .. 809 836 .. 799 839 .. 0.90 Alignments for each domain: == domain 1 score: 34.4 bits; conditional E-value: 9.8e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C++n CCsk+GyCGt+s YCgkgCqs 807842|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 590 CGS--GVAVCADNMCCSKYGYCGTSSVYCGKGCQS 622 884..779**************************9 PP == domain 2 score: 32.5 bits; conditional E-value: 3.9e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg a+ + C ++ CCs +GyCGt+s+YCg+gCqs 807842|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 654 CG--ANVAVCGNDMCCSRYGYCGTSSAYCGNGCQS 686 77..46699*************************9 PP == domain 3 score: 35.1 bits; conditional E-value: 6e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg a+ + C ++ CCsk+GyCGtts+YCg+gCqs 807842|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 727 CG--ANVAVCGNDMCCSKYGYCGTTSAYCGNGCQS 759 77..46699*************************9 PP == domain 4 score: 31.6 bits; conditional E-value: 7.6e-12 CBM18.hmm 9 ntCplnaCCskwGyCGttsdYCgkgCqs 36 Cp+++CCsk+GyCG t++YC++gCq+ 807842|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 809 GLCPDEYCCSKYGYCGKTAAYCSTGCQQ 836 68*************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (845 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 86.47 // Query: 580033|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 [L=502] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-11 28.6 22.7 6.3e-11 28.6 22.7 2.6 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.9 0.1 0.22 0.22 22 27 .. 108 113 .. 106 115 .. 0.67 2 ? -1.6 0.2 0.18 0.18 2 13 .. 347 358 .. 346 360 .. 0.85 3 ! 28.6 22.7 6.3e-11 6.3e-11 2 35 .. 463 494 .. 461 497 .. 0.92 Alignments for each domain: == domain 1 score: -1.9 bits; conditional E-value: 0.22 CBM18.hmm 22 yCGtts 27 yCG+++ 580033|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 108 YCGSNK 113 777766 PP == domain 2 score: -1.6 bits; conditional E-value: 0.18 CBM18.hmm 2 cgkqaggntCpl 13 cg +ag+ +C + 580033|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 347 CGISAGNLPCTT 358 999999999975 PP == domain 3 score: 28.6 bits; conditional E-value: 6.3e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ g C++++CCsk+GyCGt+s+YC++gCq 580033|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 463 CGS--GYGACKSGYCCSKYGYCGTSSEYCKSGCQ 494 784..7899************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (502 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 65.93 // Query: 869660|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=854] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-34 104.4 105.8 4.9e-12 32.2 20.4 4.4 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.6 19.3 1.6e-11 1.6e-11 2 36 .. 583 615 .. 582 620 .. 0.91 2 ! 32.2 20.4 5e-12 5e-12 2 36 .. 663 695 .. 662 700 .. 0.91 3 ! 32.2 20.4 4.9e-12 4.9e-12 2 36 .. 743 775 .. 742 780 .. 0.92 4 ! 28.1 21.8 9.7e-11 9.7e-11 2 36 .. 815 847 .. 814 852 .. 0.91 Alignments for each domain: == domain 1 score: 30.6 bits; conditional E-value: 1.6e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg ag + C++++CCsk+G+CG t +YCg+gCqs 869660|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 583 CG--AGIAVCAPGYCCSKYGHCGKTFEYCGAGCQS 615 77..5789**************************9 PP == domain 2 score: 32.2 bits; conditional E-value: 5e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg ag + C++++CCsk+GyCG+t +YCg+gCqs 869660|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 663 CG--AGVAICAPGYCCSKYGYCGNTFEYCGAGCQS 695 77..58899*************************9 PP == domain 3 score: 32.2 bits; conditional E-value: 4.9e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg ag + C++++CCsk+GyCG+t +YCg+gCqs 869660|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 743 CG--AGVAICAPGYCCSKYGYCGNTFEYCGAGCQS 775 77..58899*************************9 PP == domain 4 score: 28.1 bits; conditional E-value: 9.7e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + + C++++CCs++GyCG +s+YC++gCq+ 869660|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 815 CGK--NIAICAKGYCCSQYGYCGKSSKYCSSGCQK 847 886..5599*************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (854 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.89 // Query: 1183345|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=809] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-39 120.3 103.2 5.5e-13 35.3 20.9 4.5 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.8 21.5 1.5e-12 1.5e-12 1 36 [. 555 588 .. 554 593 .. 0.91 2 ! 35.3 20.9 5.5e-13 5.5e-13 2 36 .. 629 661 .. 628 666 .. 0.91 3 ! 35.0 20.6 6.4e-13 6.4e-13 2 36 .. 703 735 .. 702 740 .. 0.91 4 ! 34.7 16.2 8.3e-13 8.3e-13 1 36 [. 769 802 .. 769 805 .. 0.93 Alignments for each domain: == domain 1 score: 33.8 bits; conditional E-value: 1.5e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ + + C+ ++CCsk+GyCG ts+YCg+gCqs 1183345|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 555 QCGP--NVAVCAAGYCCSKYGYCGKTSEYCGTGCQS 588 6886..5599*************************9 PP == domain 2 score: 35.3 bits; conditional E-value: 5.5e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + + C+ ++CCs++GyCG ts+YCg+gCqs 1183345|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 629 CGK--DIAVCAAGYCCSQYGYCGKTSEYCGTGCQS 661 887..569**************************9 PP == domain 3 score: 35.0 bits; conditional E-value: 6.4e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + + C+ ++CCsk+GyCG ts+YCg+gCqs 1183345|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 703 CGK--DIAVCAAGYCCSKYGYCGKTSEYCGTGCQS 735 887..569**************************9 PP == domain 4 score: 34.7 bits; conditional E-value: 8.3e-13 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cgk + + C++++CCsk+GyCG t++YC++gCq+ 1183345|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 769 RCGK--DVAVCETGYCCSKYGYCGKTKTYCEAGCQK 802 6998..569**************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (809 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.68 // Query: 344851|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 [L=268] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-14 38.3 17.8 6e-14 38.3 17.8 2.3 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.8 0.51 0.51 23 26 .. 143 146 .. 136 153 .. 0.62 2 ! 38.3 17.8 6e-14 6e-14 1 37 [. 228 262 .. 228 266 .. 0.93 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.51 CBM18.hmm 23 CGtt 26 CG+ 344851|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 143 CGNY 146 5544 PP == domain 2 score: 38.3 bits; conditional E-value: 6e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 +cg ag ++C +++CCsk+G+CG+t+d+Cg+gCqs+ 344851|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 228 RCG--AGVAKCISGLCCSKYGWCGMTKDHCGSGCQSQ 262 588..588***************************97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (268 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 41.40 // Query: 105875|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=895] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-36 109.1 113.6 7.7e-13 34.8 21.5 4.5 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.8 21.5 7.7e-13 7.7e-13 2 36 .. 585 617 .. 584 622 .. 0.90 2 ! 33.7 20.9 1.6e-12 1.6e-12 2 36 .. 664 696 .. 663 701 .. 0.90 3 ! 33.5 21.3 1.9e-12 1.9e-12 2 36 .. 750 782 .. 749 787 .. 0.89 4 ! 25.5 25.8 6.1e-10 6.1e-10 2 36 .. 856 888 .. 854 893 .. 0.92 Alignments for each domain: == domain 1 score: 34.8 bits; conditional E-value: 7.7e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCs++GyCG+t++YCg+gCqs 105875|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 585 CGP--NVAVCKEGYCCSQYGYCGNTDEYCGNGCQS 617 776..4599*************************9 PP == domain 2 score: 33.7 bits; conditional E-value: 1.6e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCs++GyCG t++YCgkgCqs 105875|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 664 CGP--NVAVCKEGYCCSQYGYCGKTEAYCGKGCQS 696 776..4599*************************9 PP == domain 3 score: 33.5 bits; conditional E-value: 1.9e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCs++GyCG t++YCgkgCqs 105875|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 750 CGP--NVAVCKEGYCCSQYGYCGKTEAYCGKGCQS 782 776..4599*************************9 PP == domain 4 score: 25.5 bits; conditional E-value: 6.1e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g C++++CCsk+GyCG +s+YC++gCq+ 105875|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 856 CGS--GYGSCASGYCCSKYGYCGKSSEYCSTGCQK 888 884..8899*************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (895 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 86.26 // Query: 522135|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=650] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.4e-32 95.3 106.2 1.3e-11 30.9 20.9 5.5 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.2 20.8 4.3e-11 4.3e-11 1 36 [. 399 433 .. 398 439 .. 0.86 2 ! 29.2 20.8 4.3e-11 4.3e-11 1 36 [. 469 503 .. 468 509 .. 0.86 3 ! 30.9 20.9 1.3e-11 1.3e-11 1 36 [. 539 573 .. 538 579 .. 0.86 4 ! 23.1 19.6 3.5e-09 3.5e-09 1 35 [. 609 642 .. 608 645 .. 0.87 Alignments for each domain: == domain 1 score: 29.2 bits; conditional E-value: 4.3e-11 CBM18.hmm 1 qcgkqaggntC.plnaCCskwGyCGttsdYCgkgCqs 36 qcg+ g C ++n+CCs++G+CGt++++Cg+gCqs 522135|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 399 QCGP--GIGACaKSNECCSQYGWCGTSEAHCGTGCQS 433 5775..668895566*********************9 PP == domain 2 score: 29.2 bits; conditional E-value: 4.3e-11 CBM18.hmm 1 qcgkqaggntC.plnaCCskwGyCGttsdYCgkgCqs 36 qcg+ g C ++n+CCs++G+CGt++++Cg+gCqs 522135|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 469 QCGP--GIGACaKSNECCSQYGWCGTSEAHCGTGCQS 503 5775..668895566*********************9 PP == domain 3 score: 30.9 bits; conditional E-value: 1.3e-11 CBM18.hmm 1 qcgkqaggntC.plnaCCskwGyCGttsdYCgkgCqs 36 qcg+ g C ++n+CCs++G+CGt++d+Cg+gCqs 522135|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 539 QCGP--GIGACaKSNECCSQYGWCGTSEDHCGTGCQS 573 5775..668895566*********************9 PP == domain 4 score: 23.1 bits; conditional E-value: 3.5e-09 CBM18.hmm 1 qcgkqaggntCpln.aCCskwGyCGttsdYCgkgCq 35 qcg+ + C+++ +CCs++ +CGt++++Cg+gCq 522135|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 609 QCGS--KYGACAKSgECCSQYDWCGTSDAHCGTGCQ 642 6885..668996655********************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (650 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 70.65 // Query: 526368|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18 [L=665] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-11 28.9 16.7 5.2e-11 28.9 16.7 1.7 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.9 16.7 5.2e-11 5.2e-11 9 36 .. 573 600 .. 567 608 .. 0.91 2 ? -3.7 0.1 0.79 0.79 22 29 .. 647 654 .. 645 654 .. 