# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM18/fasta_for_each_cluster/cluster_126.txt # target HMM database: merged_hmms/CBM18.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM18/CBM18_cluster_126.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 386123|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 [L=273] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-34 104.6 148.1 1e-10 28.0 24.0 7.6 6 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.0 24.0 1e-10 1e-10 2 35 .. 4 35 .. 3 37 .. 0.89 2 ! 27.7 19.8 1.3e-10 1.3e-10 2 36 .. 61 93 .. 56 98 .. 0.90 3 ! 17.9 22.3 1.4e-07 1.4e-07 2 35 .. 120 150 .. 113 163 .. 0.84 4 ! 27.3 28.2 1.6e-10 1.6e-10 7 36 .. 171 200 .. 153 206 .. 0.88 5 ! 24.6 21.8 1.2e-09 1.2e-09 2 35 .. 219 250 .. 201 252 .. 0.90 6 ? -2.7 0.2 0.41 0.41 21 25 .. 255 259 .. 254 262 .. 0.66 Alignments for each domain: == domain 1 score: 28.0 bits; conditional E-value: 1e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ + C+ ++CCsk+GyCGtt++YCg+gCq 386123|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 4 CGS--SYGFCNFGECCSKYGYCGTTEEYCGNGCQ 35 774..5578************************9 PP == domain 2 score: 27.7 bits; conditional E-value: 1.3e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ g C+ ++CCs GyCG t++YCg+gCq 386123|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 61 CGS--GVGICNFGECCSRDGYCGKTDEYCGNGCQH 93 774..67899999*********************6 PP == domain 3 score: 17.9 bits; conditional E-value: 1.4e-07 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ g C+ ++CCs+ GyCGtts+YC+ +Cq 386123|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 120 CGP--GYGFCDFEECCSQDGYCGTTSEYCD-SCQ 150 554..55668888****************9.677 PP == domain 4 score: 27.3 bits; conditional E-value: 1.6e-10 CBM18.hmm 7 ggntCplnaCCskwGyCGttsdYCgkgCqs 36 g C +n+CCsk+GyCGtt++YCg gCq+ 386123|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 171 GYGFCGNNECCSKYGYCGTTEEYCGYGCQQ 200 55679999*********************6 PP == domain 5 score: 24.6 bits; conditional E-value: 1.2e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg + C +++CCsk GyCG t+++CgkgCq 386123|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 219 CG--FKYGYCSDDECCSKKGYCGKTEEHCGKGCQ 250 55..3556799**********************9 PP == domain 6 score: -2.7 bits; conditional E-value: 0.41 CBM18.hmm 21 GyCGt 25 GyC+ 386123|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 255 GYCND 259 78875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (273 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 3.72 // Query: 788480|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=1808] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-36 109.8 95.2 2e-12 33.5 15.6 4.5 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.9 22.1 1.2e-11 1.2e-11 1 35 [. 23 56 .. 23 62 .. 0.93 2 ! 32.1 17.0 5.4e-12 5.4e-12 1 36 [. 126 163 .. 126 168 .. 0.92 3 ! 32.0 16.4 5.6e-12 5.6e-12 1 36 [. 180 217 .. 180 222 .. 0.92 4 ! 33.5 15.6 2e-12 2e-12 1 36 [. 234 271 .. 234 276 .. 0.92 Alignments for each domain: == domain 1 score: 30.9 bits; conditional E-value: 1.2e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cgk + Cp+++CCsk+GyCG +sdYC++gCq 788480|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 23 RCGK-DYNRSCPSGYCCSKYGYCGKSSDYCDAGCQ 56 6997.6799*************************9 PP == domain 2 score: 32.1 bits; conditional E-value: 5.4e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cg++++++ Cp+++CCsk+GyCG ++++C+ +gCqs 788480|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 126 KCGPKNNNTVCPDDECCSKYGYCGHSDAHCDvdAGCQS 163 6*****************************84469**9 PP == domain 3 score: 32.0 bits; conditional E-value: 5.6e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cg+++ ++ Cp+++CCsk+GyCG ++++C+ +gCqs 788480|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 180 