0.77 Alignments for each domain: == domain 1 score: 28.9 bits; conditional E-value: 5.2e-11 CBM18.hmm 9 ntCplnaCCskwGyCGttsdYCgkgCqs 36 +Cp+n+CCs++GyC ++d+C+ gCqs 526368|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18 573 GKCPDNLCCSQYGYCDDSPDHCSIGCQS 600 69*************************9 PP == domain 2 score: -3.7 bits; conditional E-value: 0.79 CBM18.hmm 22 yCGttsdY 29 +CG + dY 526368|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18 647 QCGDGIDY 654 79988887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (665 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.30 // Query: 622574|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=634] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-15 40.8 101.8 2.2e-10 26.9 18.2 7.2 6 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 6.1 18.5 0.0007 0.0007 8 35 .. 239 271 .. 228 272 .. 0.71 2 ! 11.1 2.7 1.9e-05 1.9e-05 14 33 .. 268 287 .. 266 291 .. 0.88 3 ! 26.9 18.2 2.2e-10 2.2e-10 2 36 .. 284 318 .. 284 323 .. 0.96 4 ? -7.1 19.5 1 1 2 35 .. 349 385 .. 345 391 .. 0.74 5 ? -0.3 3.0 0.069 0.069 7 23 .. 374 391 .. 371 399 .. 0.71 6 ! 25.0 18.1 9.1e-10 9.1e-10 2 35 .. 594 626 .. 593 629 .. 0.87 Alignments for each domain: == domain 1 score: 6.1 bits; conditional E-value: 0.0007 CBM18.hmm 8 gntCpln...aCCskwGyCGttsdYCg..kgCq 35 C+++ +CC+k G CG+++ +C+ ++C+ 622574|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 239 YGFCDPStinSCCGKDGICGYSDHFCNvrNQCN 271 4456444667****************8323455 PP == domain 2 score: 11.1 bits; conditional E-value: 1.9e-05 CBM18.hmm 14 naCCskwGyCGttsdYCgkg 33 n+C s++G+C ++++YCg++ 622574|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 268 NQCNSEFGVCSPSNNYCGPK 287 7899*************985 PP == domain 3 score: 26.9 bits; conditional E-value: 2.2e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg++++ + C+ n+CC++ G+CGt+++YCg +Cqs 622574|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 284 CGPKNDYKVCQFNECCGEDGVCGTGEKYCGVKCQS 318 9*********************************9 PP == domain 4 score: -7.1 bits; conditional E-value: 1 CBM18.hmm 2 cgkqaggntCplnaCCskwGyC...GttsdYCg..kgCq 35 cg+ + +C + +CC+k G C t + C+ kgCq 622574|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 349 CGP--EYGRCGELECCNKDGKCasiFTENSQCQmnKGCQ 385 775..5689*999*********65545555676445777 PP == domain 5 score: -0.3 bits; conditional E-value: 0.069 CBM18.hmm 7 ggntCplnaCCsk.wGyC 23 ++++C+ n+ C +G C 622574|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 374 ENSQCQMNKGCQPnYGLC 391 688999995555449999 PP == domain 6 score: 25.0 bits; conditional E-value: 9.1e-10 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCgkgCq 35 cg+ + C++ +CCs++ +CGt++++Cg+gCq 622574|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18 594 CGP--NYGACANAkYCCSQYNWCGTSDAHCGTGCQ 626 776..557898877********************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (634 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 11.15 // Query: 619420|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18 [L=419] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-25 75.9 76.7 2.8e-12 33.0 19.0 4.3 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.0 19.0 2.8e-12 2.8e-12 2 36 .. 242 275 .. 241 283 .. 0.86 2 ! 31.7 18.8 7e-12 7e-12 2 36 .. 309 342 .. 308 350 .. 0.86 3 ! 21.9 22.9 8e-09 8e-09 2 36 .. 379 412 .. 376 417 .. 0.85 Alignments for each domain: == domain 1 score: 33.0 bits; conditional E-value: 2.8e-12 CBM18.hmm 2 cgkqaggntC.plnaCCskwGyCGttsdYCgkgCqs 36 cg+ + C ++n+CCsk+G+CGtt+++Cg+gCqs 619420|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18 242 CGP--DFGACaKSNECCSKYGWCGTTEAHCGTGCQS 275 776..557895566*********************9 PP == domain 2 score: 31.7 bits; conditional E-value: 7e-12 CBM18.hmm 2 cgkqaggntC.plnaCCskwGyCGttsdYCgkgCqs 36 cg+ + C ++n+CCsk+G+CGt++++Cg+gCqs 619420|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18 309 CGP--DFGACaKSNECCSKYGWCGTSEKHCGTGCQS 342 776..557895566*********************9 PP == domain 3 score: 21.9 bits; conditional E-value: 8e-09 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCgkgCqs 36 cg+ + C+++ +CCsk yCG+t dYCg+gCq+ 619420|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18 379 CGP--NYGACAKSgYCCSKHNYCGNTGDYCGTGCQN 412 775..557896555*********************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (419 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 53.18 // Query: 624454|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18 [L=264] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-28 84.2 69.0 5.7e-14 38.4 18.5 3.5 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.7 14.9 6.8e-12 6.8e-12 1 36 [. 96 133 .. 96 138 .. 0.91 2 ! 38.4 18.5 5.7e-14 5.7e-14 1 36 [. 164 201 .. 164 206 .. 0.93 3 ! 26.2 19.5 3.7e-10 3.7e-10 7 36 .. 226 257 .. 218 262 .. 0.84 Alignments for each domain: == domain 1 score: 31.7 bits; conditional E-value: 6.8e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cg++ ++++ n+CCsk+G+CG t++YC+ kgCqs 624454|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18 96 RCGPEFNNQKYHHNKCCSKYGWCGRTDEYCKisKGCQS 133 6999999***********************6559***9 PP == domain 2 score: 38.4 bits; conditional E-value: 5.7e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cg++ ++++C n+CCsk+G+CG t++YC+ kgCqs 624454|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18 164 RCGPKFNNKKCHYNECCSKYGWCGRTDEYCKisKGCQS 201 6*****************************6559***9 PP == domain 3 score: 26.2 bits; conditional E-value: 3.7e-10 CBM18.hmm 7 ggntCplnaCCskwGyCGttsdYCgk..gCqs 36 ++ +C ++CCsk+GyCG +s+YC+k gCqs 624454|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18 226 KDGKCLFGECCSKYGYCGKSSEYCSKkkGCQS 257 56899999****************85459**9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (264 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 37.80 // Query: 1000278|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=850] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-35 105.7 106.5 9e-14 37.8 18.6 4.6 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.8 18.6 9e-14 9e-14 2 36 .. 573 605 .. 572 610 .. 0.90 2 ! 31.4 19.1 8.9e-12 8.9e-12 2 36 .. 648 680 .. 645 685 .. 0.90 3 ! 31.8 20.0 6.4e-12 6.4e-12 2 36 .. 732 764 .. 730 769 .. 0.90 4 ! 23.1 24.8 3.4e-09 3.4e-09 1 36 [. 810 843 .. 810 848 .. 0.91 Alignments for each domain: == domain 1 score: 37.8 bits; conditional E-value: 9e-14 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk+GyCG+t++YCgkgCqs 1000278|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 573 CGP--NVAICADGRCCSKYGYCGSTDEYCGKGCQS 605 786..4599*************************9 PP == domain 2 score: 31.4 bits; conditional E-value: 8.9e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk+GyCG t ++CgkgCqs 1000278|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 648 CGP--NVAICAEGYCCSKYGYCGKTTAHCGKGCQS 680 665..4489*************************9 PP == domain 3 score: 31.8 bits; conditional E-value: 6.4e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk+GyCG ts++CgkgCqs 1000278|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 732 CGP--NVAVCAEGYCCSKYGYCGKTSAHCGKGCQS 764 675..4589*************************9 PP == domain 4 score: 23.1 bits; conditional E-value: 3.4e-09 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+ + C++++CCsk+GyCG s+YC++gCq+ 1000278|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 810 RCGS--SYGSCASGYCCSKYGYCGKDSNYCSSGCQK 843 5885..6689*************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (850 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.00 // Query: 6633|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 [L=713] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-26 77.9 68.2 5.6e-12 32.0 16.1 3.7 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.0 16.1 5.6e-12 5.6e-12 1 36 [. 493 530 .. 493 538 .. 0.91 2 ! 27.9 14.5 1.1e-10 1.1e-10 2 36 .. 578 612 .. 577 617 .. 0.86 3 ! 29.6 21.7 3.2e-11 3.2e-11 2 36 .. 674 706 .. 672 708 .. 0.92 Alignments for each domain: == domain 1 score: 32.0 bits; conditional E-value: 5.6e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cg+ g+++Cp+++CCs GyCGtt+ +C+ gCq 6633|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 493 KCGPRFGNAKCPKGLCCSYKGYCGTTKSFCEveRGCQD 530 6*****************************84459995 PP == domain 2 score: 27.9 bits; conditional E-value: 1.1e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYC..gkgCqs 36 cgk +Cp+++CCsk G+CGtt +C + gCq+ 6633|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 578 CGK--LYGKCPTGLCCSKKGWCGTTRSFCliDRGCQK 612 776..4589********************55589*96 PP == domain 3 score: 29.6 bits; conditional E-value: 3.2e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g +C++++CCs++G+CG +++YCg gCq 6633|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 674 CGE--GYGKCKTGYCCSQYGWCGKSDAYCGVGCQA 706 885..779**************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (713 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.04 // Query: 572745|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 [L=739] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-15 42.4 84.0 2.2e-08 20.5 19.8 4.4 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 1.3 0.25 0.25 29 36 .. 463 472 .. 461 480 .. 0.63 2 ! 20.5 19.8 2.2e-08 2.2e-08 2 36 .. 515 549 .. 514 554 .. 0.86 3 ! 20.2 19.8 2.8e-08 2.8e-08 2 36 .. 584 618 .. 583 623 .. 0.85 4 ! 20.2 19.8 2.8e-08 2.8e-08 2 36 .. 653 687 .. 652 692 .. 0.85 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.25 CBM18.hmm 29 YCg..kgCqs 36 YC+ gCq+ 572745|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 463 YCDidRGCQE 472 7754357774 PP == domain 2 score: 20.5 bits; conditional E-value: 2.2e-08 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg + +C +++CCsk+G+CG ++++C+ gCq+ 572745|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 515 CGD--SYGQCSEGYCCSKYGWCGKSQAHCDidRGCQE 549 775..5689********************75579*96 PP == domain 3 score: 20.2 bits; conditional E-value: 2.8e-08 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg + +C +++CCsk+G+CG ++++C+ gCq+ 572745|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 584 CGG--SFGQCSEGYCCSKYGWCGKSQAHCDidRGCQE 618 674..4589********************75579*96 PP == domain 4 score: 20.2 bits; conditional E-value: 2.8e-08 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg + +C +++CCsk+G+CG ++++C+ gCq+ 572745|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 653 CGG--SFGQCSEGYCCSKYGWCGKSQAHCDidRGCQE 687 674..4589********************75579*96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (739 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.09 // Query: 1185062|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18 [L=258] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-30 90.7 90.1 7.6e-13 34.8 23.5 4.2 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.8 23.5 7.6e-13 7.6e-13 2 36 .. 87 119 .. 86 124 .. 0.92 2 ! 33.5 24.8 1.9e-12 1.9e-12 2 36 .. 157 189 .. 156 194 .. 0.91 3 ! 34.7 24.6 8.1e-13 8.1e-13 2 36 .. 219 251 .. 214 256 .. 0.91 Alignments for each domain: == domain 1 score: 34.8 bits; conditional E-value: 7.6e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + +Cp+++CCs++GyCGt+s++CgkgCqs 1185062|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18 87 CGK--EYGHCPSGQCCSQYGYCGTSSEHCGKGCQS 119 887..6799*************************9 PP == domain 2 score: 33.5 bits; conditional E-value: 1.9e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + Cp+++CCs++GyCGt+s++CgkgCqs 1185062|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18 157 CGK--EYGNCPSGQCCSQYGYCGTSSEHCGKGCQS 189 897..6689*************************9 PP == domain 3 score: 34.7 bits; conditional E-value: 8.1e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + Cp+++CCs++GyCG ts+YCgkgCqs 1185062|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18 219 CGK--EYGNCPSGQCCSQYGYCGKTSAYCGKGCQS 251 887..6689*************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (258 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.58 // Query: 407251|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 [L=684] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-22 64.2 45.6 3.9e-13 35.7 20.3 2.4 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.7 20.3 3.9e-13 3.9e-13 2 36 .. 572 604 .. 571 609 .. 0.91 2 ! 34.2 17.3 1.2e-12 1.2e-12 2 36 .. 645 677 .. 644 680 .. 0.92 Alignments for each domain: == domain 1 score: 35.7 bits; conditional E-value: 3.9e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C++++CCsk+G+CGttsd+Cg+gCqs 407251|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 572 CGP--GVAVCASGYCCSKYGWCGTTSDHCGTGCQS 604 886..7799*************************9 PP == domain 2 score: 34.2 bits; conditional E-value: 1.2e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C++++CCsk+G+CG t+d+C++gCq+ 407251|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 645 CGS--GVAVCASGYCCSKYGWCGKTKDHCSTGCQK 677 784..779**************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (684 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 83.07 // Query: 202032|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 [L=78] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-20 58.3 51.7 5.5e-13 35.2 13.4 3.4 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.2 13.4 5.5e-13 5.5e-13 11 35 .. 1 25 [. 1 28 [. 0.96 2 ! 27.0 29.2 2e-10 2e-10 1 36 [. 36 70 .. 30 75 .. 0.82 3 ? -1.1 0.1 0.13 0.13 19 24 .. 71 76 .. 70 77 .. 0.73 Alignments for each domain: == domain 1 score: 35.2 bits; conditional E-value: 5.5e-13 CBM18.hmm 11 CplnaCCskwGyCGttsdYCgkgCq 35 Cp+n+CCs+ GyCG++++YCg gC 202032|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 1 CPNNQCCSQHGYCGYSKEYCGIGCL 25 ************************6 PP == domain 2 score: 27.0 bits; conditional E-value: 2e-10 CBM18.hmm 1 qcgkqaggntC.plnaCCskwGyCGttsdYCgkgCqs 36 +cg+ g C ++++CCsk+GyCG+t++YCg+gCq+ 202032|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 36 RCGE--GFGLCnKTGYCCSKYGYCGNTKEYCGAGCQK 70 3553..679996666*********************7 PP == domain 3 score: -1.1 bits; conditional E-value: 0.13 CBM18.hmm 19 kwGyCG 24 ++G+C+ 202032|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 71 SFGHCN 76 589995 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (78 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 2.13 // Query: 1185732|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 [L=778] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-24 72.3 69.4 4.1e-14 38.9 19.8 4.4 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.1 0.2 0.052 0.052 8 19 .. 264 282 .. 259 284 .. 0.69 2 ! 38.9 19.8 4.1e-14 4.1e-14 1 36 [. 635 670 .. 635 675 .. 0.96 3 ! 23.1 18.1 3.4e-09 3.4e-09 12 36 .. 711 735 .. 697 740 .. 0.80 4 ! 25.0 10.1 8.8e-10 8.8e-10 9 31 .. 751 773 .. 743 775 .. 0.89 Alignments for each domain: == domain 1 score: 0.1 bits; conditional E-value: 0.052 CBM18.hmm 8 gntC.pln......aCCsk 19 g tC p++ +CCs 1185732|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 264 GETCvPEKvnnlefKCCSD 282 667852224567889**95 PP == domain 2 score: 38.9 bits; conditional E-value: 4.1e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg + ++++Cp+n+CCs++G+CGt++++Cg+ Cqs 1185732|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 635 RCGAEFNNAKCPSNKCCSEYGWCGTSEKHCGTDCQS 670 6**********************************9 PP == domain 3 score: 23.1 bits; conditional E-value: 3.4e-09 CBM18.hmm 12 plnaCCskwGyCGttsdYCgkgCqs 36 ++++CCsk+GyCG ++ YCg+gCq 1185732|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 711 KTGYCCSKSGYCGVSDRYCGTGCQT 735 467*********************6 PP == domain 4 score: 25.0 bits; conditional E-value: 8.8e-10 CBM18.hmm 9 ntCplnaCCskwGyCGttsdYCg 31 +C++n+CCsk+ yCGtts++C+ 1185732|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 751 GKCKNNNCCSKYEYCGTTSKHCK 773 79********************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (778 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.72 // Query: 961377|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=759] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-36 111.0 104.3 7.8e-13 34.8 19.1 4.7 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.6 21.1 3.8e-12 3.8e-12 1 36 [. 480 513 .. 480 518 .. 0.92 2 ! 34.8 19.1 7.8e-13 7.8e-13 2 36 .. 556 588 .. 555 593 .. 0.91 3 ! 32.1 19.8 5.2e-12 5.2e-12 2 36 .. 631 663 .. 628 668 .. 0.89 4 ! 29.6 20.2 3.1e-11 3.1e-11 2 36 .. 720 752 .. 718 754 .. 0.91 Alignments for each domain: == domain 1 score: 32.6 bits; conditional E-value: 3.8e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ + Cp+++CCs +GyCG+t +YCgkgCqs 961377|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 480 QCGP--DYGVCPKGKCCSRYGYCGNTVAYCGKGCQS 513 6887..6699*************************9 PP == domain 2 score: 34.8 bits; conditional E-value: 7.8e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C +n+CCs +GyCG+t +YCgkgCqs 961377|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 556 CGP--GVAVCGNNLCCSRYGYCGNTVAYCGKGCQS 588 775..6799*************************9 PP == domain 3 score: 32.1 bits; conditional E-value: 5.2e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg g + C +n+CCsk+GyCG +s+YCgkgCqs 961377|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 631 CG--LGVAVCGSNLCCSKYGYCGDSSAYCGKGCQS 663 55..36689*************************9 PP == domain 4 score: 29.6 bits; conditional E-value: 3.1e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + Cp++ CCsk+GyCGt ++YCg+gC++ 961377|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 720 CGS--EYGICPNGGCCSKYGYCGTEAAYCGTGCKK 752 775..6789************************85 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (759 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.32 // Query: 463607|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=845] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-38 115.5 101.3 6e-13 35.1 20.3 4.6 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.4 19.5 9.8e-13 9.8e-13 2 36 .. 590 622 .. 589 627 .. 0.92 2 ! 32.5 20.0 3.9e-12 3.9e-12 2 36 .. 654 686 .. 653 691 .. 0.91 3 ! 35.1 20.3 6e-13 6e-13 2 36 .. 727 759 .. 726 764 .. 0.91 4 ! 31.6 17.5 7.6e-12 7.6e-12 9 36 .. 809 836 .. 799 839 .. 0.90 Alignments for each domain: == domain 1 score: 34.4 bits; conditional E-value: 9.8e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C++n CCsk+GyCGt+s YCgkgCqs 463607|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 590 CGS--GVAVCADNMCCSKYGYCGTSSVYCGKGCQS 622 884..779**************************9 PP == domain 2 score: 32.5 bits; conditional E-value: 3.9e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg a+ + C ++ CCs +GyCGt+s+YCg+gCqs 463607|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 654 CG--ANVAVCGNDMCCSRYGYCGTSSAYCGNGCQS 686 77..46699*************************9 PP == domain 3 score: 35.1 bits; conditional E-value: 6e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg a+ + C ++ CCsk+GyCGtts+YCg+gCqs 463607|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 727 CG--ANVAVCGNDMCCSKYGYCGTTSAYCGNGCQS 759 77..46699*************************9 PP == domain 4 score: 31.6 bits; conditional E-value: 7.6e-12 CBM18.hmm 9 ntCplnaCCskwGyCGttsdYCgkgCqs 36 Cp+++CCsk+GyCG t++YC++gCq+ 463607|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 809 GLCPDEYCCSKYGYCGKTAAYCSTGCQQ 836 68*************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (845 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.11 // Query: 264070|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 [L=249] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-50 154.5 134.0 1.5e-14 40.3 21.5 5.9 5 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.4 21.6 8.6e-12 8.6e-12 2 36 .. 4 36 .. 3 44 .. 0.92 2 ! 36.0 19.6 3.1e-13 3.1e-13 2 36 .. 53 88 .. 52 96 .. 0.89 3 ! 36.3 19.1 2.7e-13 2.7e-13 2 36 .. 105 140 .. 104 145 .. 0.87 4 ! 35.3 20.0 5.1e-13 5.1e-13 2 36 .. 157 192 .. 156 198 .. 0.87 5 ! 40.3 21.5 1.5e-14 1.5e-14 2 36 .. 209 244 .. 208 249 .] 0.89 Alignments for each domain: == domain 1 score: 31.4 bits; conditional E-value: 8.6e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + +C +++CCsk GyCG+ts+YCg gCqs 264070|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 4 CGK--DIGKCSNGQCCSKKGYCGSTSAYCGIGCQS 36 897..5589*************************9 PP == domain 2 score: 36.0 bits; conditional E-value: 3.1e-13 CBM18.hmm 2 cgkqa.ggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + Cp+++CCs+ GyCGtts+YCg gCqs 264070|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 53 CGKMGsVNYICPNSQCCSQKGYCGTTSAYCGVGCQS 88 7865436799*************************9 PP == domain 3 score: 36.3 bits; conditional E-value: 2.7e-13 CBM18.hmm 2 cgkqa.ggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg++ + Cp+++CCs+ GyCGtts+YCg gCqs 264070|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 105 CGRKGsVDYICPNSQCCSQKGYCGTTSAYCGVGCQS 140 8855426699*************************9 PP == domain 4 score: 35.3 bits; conditional E-value: 5.1e-13 CBM18.hmm 2 cgkqa.ggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg++ + Cp+++CCs+ GyCGtts+YCg gCqs 264070|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 157 CGRKGsVDYICPNSQCCSQKGYCGTTSAYCGVGCQS 192 8855426699*************************9 PP == domain 5 score: 40.3 bits; conditional E-value: 1.5e-14 CBM18.hmm 2 cgkqa.ggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+++ + Cp+++CCsk+GyCGttsdYCg+gCqs 264070|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 209 CGRKNnVDYICPNSQCCSKYGYCGTTSDYCGTGCQS 244 8965526699*************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (249 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 14.25 // Query: 818409|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=903] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-36 109.0 113.6 7.8e-13 34.8 21.5 4.5 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.8 21.5 7.8e-13 7.8e-13 2 36 .. 585 617 .. 584 622 .. 0.90 2 ! 33.7 20.9 1.6e-12 1.6e-12 2 36 .. 664 696 .. 663 701 .. 0.90 3 ! 33.5 21.3 1.9e-12 1.9e-12 2 36 .. 762 794 .. 761 799 .. 0.89 4 ! 25.5 25.8 6.2e-10 6.2e-10 2 36 .. 864 896 .. 862 901 .. 