KCGPKNHNTVCPDDECCSKYGYCGHSDAHCDvdAGCQS 217 6*****************************84469**9 PP == domain 4 score: 33.5 bits; conditional E-value: 2e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cg+++ ++ Cp+++CCsk+GyCG ++++C+ +gCqs 788480|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18 234 KCGPKNHNTVCPDDECCSKYGYCGLSDAHCDvdAGCQS 271 6*****************************84469**9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1808 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 97.56 // Query: 202442|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 [L=1252] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-53 165.4 115.4 3.3e-15 42.4 15.6 5.7 5 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.2 17.8 1.4e-13 1.4e-13 1 35 [. 23 56 .. 23 59 .. 0.92 2 ! 42.4 15.6 3.3e-15 3.3e-15 1 35 [. 96 129 .. 96 132 .. 0.93 3 ! 41.3 18.8 7e-15 7e-15 1 36 [. 162 197 .. 162 199 .. 0.97 4 ! 38.7 14.4 4.7e-14 4.7e-14 1 34 [. 214 247 .. 214 249 .. 0.97 5 ! 30.4 16.7 1.9e-11 1.9e-11 1 36 [. 381 416 .. 381 421 .. 0.95 Alignments for each domain: == domain 1 score: 37.2 bits; conditional E-value: 1.4e-13 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cg + +n+Cp+++CCs++GyCG ts+YC++gCq 202442|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 23 RCG-AVFNNPCPSGYCCSQYGYCGQTSEYCDAGCQ 56 588.4679**************************9 PP == domain 2 score: 42.4 bits; conditional E-value: 3.3e-15 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cg+ +++ Cp+n+CCs++GyCG+ts+YC++gCq 202442|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 96 RCGS-INNMICPNNECCSQYGYCGNTSEYCDTGCQ 129 5884.899**************************9 PP == domain 3 score: 41.3 bits; conditional E-value: 7e-15 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+++g++ Cp+n+CCs++GyCG+t +YC++gCq 202442|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 162 KCGPKNGNKICPNNECCSQYGYCGSTFEYCDSGCQT 197 6*********************************95 PP == domain 4 score: 38.7 bits; conditional E-value: 4.7e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgC 34 +cg++ g++tCp+++CCsk GyCG+t++YC++ C 202442|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 214 RCGPNYGNKTCPDDLCCSKHGYCGNTPEYCDSDC 247 6******************************999 PP == domain 5 score: 30.4 bits; conditional E-value: 1.9e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+++g++ Cp+n CCs++GyCG++ +Cgk C s 202442|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 381 RCGPENGNTICPNNGCCSSFGYCGSGILFCGKLCLS 416 6*******************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1252 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.78 // Query: 604512|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 [L=1251] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-54 168.5 114.2 3.3e-15 42.4 15.6 5.7 5 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.2 17.8 1.4e-13 1.4e-13 1 35 [. 23 56 .. 23 59 .. 0.92 2 ! 42.4 15.6 3.3e-15 3.3e-15 1 35 [. 96 129 .. 96 132 .. 0.93 3 ! 41.3 18.8 7e-15 7e-15 1 36 [. 162 197 .. 162 199 .. 0.97 4 ! 38.7 14.4 4.7e-14 4.7e-14 1 34 [. 214 247 .. 214 249 .. 0.97 5 ! 33.5 15.6 2e-12 2e-12 1 36 [. 380 415 .. 380 420 .. 0.95 Alignments for each domain: == domain 1 score: 37.2 bits; conditional E-value: 1.4e-13 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cg + +n+Cp+++CCs++GyCG ts+YC++gCq 604512|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 23 RCG-AVFNNPCPSGYCCSQYGYCGQTSEYCDAGCQ 56 588.4679**************************9 PP == domain 2 score: 42.4 bits; conditional E-value: 3.3e-15 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cg+ +++ Cp+n+CCs++GyCG+ts+YC++gCq 604512|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 96 RCGS-INNMICPNNECCSQYGYCGNTSEYCDTGCQ 129 5884.899**************************9 PP == domain 3 score: 41.3 bits; conditional E-value: 7e-15 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+++g++ Cp+n+CCs++GyCG+t +YC++gCq 604512|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 162 KCGPKNGNKICPNNECCSQYGYCGSTFEYCDSGCQT 197 6*********************************95 PP == domain 4 score: 38.7 bits; conditional E-value: 4.7e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgC 34 +cg++ g++tCp+++CCsk GyCG+t++YC++ C 604512|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 214 RCGPNYGNKTCPDDLCCSKHGYCGNTPEYCDSDC 247 6******************************999 PP == domain 5 score: 33.5 bits; conditional E-value: 2e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+++g++ Cp+n+CCs++GyCG++ +Cgk C s 604512|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 380 RCGPENGNTICPNNRCCSSFGYCGSGILFCGKLCLS 415 6*******************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1251 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 88.14 // Query: 1433628|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 [L=1030] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-68 212.8 214.2 1e-15 44.0 21.1 8.7 8 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.5 21.7 1.5e-10 1.5e-10 1 36 [. 23 57 .. 23 62 .. 0.93 2 ! 23.9 18.0 1.9e-09 1.9e-09 2 34 .. 342 374 .. 341 386 .. 0.85 3 ! 37.1 20.2 1.4e-13 1.4e-13 1 36 [. 480 515 .. 480 520 .. 0.96 4 ! 38.0 20.7 7.8e-14 7.8e-14 1 36 [. 537 572 .. 537 577 .. 0.96 5 ! 38.7 21.3 4.5e-14 4.5e-14 1 36 [. 594 629 .. 594 634 .. 0.96 6 ! 44.0 21.1 1e-15 1e-15 1 36 [. 651 686 .. 651 691 .. 0.96 7 ! 22.5 20.6 5.2e-09 5.2e-09 2 37 .. 787 822 .. 786 826 .. 0.96 8 ! 25.4 14.7 6.6e-10 6.6e-10 2 36 .. 844 878 .. 843 880 .. 0.97 Alignments for each domain: == domain 1 score: 27.5 bits; conditional E-value: 1.5e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcgk ++ Cp+++CCs+ GyCG + +YCg gCq 1433628|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 23 QCGK-ENNVSCPSGYCCSQEGYCGKSIEYCGVGCQT 57 7996.779***************************6 PP == domain 2 score: 23.9 bits; conditional E-value: 1.9e-09 CBM18.hmm 2 cgkqagg.ntCplnaCCskwGyCGttsdYCgkgC 34 cg+q ++ Cp+n+CCs +G+CG++ YCg+ C 1433628|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 342 CGQQGNKiVVCPGNECCSIYGWCGSSRPYCGD-C 374 9988877689*********************6.4 PP == domain 3 score: 37.1 bits; conditional E-value: 1.4e-13 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++++++ Cp+n+CCs GyCGt+++YCg+gCqs 1433628|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 480 KCGPNNNDTVCPDNKCCSRKGYCGTSDAYCGTGCQS 515 6**********************************9 PP == domain 4 score: 38.0 bits; conditional E-value: 7.8e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++++++ Cp+n+CCs GyCGt+++YCg+gCqs 1433628|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 537 KCGPNNNNTVCPDNKCCSRKGYCGTSDAYCGTGCQS 572 6**********************************9 PP == domain 5 score: 38.7 bits; conditional E-value: 4.5e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++++++ Cp+n+CCsk GyCGt+++YCg+gCqs 1433628|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 594 KCGPNNNNTVCPDNKCCSKKGYCGTSDAYCGTGCQS 629 6**********************************9 PP == domain 6 score: 44.0 bits; conditional E-value: 1e-15 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++++++ Cp+n+CCsk+GyCGtts+YCg+gCqs 1433628|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 651 KCGPDNNNTVCPDNKCCSKYGYCGTTSAYCGTGCQS 686 6**********************************9 PP == domain 7 score: 22.5 bits; conditional E-value: 5.2e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 cg++ g+ +C ++CCs+ G CG + d+C +gCq+n 1433628|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 787 CGPKYGNRKCGFGECCSQDGRCGFGFDFCFEGCQKN 822 **********************************87 PP == domain 8 score: 25.4 bits; conditional E-value: 6.6e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg++ g+ +C ++CCsk G CG + d+C +gCq 1433628|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 844 CGPKYGNRKCSFGNCCSKDGRCGFGFDFCFDGCQR 878 9********************************95 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1030 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 68.16 // Query: 697157|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 [L=1252] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-53 165.4 115.4 3.3e-15 42.4 15.6 5.7 5 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.2 17.8 1.4e-13 1.4e-13 1 35 [. 