0.92 Alignments for each domain: == domain 1 score: 34.8 bits; conditional E-value: 7.8e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCs++GyCG+t++YCg+gCqs 818409|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 585 CGP--NVAVCKEGYCCSQYGYCGNTDEYCGNGCQS 617 776..4599*************************9 PP == domain 2 score: 33.7 bits; conditional E-value: 1.6e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCs++GyCG t++YCgkgCqs 818409|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 664 CGP--NVAVCKEGYCCSQYGYCGKTEAYCGKGCQS 696 776..4599*************************9 PP == domain 3 score: 33.5 bits; conditional E-value: 1.9e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCs++GyCG t++YCgkgCqs 818409|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 762 CGP--NVAVCKEGYCCSQYGYCGKTEAYCGKGCQS 794 776..4599*************************9 PP == domain 4 score: 25.5 bits; conditional E-value: 6.2e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g C++++CCsk+GyCG +s+YC++gCq+ 818409|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 864 CGS--GYGSCASGYCCSKYGYCGKSSEYCSTGCQK 896 884..8899*************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (903 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.33 // Query: 1174263|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=803] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-34 104.3 107.9 7.1e-13 34.9 18.1 4.8 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.2 18.1 9e-11 9e-11 2 36 .. 571 603 .. 570 608 .. 0.91 2 ! 34.9 18.1 7.1e-13 7.1e-13 2 36 .. 624 656 .. 623 661 .. 0.90 3 ! 31.4 22.0 8.6e-12 8.6e-12 2 36 .. 677 709 .. 673 714 .. 0.90 4 ! 28.1 25.3 9.2e-11 9.2e-11 2 36 .. 764 796 .. 763 801 .. 0.90 Alignments for each domain: == domain 1 score: 28.2 bits; conditional E-value: 9e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg a+ + C +++CCsk GyCG+t +Cg+gCqs 1174263|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 571 CG--AKVAVCGESLCCSKHGYCGSTISHCGTGCQS 603 78..46799*************************9 PP == domain 2 score: 34.9 bits; conditional E-value: 7.1e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C+++ CCsk+GyCG+ts+YCg+gCqs 1174263|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 624 CGR--NVAVCEKDICCSKYGYCGSTSAYCGTGCQS 656 886..5599*************************9 PP == domain 3 score: 31.4 bits; conditional E-value: 8.6e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk+GyCGt+s+YCg+gCqs 1174263|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 677 CGP--NVAVCKEGQCCSKYGYCGTSSAYCGAGCQS 709 775..4599*************************9 PP == domain 4 score: 28.1 bits; conditional E-value: 9.2e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ ++ Cp+++CCsk+GyCGt+s+YCg+gC+s 1174263|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 764 CGP--SDGVCPKGYCCSKYGYCGTSSQYCGNGCNS 796 776..7799************************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (803 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 42.67 // Query: 1179532|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 [L=603] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-30 89.6 142.7 8.6e-11 28.2 19.9 7.6 8 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.3 17.8 2.6e-08 2.6e-08 1 35 [. 104 139 .. 104 145 .. 0.87 2 ? -4.0 0.2 1 1 8 14 .. 197 203 .. 194 210 .. 0.71 3 ? -2.7 0.3 0.4 0.4 7 16 .. 222 231 .. 218 231 .. 0.80 4 ! 27.7 14.9 1.3e-10 1.3e-10 7 35 .. 245 275 .. 239 276 .. 0.88 5 ! 28.2 19.9 8.6e-11 8.6e-11 1 36 [. 336 372 .. 336 377 .. 0.90 6 ? -1.7 0.4 0.19 0.19 27 32 .. 404 409 .. 392 427 .. 0.65 7 ! 26.1 14.5 3.9e-10 3.9e-10 2 35 .. 438 471 .. 436 473 .. 0.88 8 ! 25.4 26.6 6.4e-10 6.4e-10 2 36 .. 564 596 .. 563 601 .. 0.92 Alignments for each domain: == domain 1 score: 20.3 bits; conditional E-value: 2.6e-08 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCq 35 qcg++ g++Cp+++CCsk G CG++s +C+ +gCq 1179532|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 104 QCGEDI-GIRCPPGQCCSKEGKCGNSSSHCEleEGCQ 139 699654.89*********************76589*9 PP == domain 2 score: -4.0 bits; conditional E-value: 1 CBM18.hmm 8 gntCpln 14 ++ Cp+n 1179532|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 197 KISCPTN 203 5689887 PP == domain 3 score: -2.7 bits; conditional E-value: 0.4 CBM18.hmm 7 ggntCplnaC 16 ++n Cp+ +C 1179532|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 222 DSNGCPTPVC 231 6799999888 PP == domain 4 score: 27.7 bits; conditional E-value: 1.3e-10 CBM18.hmm 7 ggntCplnaCCskwGyCGttsdYCg..kgCq 35 ++ +Cp+++CCsk+G+CG ++++C+ kgCq 1179532|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 245 EDGKCPPGECCSKYGWCGKSDKHCKidKGCQ 275 6789********************6559**9 PP == domain 5 score: 28.2 bits; conditional E-value: 8.6e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cgk g++Cp+++CCsk+G+CG ++++C+ +gCqs 1179532|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 336 RCGK-DYGTRCPSGKCCSKYGWCGQSDKHCKikEGCQS 372 6997.5799*********************7668***8 PP == domain 6 score: -1.7 bits; conditional E-value: 0.19 CBM18.hmm 27 sdYCgk 32 ++YC + 1179532|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 404 PKYCHE 409 567765 PP == domain 7 score: 26.1 bits; conditional E-value: 3.9e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCq 35 cg ++ +Cp ++CCsk+G+CG ++++C+ +gCq 1179532|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 438 CG--IEDGKCPFGECCSKYGWCGESDKHCKidNGCQ 471 67..3789*********************65589*9 PP == domain 8 score: 25.4 bits; conditional E-value: 6.4e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + +C +++CCsk+GyCG ++ YCgkgCqs 1179532|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 564 CGK--DYGKCSSGYCCSKYGYCGKNDGYCGKGCQS 596 997..6699*************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (603 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 57.17 // Query: 601251|Durrog2_GeneCatalog_proteins_20191122.aa.fasta|CBM18|CBM18 [L=141] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-14 39.9 36.6 9.4e-11 28.1 15.8 3.2 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.2 0.1 0.066 0.066 20 26 .. 25 31 .. 23 39 .. 0.63 2 ! 28.1 15.8 9.4e-11 9.4e-11 2 36 .. 28 69 .. 27 71 .. 0.80 3 ? -0.5 0.1 0.083 0.083 19 25 .. 89 95 .. 88 100 .. 0.76 4 ! 16.7 12.1 3.4e-07 3.4e-07 7 36 .. 101 134 .. 92 139 .. 0.79 Alignments for each domain: == domain 1 score: -0.2 bits; conditional E-value: 0.066 CBM18.hmm 20 wGyCGtt 26 G CG 601251|Durrog2_GeneCatalog_proteins_20191122.aa.fasta|CBM18|CBM18 25 DGTCGQA 31 6888654 PP == domain 2 score: 28.1 bits; conditional E-value: 9.4e-11 CBM18.hmm 2 cgkqa....ggntCpln.aCCskwGyCGttsdYCgk..gCqs 36 cg+++ ++ tCp++ +CCs +GyCG+t+++C k gCq 601251|Durrog2_GeneCatalog_proteins_20191122.aa.fasta|CBM18|CBM18 28 CGQAKagnnKEYTCPSDeKCCSPSGYCGSTDEHCLKsvGCQD 69 6654445446789*9999****************87558995 PP == domain 3 score: -0.5 bits; conditional E-value: 0.083 CBM18.hmm 19 kwGyCGt 25 G CG+ 601251|Durrog2_GeneCatalog_proteins_20191122.aa.fasta|CBM18|CBM18 89 PDGTCGN 95 5688987 PP == domain 4 score: 16.7 bits; conditional E-value: 3.4e-07 CBM18.hmm 7 ggntCpln..aCCskwGyCGttsdYC..gkgCqs 36 g +Cp+ CCs +Gy G+t ++C ++gCqs 601251|Durrog2_GeneCatalog_proteins_20191122.aa.fasta|CBM18|CBM18 101 FGYRCPEAgdICCSIAGYYGNTTAHClaTNGCQS 134 4679987777****************54479**9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (141 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 4.69 // Query: 863966|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=873] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-36 109.9 105.2 9.2e-13 34.5 19.1 4.6 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.3 21.1 4.5e-12 4.5e-12 1 36 [. 589 622 .. 589 627 .. 0.92 2 ! 34.5 19.1 9.2e-13 9.2e-13 2 36 .. 665 697 .. 664 702 .. 0.91 3 ! 31.8 20.7 6.7e-12 6.7e-12 2 36 .. 740 772 .. 738 777 .. 0.91 4 ! 29.4 20.2 3.6e-11 3.6e-11 2 36 .. 829 861 .. 827 863 .. 0.91 Alignments for each domain: == domain 1 score: 32.3 bits; conditional E-value: 4.5e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ + Cp+++CCs +GyCG+t +YCgkgCqs 863966|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 589 QCGP--DYGVCPKGKCCSRYGYCGNTVAYCGKGCQS 622 6887..6699*************************9 PP == domain 2 score: 34.5 bits; conditional E-value: 9.2e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C +n+CCs +GyCG+t +YCgkgCqs 863966|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 665 CGP--GVAVCGNNLCCSRYGYCGNTVAYCGKGCQS 697 775..6799*************************9 PP == domain 3 score: 31.8 bits; conditional E-value: 6.7e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C +n+CCsk+GyCG +s+YCgkgCqs 863966|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 740 CGP--GVAVCGSNLCCSKYGYCGDSSAYCGKGCQS 772 775..6799*************************9 PP == domain 4 score: 29.4 bits; conditional E-value: 3.6e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + Cp++ CCsk+GyCGt ++YCg+gC++ 863966|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 829 CGS--EYGICPNGGCCSKYGYCGTEAAYCGTGCKK 861 775..6789************************85 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (873 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 81.25 // Query: 1352658|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=873] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-36 109.1 104.6 9.2e-13 34.5 19.1 4.6 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.3 21.1 4.5e-12 4.5e-12 1 36 [. 589 622 .. 589 627 .. 0.92 2 ! 34.5 19.1 9.2e-13 9.2e-13 2 36 .. 665 697 .. 664 702 .. 0.91 3 ! 31.0 20.2 1.2e-11 1.2e-11 2 36 .. 740 772 .. 738 777 .. 0.91 4 ! 29.4 20.2 3.6e-11 3.6e-11 2 36 .. 829 861 .. 827 863 .. 0.91 Alignments for each domain: == domain 1 score: 32.3 bits; conditional E-value: 4.5e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ + Cp+++CCs +GyCG+t +YCgkgCqs 1352658|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 589 QCGP--DYGVCPKGKCCSRYGYCGNTVAYCGKGCQS 622 6887..6699*************************9 PP == domain 2 score: 34.5 bits; conditional E-value: 9.2e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C +n+CCs +GyCG+t +YCgkgCqs 1352658|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 665 CGP--GVAVCGNNLCCSRYGYCGNTVAYCGKGCQS 697 775..6799*************************9 PP == domain 3 score: 31.0 bits; conditional E-value: 1.2e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C +n+CCsk+GyCG +s+YCg gCqs 1352658|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 740 CGP--GVAVCGSNLCCSKYGYCGDSSAYCGRGCQS 772 775..6799*************************9 PP == domain 4 score: 29.4 bits; conditional E-value: 3.6e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + Cp++ CCsk+GyCGt ++YCg+gC++ 1352658|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 829 CGS--EYGICPNGGCCSKYGYCGTEAAYCGTGCKK 861 775..6789************************85 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (873 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.80 // Query: 48892|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 [L=233] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-29 86.5 80.6 9.6e-13 34.5 22.8 3.5 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.8 20.5 6.5e-12 6.5e-12 1 36 [. 51 86 .. 51 92 .. 0.89 2 ! 34.5 22.8 9.6e-13 9.6e-13 1 36 [. 118 151 .. 118 153 .. 0.92 3 ! 32.3 21.3 4.6e-12 4.6e-12 2 36 .. 194 226 .. 193 231 .. 0.91 Alignments for each domain: == domain 1 score: 31.8 bits; conditional E-value: 6.5e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 qcg+ + +C++++CCs++GyCG t++YC+ kgCqs 48892|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 51 QCGP--KYGKCDEGECCSQYGYCGKTDEYCSikKGCQS 86 6887..6699********************7669***9 PP == domain 2 score: 34.5 bits; conditional E-value: 9.6e-13 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+ + +Cp+++CCsk+GyCG s+YCg+gCqs 48892|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 118 RCGS--QYGKCPSGQCCSKYGYCGKDSQYCGTGCQS 151 6996..6699*************************9 PP == domain 3 score: 32.3 bits; conditional E-value: 4.6e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C++++CCs++G+CG ++dYCg gCq+ 48892|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 194 CGP--GVAVCASGYCCSQYGWCGKSKDYCGVGCQK 226 775..6799*************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (233 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 30.94 // Query: 4100|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18 [L=311] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-31 92.8 77.6 3.2e-13 36.0 19.8 3.8 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.4 21.9 4.2e-12 4.2e-12 2 36 .. 22 54 .. 21 59 .. 0.91 2 ! 36.0 19.8 3.2e-13 3.2e-13 2 36 .. 119 154 .. 118 161 .. 0.88 3 ! 36.0 19.8 3.2e-13 3.2e-13 2 36 .. 232 267 .. 231 274 .. 0.88 Alignments for each domain: == domain 1 score: 32.4 bits; conditional E-value: 4.2e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g +C +++CCsk+GyCG++s+YCg+gCqs 4100|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18 22 CGS--GIGKCSDGLCCSKYGYCGSSSAYCGAGCQS 54 774..7799*************************9 PP == domain 2 score: 36.0 bits; conditional E-value: 3.2e-13 CBM18.hmm 2 cgkqa.ggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+++ + Cp+++CCsk+GyCGt s+YCg+gCqs 4100|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18 119 CGRKNnIDYVCPDSQCCSKYGYCGTDSAYCGTGCQS 154 8866525699*************************9 PP == domain 3 score: 36.0 bits; conditional E-value: 3.2e-13 CBM18.hmm 2 cgkqa.ggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+++ + Cp+++CCsk+GyCGt s+YCg+gCqs 4100|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18 232 CGRKNnIDYVCPDSQCCSKYGYCGTDSAYCGTGCQS 267 8866525699*************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (311 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 18.25 // Query: 1182616|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=616] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-28 85.3 101.7 2.3e-10 26.8 18.2 4.7 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.9 20.2 4.5e-10 4.5e-10 1 36 [. 291 326 .. 291 331 .. 0.89 2 ! 24.2 19.7 1.5e-09 1.5e-09 1 36 [. 352 387 .. 352 392 .. 0.89 3 ! 26.8 18.2 2.3e-10 2.3e-10 1 36 [. 478 513 .. 478 518 .. 0.89 4 ! 26.5 19.5 2.9e-10 2.9e-10 1 36 [. 574 609 .. 574 614 .. 0.87 Alignments for each domain: == domain 1 score: 25.9 bits; conditional E-value: 4.5e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cg+ ++ Cp+++CCsk+G+CG ++ YC+ +gCqs 1182616|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 291 RCGP--EDGVCPSGQCCSKYGWCGKSEGYCKieNGCQS 326 5886..7899********************76589**9 PP == domain 2 score: 24.2 bits; conditional E-value: 1.5e-09 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cg+ ++ Cp+++CCsk+G+CG ++ +C+ +gCqs 1182616|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 352 RCGP--EDGVCPSGQCCSKYGWCGKSEGHCKieNGCQS 387 5886..7899********************76589**9 PP == domain 3 score: 26.8 bits; conditional E-value: 2.3e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cg+ ++ Cp+++CCsk G+CG ++d+C+ +gCqs 1182616|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 478 RCGP--KDGVCPSGKCCSKHGWCGKSEDHCKieNGCQS 513 5886..7899********************76589**9 PP == domain 4 score: 26.5 bits; conditional E-value: 2.9e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgk..gCqs 36 +cg+ ++ Cp+++CCsk G+CG ++d+C+k gCqs 1182616|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18 574 RCGP--KDGVCPSGKCCSKHGWCGKSEDHCKKenGCQS 609 5886..7899********************85559**9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (616 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 69.73 // Query: 1280077|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=903] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-36 109.0 113.6 7.8e-13 34.8 21.5 4.5 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.8 21.5 7.8e-13 7.8e-13 2 36 .. 585 617 .. 584 622 .. 0.90 2 ! 33.7 20.9 1.6e-12 1.6e-12 2 36 .. 664 696 .. 663 701 .. 0.90 3 ! 33.5 21.3 1.9e-12 1.9e-12 2 36 .. 762 794 .. 761 799 .. 0.89 4 ! 25.5 25.8 6.2e-10 6.2e-10 2 36 .. 864 896 .. 862 901 .. 0.92 Alignments for each domain: == domain 1 score: 34.8 bits; conditional E-value: 7.8e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCs++GyCG+t++YCg+gCqs 1280077|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 585 CGP--NVAVCKEGYCCSQYGYCGNTDEYCGNGCQS 617 776..4599*************************9 PP == domain 2 score: 33.7 bits; conditional E-value: 1.6e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCs++GyCG t++YCgkgCqs 1280077|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 664 CGP--NVAVCKEGYCCSQYGYCGKTEAYCGKGCQS 696 776..4599*************************9 PP == domain 3 score: 33.5 bits; conditional E-value: 1.9e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCs++GyCG t++YCgkgCqs 1280077|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 762 CGP--NVAVCKEGYCCSQYGYCGKTEAYCGKGCQS 794 776..4599*************************9 PP == domain 4 score: 25.5 bits; conditional E-value: 6.2e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g C++++CCsk+GyCG +s+YC++gCq+ 1280077|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 864 CGS--GYGSCASGYCCSKYGYCGKSSEYCSTGCQK 896 884..8899*************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (903 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 89.06 // Query: 416399|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 [L=622] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-13 35.1 19.3 9.9e-13 34.4 19.3 1.3 1 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.4 19.3 9.9e-13 9.9e-13 1 36 [. 582 615 .. 582 620 .. 0.92 Alignments for each domain: == domain 1 score: 34.4 bits; conditional E-value: 9.9e-13 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ g + C++n+CCsk+G+CG t+d+C++gCq+ 416399|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18 582 QCGS--GVAVCASNLCCSKYGWCGKTKDHCSTGCQK 615 6895..889**************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (622 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 78.45 // Query: 1059070|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18 [L=619] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-11 31.1 24.2 1.8e-11 30.4 24.2 1.4 1 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.4 24.2 1.8e-11 1.8e-11 2 36 .. 580 612 .. 578 617 .. 0.91 Alignments for each domain: == domain 1 score: 30.4 bits; conditional E-value: 1.8e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + +Cp+++CCsk+GyCGt YCg+gCqs 1059070|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18 580 CGS--EYGKCPNGLCCSKYGYCGTETGYCGAGCQS 612 885..779**************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (619 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 79.22 // Query: 288426|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 [L=452] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-10 25.0 17.4 9.1e-10 25.0 17.4 2.2 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.0 17.4 9.1e-10 9.1e-10 2 35 .. 102 134 .. 101 136 .. 0.85 2 ? -1.4 0.9 0.16 0.16 26 34 .. 308 316 .. 307 318 .. 0.83 Alignments for each domain: == domain 1 score: 25.0 bits; conditional E-value: 9.1e-10 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCgkgCq 35 cg+ + C+++ +CC+k GyCG t+++Cg+gCq 288426|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 102 CGP--EYGACAKSgYCCNKLGYCGKTDKHCGTGCQ 134 776..567896655********************9 PP == domain 2 score: -1.4 bits; conditional E-value: 0.16 CBM18.hmm 26 tsdYCgkgC 34 ++++C+ gC 288426|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 308 GNKHCKFGC 316 6899*9999 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (452 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 59.07 // Query: 292287|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 [L=205] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-11 31.0 22.3 1.2e-11 31.0 22.3 2.3 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.0 0.5 0.027 0.027 21 32 .. 156 167 .. 155 168 .. 0.89 2 ! 31.0 22.3 1.2e-11 1.2e-11 2 37 .. 165 199 .. 164 203 .. 0.92 Alignments for each domain: == domain 1 score: 1.0 bits; conditional E-value: 0.027 CBM18.hmm 21 GyCGttsdYCgk 32 G+C + d Cgk 292287|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 156 GWCKYDTDLCGK 167 9*********97 PP == domain 2 score: 31.0 bits; conditional E-value: 1.2e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 cgk + g +C +++CCsk+G+CG ++dYC+kgCq n 292287|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 165 CGK-QYGFHCHTGYCCSKYGHCGKSKDYCEKGCQGN 199 886.5689**************************76 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (205 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 10.62 // Query: 1182256|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 [L=412] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-12 33.4 19.7 2.1e-12 33.4 19.7 4.5 7 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.3 0.24 0.24 26 35 .. 49 68 .. 37 70 .. 0.71 2 ? -3.3 0.1 0.61 0.61 6 12 .. 99 105 .. 96 106 .. 0.73 3 ? -2.2 0.3 0.28 0.28 8 16 .. 131 139 .. 128 143 .. 0.58 4 ? -2.9 0.1 0.45 0.45 27 35 .. 213 231 .. 211 232 .. 0.59 5 ? -3.2 0.1 0.57 0.57 4 12 .. 260 268 .. 259 269 .. 0.76 6 ? -1.6 0.2 0.18 0.18 11 22 .. 297 307 .. 291 307 .. 0.63 7 ! 33.4 19.7 2.1e-12 2.1e-12 1 36 [. 356 392 .. 356 397 .. 0.90 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.24 CBM18.hmm 26 tsdYCgk..........gCq 35 +++C + Cq 1182256|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 49 DNEFCHNfifdyenaltECQ 68 57888876666666666666 PP == domain 2 score: -3.3 bits; conditional E-value: 0.61 CBM18.hmm 6 aggntCp 12 +gn+Cp 1182256|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 99 ENGNECP 105 5789998 PP == domain 3 score: -2.2 bits; conditional E-value: 0.28 CBM18.hmm 8 gntCplnaC 16 +++C + +C 1182256|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 131 NKQCRSTKC 139 556655544 PP == domain 4 score: -2.9 bits; conditional E-value: 0.45 CBM18.hmm 27 sdYCgk..........gCq 35 s++C++ Cq 1182256|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 213 SEHCQNfifsymdilpECQ 231 6788765555555555555 PP == domain 5 score: -3.2 bits; conditional E-value: 0.57 CBM18.hmm 4 kqaggntCp 12 k+ +g++Cp 1182256|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 260 KDENGKECP 268 567899998 PP == domain 6 score: -1.6 bits; conditional E-value: 0.18 CBM18.hmm 11 CplnaCCskwGy 22 C ++ Cs++Gy 1182256|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 297 CYSKM-CSEAGY 307 54443.788887 PP == domain 7 score: 33.4 bits; conditional E-value: 2.1e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgk..gCqs 36 +cgk ++g++Cp+++CCsk GyCGtt++YC+ gCqs 1182256|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18 356 KCGK-NNGKKCPSDKCCSKHGYCGTTDKYCSVelGCQS 392 5996.789**********************96679**9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (412 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 45.12 // Query: 623817|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 [L=871] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-61 189.3 212.5 1.2e-14 40.6 20.1 9.5 8 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.1 15.3 4e-10 4e-10 1 35 [. 