23 56 .. 23 59 .. 0.92 2 ! 42.4 15.6 3.3e-15 3.3e-15 1 35 [. 96 129 .. 96 132 .. 0.93 3 ! 41.3 18.8 7e-15 7e-15 1 36 [. 162 197 .. 162 199 .. 0.97 4 ! 38.7 14.4 4.7e-14 4.7e-14 1 34 [. 214 247 .. 214 249 .. 0.97 5 ! 30.4 16.7 1.9e-11 1.9e-11 1 36 [. 381 416 .. 381 421 .. 0.95 Alignments for each domain: == domain 1 score: 37.2 bits; conditional E-value: 1.4e-13 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cg + +n+Cp+++CCs++GyCG ts+YC++gCq 697157|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 23 RCG-AVFNNPCPSGYCCSQYGYCGQTSEYCDAGCQ 56 588.4679**************************9 PP == domain 2 score: 42.4 bits; conditional E-value: 3.3e-15 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cg+ +++ Cp+n+CCs++GyCG+ts+YC++gCq 697157|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 96 RCGS-INNMICPNNECCSQYGYCGNTSEYCDTGCQ 129 5884.899**************************9 PP == domain 3 score: 41.3 bits; conditional E-value: 7e-15 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+++g++ Cp+n+CCs++GyCG+t +YC++gCq 697157|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 162 KCGPKNGNKICPNNECCSQYGYCGSTFEYCDSGCQT 197 6*********************************95 PP == domain 4 score: 38.7 bits; conditional E-value: 4.7e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgC 34 +cg++ g++tCp+++CCsk GyCG+t++YC++ C 697157|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 214 RCGPNYGNKTCPDDLCCSKHGYCGNTPEYCDSDC 247 6******************************999 PP == domain 5 score: 30.4 bits; conditional E-value: 1.9e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+++g++ Cp+n CCs++GyCG++ +Cgk C s 697157|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18 381 RCGPENGNTICPNNGCCSSFGYCGSGILFCGKLCLS 416 6*******************************9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1252 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 98.08 // Query: 1755210|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18 [L=120] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-18 53.2 49.1 2.7e-12 33.0 18.7 2.3 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.1 22.4 4e-10 4e-10 1 37 [. 17 53 .. 17 57 .. 0.96 2 ! 33.0 18.7 2.7e-12 2.7e-12 2 36 .. 78 112 .. 77 114 .. 0.96 Alignments for each domain: == domain 1 score: 26.1 bits; conditional E-value: 4e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 +cg+++g +C + CCsk G CG + +YC +gCqsn 1755210|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18 17 NCGPNNGYVKCSFGDCCSKEGKCGFGYEYCYEGCQSN 53 5***********************************8 PP == domain 2 score: 33.0 bits; conditional E-value: 2.7e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg++ g ++C ++CCsk G CG + +YCg+gCqs 1755210|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18 78 CGPKYGFKKCSFGNCCSKDGRCGFGHEYCGEGCQS 112 **********************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (120 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 18.31 // Query: 529450|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18 [L=130] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-15 42.3 17.3 5.9e-15 41.6 17.3 1.4 1 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 41.6 17.3 5.9e-15 5.9e-15 3 36 .. 86 119 .. 84 126 .. 