23 56 .. 23 59 .. 0.94 2 ! 15.6 19.5 7.8e-07 7.8e-07 1 33 [. 298 335 .. 298 344 .. 0.80 3 ! 20.1 21.3 2.9e-08 2.9e-08 8 34 .. 388 414 .. 381 425 .. 0.79 4 ! 39.6 21.0 2.3e-14 2.3e-14 1 36 [. 516 551 .. 516 556 .. 0.96 5 ! 40.2 21.2 1.6e-14 1.6e-14 1 36 [. 584 619 .. 584 624 .. 0.96 6 ! 40.6 20.1 1.2e-14 1.2e-14 1 36 [. 650 685 .. 650 690 .. 0.96 7 ! 24.0 20.1 1.8e-09 1.8e-09 1 36 [. 770 805 .. 770 810 .. 0.96 8 ! 25.7 18.0 5.3e-10 5.3e-10 1 36 [. 827 862 .. 827 865 .. 0.97 Alignments for each domain: == domain 1 score: 26.1 bits; conditional E-value: 4e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cgk ++++ Cp+++CCs+ G CG + +YCg gCq 623817|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 23 KCGK-KNNIACPTGYCCSEDGECGKSIKYCGIGCQ 56 5996.789**************************9 PP == domain 2 score: 15.6 bits; conditional E-value: 7.8e-07 CBM18.hmm 1 qcgkqagg.ntCplnaCCskwGyCGttsdYCgk....g 33 +cg+ ++ + Cp+n+CC++ GyCG++ ++C++ + 623817|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 298 RCGRYSNYvKICPGNECCNSNGYCGNSIQHCDPwyclN 335 6998885559*********************9854441 PP == domain 3 score: 20.1 bits; conditional E-value: 2.9e-08 CBM18.hmm 8 g.ntCplnaCCskwGyCGttsdYCgkgC 34 + Cp+n+CCs++GyCG++ +YC+ +C 623817|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 388 KvVVCPNNECCSNYGYCGSSYEYCN-NC 414 3378********************9.55 PP == domain 4 score: 39.6 bits; conditional E-value: 2.3e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg++ g++ Cp+++CCsk+GyCG+t+++CgkgCqs 623817|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 516 QCGPKYGNAICPSGKCCSKYGYCGITDAHCGKGCQS 551 7**********************************9 PP == domain 5 score: 40.2 bits; conditional E-value: 1.6e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg++ g++ Cp+++CCsk+GyCG+t+++CgkgCqs 623817|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 584 QCGPKFGNTVCPSGKCCSKYGYCGITNAHCGKGCQS 619 7**********************************9 PP == domain 6 score: 40.6 bits; conditional E-value: 1.2e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg++ g++ Cp+++CCsk+GyCG+t+++Cgk+Cqs 623817|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 650 QCGPKFGNAVCPSGQCCSKYGYCGITDAHCGKNCQS 685 7**********************************9 PP == domain 7 score: 24.0 bits; conditional E-value: 1.8e-09 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++ gg++C ++CCsk G+CG + d+C +gCq+ 623817|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 770 RCGPKFGGQKCGFGECCSKDGVCGFGFDFCFEGCQK 805 6**********************************6 PP == domain 8 score: 25.7 bits; conditional E-value: 5.3e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++ gg++C ++CCsk G+CG + d+C +gCq+ 623817|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 827 KCGPKFGGQKCGFGECCSKDGVCGFGFDFCFEGCQK 862 6**********************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (871 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 25.92 // Query: 556408|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18 [L=230] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-11 29.2 15.3 7.2e-11 28.5 15.3 1.3 1 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.5 15.3 7.2e-11 7.2e-11 1 35 [. 2 35 .. 2 38 .. 0.94 Alignments for each domain: == domain 1 score: 28.5 bits; conditional E-value: 7.2e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cgk ++++ Cp+++CCs+ G CG + +YCg gCq 556408|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18 2 KCGK-KNNIACPTGYCCSEDGECGKSIKYCGIGCQ 35 5996.789**************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (230 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 40.53 // Query: 329096|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 [L=773] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-22 64.5 50.1 2.4e-13 36.4 20.0 2.5 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.4 20.0 2.4e-13 2.4e-13 2 36 .. 601 633 .. 600 638 .. 0.90 2 ! 33.6 22.1 1.8e-12 1.8e-12 2 36 .. 734 766 .. 733 771 .. 0.90 Alignments for each domain: == domain 1 score: 36.4 bits; conditional E-value: 2.4e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk+GyCGtt+dYC++gCqs 329096|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 601 CGP--NVAVCAKGYCCSKYGYCGTTDDYCSTGCQS 633 776..4599*************************9 PP == domain 2 score: 33.6 bits; conditional E-value: 1.8e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk+GyCG tsdYCgkgCqs 329096|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 734 CGP--NVAVCASGYCCSKYGYCGKTSDYCGKGCQS 766 776..4599*************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (773 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 92.65 // Query: 290423|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=824] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-30 90.8 107.9 7.3e-12 31.6 22.2 4.6 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.0 18.4 1e-10 1e-10 2 36 .. 585 617 .. 584 622 .. 0.91 2 ! 26.7 20.0 2.5e-10 2.5e-10 2 36 .. 632 664 .. 631 669 .. 0.90 3 ! 31.6 22.2 7.3e-12 7.3e-12 2 36 .. 702 734 .. 700 739 .. 0.91 4 ! 22.8 23.2 4.2e-09 4.2e-09 2 36 .. 785 817 .. 780 822 .. 0.88 Alignments for each domain: == domain 1 score: 28.0 bits; conditional E-value: 1e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + + C++++CCsk G+CG+t +YCg gCqs 290423|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 585 CGK--NIAICKEGLCCSKNGVCGSTTAYCGLGCQS 617 886..5599*************************9 PP == domain 2 score: 26.7 bits; conditional E-value: 2.5e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg a+ + C++++CCs++ CG+ts+YCg gCqs 290423|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 632 CG--ANVAVCQEGLCCSQYNSCGSTSNYCGVGCQS 664 77..46699*************************9 PP == domain 3 score: 31.6 bits; conditional E-value: 7.3e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C +++CCsk+GyCG t+dYCg+gCqs 290423|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 702 CGP--GIAVCVEGYCCSKYGYCGKTPDYCGNGCQS 734 775..6699*************************9 PP == domain 4 score: 22.8 bits; conditional E-value: 4.2e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ Cp+++CCsk+GyCG ++ YC++gC++ 290423|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 785 CGS--VYGSCPSGYCCSKYGYCGKSDMYCSTGCNK 817 664..4578************************85 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (824 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 85.37 // Query: 590469|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18 [L=544] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-14 38.5 46.1 6.4e-11 28.6 22.5 3.5 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.4 0.1 0.66 0.66 27 34 .. 59 66 .. 58 67 .. 0.74 2 ? -2.8 2.3 0.42 0.42 7 24 .. 354 374 .. 348 378 .. 0.59 3 ! 24.0 15.7 1.7e-09 1.7e-09 1 36 [. 447 482 .. 447 487 .. 0.89 4 ! 28.6 22.5 6.4e-11 6.4e-11 1 36 [. 504 537 .. 504 542 .. 0.91 Alignments for each domain: == domain 1 score: -3.4 bits; conditional E-value: 0.66 CBM18.hmm 27 sdYCgkgC 34 +++C++++ 590469|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18 59 ETFCTENS 66 67999875 PP == domain 2 score: -2.8 bits; conditional E-value: 0.42 CBM18.hmm 7 ggntCpln...aCCskwGyCG 24 +++ C+++ +C +++ C+ 590469|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18 354 SKSVCKPKdnvVCGNSFSLCN 374 556674444566766677775 PP == domain 3 score: 24.0 bits; conditional E-value: 1.7e-09 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cgk + C ++ CCs G+CG+++++C+ kgCqs 590469|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18 447 RCGK--DFGVCREGFCCSILGWCGNSETHCKisKGCQS 482 6997..6699********************6559***9 PP == domain 4 score: 28.6 bits; conditional E-value: 6.4e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+ g +C ++ CCs G+CGt+++YCg+gCqs 590469|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18 504 RCGE--GFGRCGKGTCCSRLGWCGTSDAYCGTGCQS 537 5885..7799*************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (544 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 60.83 // Query: 378805|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=312] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-38 114.6 105.2 2.6e-14 39.5 18.6 5.0 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.5 18.6 2.6e-14 2.6e-14 2 36 .. 37 69 .. 36 74 .. 0.90 2 ! 33.0 19.2 2.7e-12 2.7e-12 2 36 .. 111 143 .. 109 148 .. 0.90 3 ! 34.2 19.5 1.2e-12 1.2e-12 2 36 .. 194 226 .. 189 231 .. 0.90 4 ! 25.8 24.0 5e-10 5e-10 1 36 [. 272 305 .. 267 310 .. 0.91 Alignments for each domain: == domain 1 score: 39.5 bits; conditional E-value: 2.6e-14 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk+GyCG+t++YCgkgCqs 378805|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 37 CGP--NVAICADGRCCSKYGYCGSTDEYCGKGCQS 69 886..4599*************************9 PP == domain 2 score: 33.0 bits; conditional E-value: 2.7e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk+GyCG t ++CgkgCqs 378805|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 111 CGP--NVAICAEGYCCSKYGYCGKTTAHCGKGCQS 143 675..4489*************************9 PP == domain 3 score: 34.2 bits; conditional E-value: 1.2e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk+GyCG ts++CgkgCqs 378805|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 194 CGP--NVAVCAEGYCCSKYGYCGKTSAHCGKGCQS 226 675..4589*************************9 PP == domain 4 score: 25.8 bits; conditional E-value: 5e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+ + C++++CCsk+GyCG s+YC++gCq+ 378805|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18 272 RCGS--SYGSCASGYCCSKYGYCGKDSNYCSSGCQK 305 5885..6689*************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (312 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 18.74 // Query: 290422|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 [L=864] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-36 109.8 134.3 7.8e-12 31.6 22.2 5.6 5 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.7 17.6 6.3e-11 6.3e-11 2 36 .. 582 614 .. 581 619 .. 0.91 2 ! 25.2 19.6 7.5e-10 7.5e-10 2 36 .. 629 661 .. 628 666 .. 0.90 3 ! 26.4 19.7 3.1e-10 3.1e-10 2 36 .. 676 708 .. 675 713 .. 0.90 4 ! 31.6 22.2 7.8e-12 7.8e-12 2 36 .. 745 777 .. 743 782 .. 0.91 5 ! 22.8 23.2 4.4e-09 4.4e-09 2 36 .. 825 857 .. 820 862 .. 0.88 Alignments for each domain: == domain 1 score: 28.7 bits; conditional E-value: 6.3e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + + C++++CCsk G+CG+t +YCg gCqs 290422|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 582 CGK--NIAICKEGLCCSKNGVCGSTTAYCGLGCQS 614 886..5599*************************9 PP == domain 2 score: 25.2 bits; conditional E-value: 7.5e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg a+ + C++++CCsk+ CG+ts+YCg gCqs 290422|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 629 CG--ANVAVCQEGLCCSKYNSCGSTSNYCGIGCQS 661 77..46699*************************9 PP == domain 3 score: 26.4 bits; conditional E-value: 3.1e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg a+ + C++++CCsk+ CG+ts+YCg gCqs 290422|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 676 CG--ANVAVCQEGLCCSKYNSCGSTSNYCGVGCQS 708 77..46699*************************9 PP == domain 4 score: 31.6 bits; conditional E-value: 7.8e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C +++CCsk+GyCG t+dYCg+gCqs 290422|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 745 CGP--GIAVCVEGYCCSKYGYCGKTPDYCGNGCQS 777 775..6699*************************9 PP == domain 5 score: 22.8 bits; conditional E-value: 4.4e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ Cp+++CCsk+GyCG ++ YC++gC++ 290422|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 825 CGS--VYGSCPSGYCCSKYGYCGKSDMYCSTGCNK 857 664..4578************************85 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (864 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 80.79 // Query: 522134|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18 [L=391] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.9e-11 28.0 20.2 9.9e-11 28.0 20.2 2.7 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.2 0.73 0.73 25 30 .. 126 131 .. 122 133 .. 0.72 2 ! 28.0 20.2 9.9e-11 9.9e-11 1 36 [. 306 340 .. 304 345 .. 0.86 3 ? 1.6 0.1 0.018 0.018 18 27 .. 340 349 .. 340 350 .. 0.85 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.73 CBM18.hmm 25 ttsdYC 30 ++d+C 522134|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18 126 KKNDFC 131 467888 PP == domain 2 score: 28.0 bits; conditional E-value: 9.9e-11 CBM18.hmm 1 qcgkqaggntC.plnaCCskwGyCGttsdYCgkgCqs 36 qcg+ g C + n+CCsk+G+CGt++++Cg gCqs 522134|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18 306 QCGP--GIGACaKANECCSKYGWCGTSEAHCGVGCQS 340 5775..567896667*********************9 PP == domain 3 score: 1.6 bits; conditional E-value: 0.018 CBM18.hmm 18 skwGyCGtts 27 s++G CG++s 522134|Caecom1_GeneCatalog_proteins_20171213.aa.fasta|CBM18 340 SEFGICGNNS 349 799****976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (391 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 17.80 // Query: 550519|Bimnz1_GeneCatalog_proteins_20150128.aa.fasta|CBM18|CBM18|CBM18 [L=403] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-10 27.7 55.2 5.1e-10 25.8 22.1 5.9 5 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 25.8 22.1 5.1e-10 5.1e-10 2 36 .. 25 61 .. 23 66 .. 0.89 2 ! 10.3 27.6 3.3e-05 3.3e-05 2 36 .. 90 126 .. 88 131 .. 0.88 3 ! 15.7 25.1 6.9e-07 6.9e-07 7 36 .. 201 233 .. 192 238 .. 0.83 4 ? -16.3 24.7 1 1 6 38 .] 343 388 .. 337 388 .. 0.54 5 ? -11.8 16.2 1 1 7 20 .. 372 388 .. 363 402 .. 0.68 Alignments for each domain: == domain 1 score: 25.8 bits; conditional E-value: 5.1e-10 CBM18.hmm 2 cgkqaggntCpln...aCCskwGyCGttsdYCgkgCqs 36 cg+ a g tC ++ +CCsk+G+CG++ +YCg+gCqs 550519|Bimnz1_GeneCatalog_proteins_20150128.aa.fasta|CBM18|CBM18|CBM18 25 CGS-AVGLTCSGSafgSCCSKYGHCGSSTAYCGTGCQS 61 885.7799**887788*********************9 PP == domain 2 score: 10.3 bits; conditional E-value: 3.3e-05 CBM18.hmm 2 cgkqaggntCpln...aCCskwGyCGttsdYCgkgCqs 36 cg ++g tC ++ +CCs +G CG++sd Cg+gC+s 550519|Bimnz1_GeneCatalog_proteins_20150128.aa.fasta|CBM18|CBM18|CBM18 90 CGG-SKGYTCSGSkygNCCSRYGRCGSSSDCCGTGCKS 126 774.7899**666677********************98 PP == domain 3 score: 15.7 bits; conditional E-value: 6.9e-07 CBM18.hmm 7 ggntCpln...aCCskwGyCGttsdYCgkgCqs 36 g tC+++ +CC+k+GyCG t+d Cg+gCq 550519|Bimnz1_GeneCatalog_proteins_20150128.aa.fasta|CBM18|CBM18|CBM18 201 FGYTCKGSkwgNCCNKYGYCGKTNDCCGDGCQA 233 4689*888888********************95 PP == domain 4 score: -16.3 bits; conditional E-value: 1 CBM18.hmm 6 aggntCpln.aCCsk........wGyCGttsdYCgk.... 32 a+g+tC +n CC++ +C ++++ C+ 550519|Bimnz1_GeneCatalog_proteins_20150128.aa.fasta|CBM18|CBM18|CBM18 343 ASGATCSSNlGCCDSllgcfnnlCQQCIPSNQLCTIqsfv 382 4677787776787775444433333444444444424555 PP CBM18.hmm 33 gCqsnC 38 +C s+C 550519|Bimnz1_GeneCatalog_proteins_20150128.aa.fasta|CBM18|CBM18|CBM18 383 NCCSQC 388 666666 PP == domain 5 score: -11.8 bits; conditional E-value: 1 CBM18.hmm 7 ggntCpln...aCCskw 20 +++ C + +CCs+ 550519|Bimnz1_GeneCatalog_proteins_20150128.aa.fasta|CBM18|CBM18|CBM18 372 SNQLCTIQsfvNCCSQC 388 456665556789***94 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (403 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 14.66 // Query: 330232|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18 [L=818] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-25 75.2 76.6 3.1e-11 29.7 20.4 3.5 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.7 20.4 3.1e-11 3.1e-11 2 36 .. 604 637 .. 603 642 .. 0.85 2 ! 29.0 20.6 5e-11 5e-11 2 36 .. 687 720 .. 686 725 .. 0.84 3 ! 28.5 19.6 7.3e-11 7.3e-11 2 35 .. 778 810 .. 777 812 .. 0.85 Alignments for each domain: == domain 1 score: 29.7 bits; conditional E-value: 3.1e-11 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCgkgCqs 36 cg+ + C+ + +CCsk+GyCGt+++YCg+gCqs 330232|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18 604 CGP--EYGACAREgQCCSKYGYCGTSDAYCGTGCQS 637 776..557896555*********************9 PP == domain 2 score: 29.0 bits; conditional E-value: 5e-11 CBM18.hmm 2 cgkqaggntC.plnaCCskwGyCGttsdYCgkgCqs 36 cg+ + C +++CCsk+GyCGt+++YCg+gCqs 330232|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18 687 CGP--EYGACtREGQCCSKYGYCGTSDAYCGTGCQS 720 776..5567845669********************9 PP == domain 3 score: 28.5 bits; conditional E-value: 7.3e-11 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCgkgCq 35 cg+ + C+++ +CCsk+GyCG t++YCg+gCq 330232|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18 778 CGP--EYGACAKSgYCCSKYGYCGKTDQYCGTGCQ 810 776..557896655********************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (818 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.34 // Query: 217197|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 [L=104] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-21 60.3 51.5 2.3e-12 33.3 21.2 2.5 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.3 21.2 2.3e-12 2.3e-12 1 36 [. 1 34 [. 1 39 [. 0.93 2 ! 32.6 22.5 3.8e-12 3.8e-12 2 36 .. 67 99 .. 66 104 .] 0.92 Alignments for each domain: == domain 1 score: 33.3 bits; conditional E-value: 2.3e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cgk + +C++++CCs++G+CG ++d+Cg gCqs 217197|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 1 RCGK--NHGKCDEGYCCSEYGWCGESDDHCGIGCQS 34 6997..779**************************9 PP == domain 2 score: 32.6 bits; conditional E-value: 3.8e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + C++++CCsk+G+CG +++Cg+gCqs 217197|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18 67 CGK--DHGSCDKGYCCSKYGWCGKEETHCGTGCQS 99 997..7799*************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (104 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 6.93 // Query: 617108|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=759] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-36 111.0 104.3 7.8e-13 34.8 19.1 4.7 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.6 21.1 3.8e-12 3.8e-12 1 36 [. 480 513 .. 480 518 .. 0.92 2 ! 34.8 19.1 7.8e-13 7.8e-13 2 36 .. 556 588 .. 555 593 .. 0.91 3 ! 32.1 19.8 5.2e-12 5.2e-12 2 36 .. 631 663 .. 628 668 .. 0.89 4 ! 29.6 20.2 3.1e-11 3.1e-11 2 36 .. 720 752 .. 718 754 .. 0.91 Alignments for each domain: == domain 1 score: 32.6 bits; conditional E-value: 3.8e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ + Cp+++CCs +GyCG+t +YCgkgCqs 617108|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 480 QCGP--DYGVCPKGKCCSRYGYCGNTVAYCGKGCQS 513 6887..6699*************************9 PP == domain 2 score: 34.8 bits; conditional E-value: 7.8e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C +n+CCs +GyCG+t +YCgkgCqs 617108|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 556 CGP--GVAVCGNNLCCSRYGYCGNTVAYCGKGCQS 588 775..6799*************************9 PP == domain 3 score: 32.1 bits; conditional E-value: 5.2e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg g + C +n+CCsk+GyCG +s+YCgkgCqs 617108|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 631 CG--LGVAVCGSNLCCSKYGYCGDSSAYCGKGCQS 663 55..36689*************************9 PP == domain 4 score: 29.6 bits; conditional E-value: 3.1e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + Cp++ CCsk+GyCGt ++YCg+gC++ 617108|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 720 CGS--EYGICPNGGCCSKYGYCGTEAAYCGTGCKK 752 775..6789************************85 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (759 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 77.92 // Query: 1175450|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 [L=890] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-41 124.5 141.7 5.1e-12 32.2 18.7 6.3 6 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 32.2 18.7 5.1e-12 5.1e-12 2 36 .. 588 620 .. 585 625 .. 0.90 2 ! 29.4 22.8 3.7e-11 3.7e-11 1 36 [. 660 693 .. 660 698 .. 0.91 3 ! 26.6 22.9 2.7e-10 2.7e-10 2 36 .. 714 746 .. 712 751 .. 0.91 4 ? -1.7 0.1 0.19 0.19 20 27 .. 748 755 .. 746 756 .. 0.83 5 ! 31.8 22.6 6.7e-12 6.7e-12 1 36 [. 790 823 .. 790 828 .. 0.92 6 ! 29.4 21.1 3.6e-11 3.6e-11 2 35 .. 849 880 .. 847 883 .. 0.90 Alignments for each domain: == domain 1 score: 32.2 bits; conditional E-value: 5.1e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + + C++++CCsk+GyCGt+ ++Cg+gCqs 1175450|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 588 CGP--NVAICKEGLCCSKYGYCGTSTAHCGTGCQS 620 775..4589*************************9 PP == domain 2 score: 29.4 bits; conditional E-value: 3.7e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ g + C +++CCsk+G+CGt+ +YCg+gCq+ 1175450|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 660 QCGP--GVAICGNGYCCSKYGWCGTSTAYCGTGCQN 693 6886..7799*************************6 PP == domain 3 score: 26.6 bits; conditional E-value: 2.7e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g + C +++CCsk+GyCG ts YCg+gCq 1175450|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 714 CGP--GVAICGEGYCCSKYGYCGKTSPYCGTGCQT 746 775..6699************************95 PP == domain 4 score: -1.7 bits; conditional E-value: 0.19 CBM18.hmm 20 wGyCGtts 27 +G CGt+s 1175450|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 748 FGECGTSS 755 799**986 PP == domain 5 score: 31.8 bits; conditional E-value: 6.7e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ g + C +++CCsk+G+CGt+s+YCg+gCqs 1175450|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 790 QCGP--GIAICGNGYCCSKYGWCGTSSAYCGTGCQS 823 6886..7799*************************9 PP == domain 6 score: 29.4 bits; conditional E-value: 3.6e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ + Cp+++CCsk+GyCG t+dYC++gC+ 1175450|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 849 CGS--SYGVCPSGYCCSKYGYCGKTADYCSNGCN 880 774..6689************************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (890 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 22.39 // Query: 1185640|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18 [L=216] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-29 87.3 73.3 3.2e-13 36.0 20.5 3.6 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.3 21.7 5.4e-13 5.4e-13 1 35 [. 24 57 .. 24 65 .. 0.93 2 ! 36.0 20.5 3.2e-13 3.2e-13 1 35 [. 79 113 .. 79 119 .. 0.97 3 ! 28.2 15.0 9e-11 9e-11 2 35 .. 177 211 .. 176 212 .. 0.83 Alignments for each domain: == domain 1 score: 35.3 bits; conditional E-value: 5.4e-13 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cgk + C +++CCsk+GyCGt+++YCgkgCq 1185640|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18 24 RCGK-EFNRSCSEGYCCSKYGYCGTSEEYCGKGCQ 57 6997.5599*************************9 PP == domain 2 score: 36.0 bits; conditional E-value: 3.2e-13 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cg++ g++ Cp+n+CCs +GyCGt++++Cg+gC+ 1185640|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18 79 RCGPSYGNTVCPNNKCCSRAGYCGTSKNHCGNGCK 113 6*********************************7 PP == domain 3 score: 28.2 bits; conditional E-value: 9e-11 CBM18.hmm 2 cgkqaggntCpln.aCCskwGyCGttsdYCg..kgCq 35 cg+ + +Cp+n +CCsk+G+CG t+++C+ +gC+ 1185640|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18 177 CGP--SYGRCPGNdLCCSKYGWCGLTDEHCNisSGCN 211 776..5689*9999****************7446886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (216 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 13.94 // Query: 280786|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 [L=88] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-14 38.8 18.0 7.5e-14 38.0 17.9 1.5 1 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.0 17.9 7.5e-14 7.5e-14 1 36 [. 29 62 .. 29 67 .. 0.91 Alignments for each domain: == domain 1 score: 38.0 bits; conditional E-value: 7.5e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ g + C++++CCsk+G+CG + +YCg+gCqs 280786|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18 29 QCGP--GIAVCAEGLCCSKYGWCGDSIEYCGTGCQS 62 6886..779**************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (88 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 5.84 // Query: 14383|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 [L=162] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-17 48.6 45.4 5.4e-13 35.3 24.1 2.7 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.3 24.1 5.4e-13 5.4e-13 2 36 .. 63 95 .. 62 100 .. 0.92 2 ! 16.9 15.1 3e-07 3e-07 2 27 .. 110 133 .. 99 134 .. 0.86 Alignments for each domain: == domain 1 score: 35.3 bits; conditional E-value: 5.4e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + C++n+CCsk+GyCG +s+YCgkgCqs 14383|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 63 CGK--EYGSCDNNECCSKYGYCGKSSEYCGKGCQS 95 887..6799*************************9 PP == domain 2 score: 16.9 bits; conditional E-value: 3e-07 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGtts 27 cg+ g +C +++CCsk+GyCG + 14383|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 110 CGP--GIGKCSNGECCSKYGYCGKGT 133 664..6689**************986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (162 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 6.40 // Query: 509135|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 [L=744] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-15 42.4 84.0 2.2e-08 20.5 19.8 4.4 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.1 1.3 0.25 0.25 29 36 .. 468 477 .. 466 485 .. 0.63 2 ! 20.5 19.8 2.2e-08 2.2e-08 2 36 .. 520 554 .. 519 559 .. 0.86 3 ! 20.2 19.8 2.8e-08 2.8e-08 2 36 .. 589 623 .. 588 628 .. 0.85 4 ! 20.2 19.8 2.8e-08 2.8e-08 2 36 .. 658 692 .. 657 697 .. 0.85 Alignments for each domain: == domain 1 score: -2.1 bits; conditional E-value: 0.25 CBM18.hmm 29 YCg..kgCqs 36 YC+ gCq+ 509135|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 468 YCDidRGCQE 477 7754357774 PP == domain 2 score: 20.5 bits; conditional E-value: 2.2e-08 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg + +C +++CCsk+G+CG ++++C+ gCq+ 509135|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 520 CGD--SYGQCSEGYCCSKYGWCGKSQAHCDidRGCQE 554 775..5689********************75579*96 PP == domain 3 score: 20.2 bits; conditional E-value: 2.8e-08 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg + +C +++CCsk+G+CG ++++C+ gCq+ 509135|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 589 CGG--SFGQCSEGYCCSKYGWCGKSQAHCDidRGCQE 623 674..4589********************75579*96 PP == domain 4 score: 20.2 bits; conditional E-value: 2.8e-08 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg + +C +++CCsk+G+CG ++++C+ gCq+ 509135|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 658 CGG--SFGQCSEGYCCSKYGWCGKSQAHCDidRGCQE 692 674..4589********************75579*96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (744 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 74.26 // Query: 1179318|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 [L=1489] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-17 50.1 50.5 1e-10 28.0 21.7 2.4 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.8 20.8 1.1e-10 1.1e-10 1 36 [. 1354 1390 .. 1354 1395 .. 0.88 2 ! 28.0 21.7 1e-10 1e-10 1 36 [. 1446 1482 .. 1446 1487 .. 0.87 Alignments for each domain: == domain 1 score: 27.8 bits; conditional E-value: 1.1e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cg+ + g+ C +++CCs++GyCGt+++YC+ kgCqs 1179318|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 1354 RCGE-KFGTVCGNGKCCSQYGYCGTSDNYCNinKGCQS 1390 5886.5589*********************7669***9 PP == domain 2 score: 28.0 bits; conditional E-value: 1e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgk..gCqs 36 +cg+ + g+ C +++CCs++GyCGt+++YC+k gCqs 1179318|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18 1446 RCGE-KFGTVCGNGKCCSQYGYCGTSAKYCDKnkGCQS 1482 5886.5589*********************95449**9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1489 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 113.95 // Query: 579287|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=676] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.7e-33 99.0 108.3 1.5e-11 30.7 21.3 4.8 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.7 22.0 1.5e-11 1.5e-11 1 36 [. 469 504 .. 468 509 .. 0.90 2 ! 25.8 23.2 4.9e-10 4.9e-10 2 36 .. 525 559 .. 524 564 .. 0.89 3 ! 30.7 21.3 1.5e-11 1.5e-11 2 36 .. 580 614 .. 579 619 .. 0.89 4 ! 29.7 17.9 2.9e-11 2.9e-11 2 36 .. 635 669 .. 634 671 .. 0.87 Alignments for each domain: == domain 1 score: 30.7 bits; conditional E-value: 1.5e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 qcg+ + +Cp+++CCsk+GyCG t+ YC+ kgCqs 579287|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 469 QCGS--DHGKCPNGYCCSKYGYCGKTERYCSisKGCQS 504 7996..889*********************7669***9 PP == domain 2 score: 25.8 bits; conditional E-value: 4.9e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg+ g +C +++CCsk+GyCG t+ YC+ kgCqs 579287|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 525 CGS--GYGKCSNGYCCSKYGYCGKTERYCSisKGCQS 559 885..889*********************7669***9 PP == domain 3 score: 30.7 bits; conditional E-value: 1.5e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg+ + +Cp+++CCsk+GyCG t+ YC+ kgCqs 579287|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 580 CGS--DHGKCPNGYCCSKYGYCGKTERYCSisKGCQS 614 885..889*********************7669***9 PP == domain 4 score: 29.7 bits; conditional E-value: 2.9e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 cg+ g +Cp+++CCsk+G+CG ++dYC+ gCq 579287|Pirfi3_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18|CBM18 635 CGS--GYGKCPESYCCSKYGWCGKSPDYCKmdRGCQR 669 885..889*********************74469*95 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (676 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 67.67 // Query: 327420|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18 [L=386] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-27 81.0 69.9 3.6e-13 35.8 17.5 4.0 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.2 19.3 2.1e-11 2.1e-11 2 35 .. 24 56 .. 23 62 .. 0.92 2 ! 26.4 17.1 3.3e-10 3.3e-10 1 35 [. 93 127 .. 93 135 .. 0.95 3 ! 35.8 17.5 3.6e-13 3.6e-13 1 35 [. 203 237 .. 203 245 .. 0.95 Alignments for each domain: == domain 1 score: 30.2 bits; conditional E-value: 2.1e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cgk ++g Cp+++CCs+ GyCG ++++Cg+gCq 327420|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18 24 CGK-QNGYICPPGYCCSEDGYCGKSEEFCGSGCQ 56 997.56899************************9 PP == domain 2 score: 26.4 bits; conditional E-value: 3.3e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cg+ g+++Cp+++CC+ +GyCG++ ++C+ gC 327420|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18 93 RCGPLYGDKKCPKGLCCNRFGYCGSSLTHCKFGCP 127 6********************************95 PP == domain 3 score: 35.8 bits; conditional E-value: 3.6e-13 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cg++++ + Cp+n CCs +GyCG tsdYCg+ C 327420|Anasp1_GeneCatalog_proteins_20160330.aa.fasta|CBM18|CBM18|CBM18 203 KCGPKNDHKVCPSNFCCSRFGYCGRTSDYCGSDCE 237 6*******************************995 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (386 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 47.61 // Query: 950403|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18 [L=544] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-14 38.5 46.1 6.4e-11 28.6 22.5 3.5 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.4 0.1 0.66 0.66 27 34 .. 59 66 .. 58 67 .. 0.74 2 ? -2.8 2.3 0.42 0.42 7 24 .. 354 374 .. 348 378 .. 0.59 3 ! 24.0 15.7 1.7e-09 1.7e-09 1 36 [. 447 482 .. 447 487 .. 0.89 4 ! 28.6 22.5 6.4e-11 6.4e-11 1 36 [. 504 537 .. 504 542 .. 0.91 Alignments for each domain: == domain 1 score: -3.4 bits; conditional E-value: 0.66 CBM18.hmm 27 sdYCgkgC 34 +++C++++ 950403|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18 59 ETFCTENS 66 67999875 PP == domain 2 score: -2.8 bits; conditional E-value: 0.42 CBM18.hmm 7 ggntCpln...aCCskwGyCG 24 +++ C+++ +C +++ C+ 950403|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18 354 SKSVCKPKdnvVCGNSFSLCN 374 556674444566766677775 PP == domain 3 score: 24.0 bits; conditional E-value: 1.7e-09 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cgk + C ++ CCs G+CG+++++C+ kgCqs 950403|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18 447 RCGK--DFGVCREGFCCSILGWCGNSETHCKisKGCQS 482 6997..6699********************6559***9 PP == domain 4 score: 28.6 bits; conditional E-value: 6.4e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+ g +C ++ CCs G+CGt+++YCg+gCqs 950403|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18 504 RCGE--GFGRCGKGTCCSRLGWCGTSDAYCGTGCQS 537 5885..7799*************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (544 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 56.63 // [ok]