0.94 Alignments for each domain: == domain 1 score: 41.6 bits; conditional E-value: 5.9e-15 CBM18.hmm 3 gkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 g++a+g+ Cp+++CCsk+GyCGtt++YCg+ Cq+ 529450|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18 86 GPNANGTICPNENCCSKYGYCGTTDAYCGSTCQE 119 8899*****************************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (130 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 23.39 // Query: 760747|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18 [L=235] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-21 61.4 41.8 1.7e-14 40.1 17.3 2.7 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 0.0 0.71 0.71 29 32 .. 13 16 .. 11 18 .. 0.70 2 ! 40.1 17.3 1.7e-14 1.7e-14 3 36 .. 154 187 .. 152 192 .. 0.94 3 ! 29.0 14.0 5.1e-11 5.1e-11 9 35 .. 200 227 .. 193 233 .. 0.88 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.71 CBM18.hmm 29 YCgk 32 YC++ 760747|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18 13 YCDE 16 8876 PP == domain 2 score: 40.1 bits; conditional E-value: 1.7e-14 CBM18.hmm 3 gkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 g++a+g+ Cp+++CCsk+GyCGtt++YCg+ Cq+ 760747|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18 154 GPNANGTICPNENCCSKYGYCGTTDAYCGSTCQE 187 8899*****************************6 PP == domain 3 score: 29.0 bits; conditional E-value: 5.1e-11 CBM18.hmm 9 ntC.plnaCCskwGyCGttsdYCgkgCq 35 +C ++++CCs++GyCG++ +YCg+ Cq 760747|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18 200 GKClNPKECCSQYGYCGSSGNYCGTRCQ 227 57865669*******************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (235 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 35.45 // Query: 869679|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 [L=477] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-59 183.5 218.7 5.3e-14 38.5 19.5 11.4 10 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.5 19.5 5.3e-14 5.3e-14 2 35 .. 26 58 .. 25 60 .. 0.92 2 ! 36.8 20.5 1.8e-13 1.8e-13 2 36 .. 74 106 .. 69 114 .. 0.91 3 ! 37.3 21.0 1.2e-13 1.2e-13 2 36 .. 153 185 .. 148 192 .. 0.89 4 ! 36.9 21.3 1.6e-13 1.6e-13 2 36 .. 214 246 .. 209 254 .. 0.89 5 ? -2.5 0.2 0.34 0.34 18 25 .. 270 277 .. 270 279 .. 0.81 6 ! 3.9 1.9 0.0033 0.0033 14 26 .. 303 315 .. 299 316 .. 0.74 7 ! 27.2 23.7 1.8e-10 1.8e-10 2 35 .. 305 336 .. 304 338 .. 0.89 8 ? -2.3 6.4 0.29 0.29 20 35 .. 339 353 .. 337 360 .. 0.89 9 ! 22.4 30.2 5.6e-09 5.6e-09 2 35 .. 371 402 .. 354 404 .. 0.92 10 ! 28.3 16.9 8.3e-11 8.3e-11 7 35 .. 426 454 .. 418 456 .. 0.88 Alignments for each domain: == domain 1 score: 38.5 bits; conditional E-value: 5.3e-14 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ +g +C++n+CCsk+GyCGtt++YCg+gCq 869679|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 26 CGS-ENGVHCKNNECCSKYGYCGTTDAYCGQGCQ 58 895.6799*************************9 PP == domain 2 score: 36.8 bits; conditional E-value: 1.8e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + C++n+CCsk+GyCGtt++YCg+gCqs 869679|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 74 CG--VDYGICKNNKCCSKYGYCGTTDAYCGDGCQS 106 66..36689*************************9 PP == domain 3 score: 37.3 bits; conditional E-value: 1.2e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + C++n+CCsk+GyCGtt++YCg+gCqs 869679|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 153 CG--VEYGICKNNKCCSKYGYCGTTDEYCGDGCQS 185 66..36689*************************9 PP == domain 4 score: 36.9 bits; conditional E-value: 1.6e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + C++n+CCsk+GyCGtt++YCg+gCqs 869679|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 214 CG--VEYGICKNNKCCSKYGYCGTTDEYCGDGCQS 246 55..36678*************************9 PP == domain 5 score: -2.5 bits; conditional E-value: 0.34 CBM18.hmm 18 skwGyCGt 25 s++G CG 869679|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 270 SSSGKCGV 277 78899996 PP == domain 6 score: 3.9 bits; conditional E-value: 0.0033 CBM18.hmm 14 naCCskwGyCGtt 26 ++C s++G+C+ + 869679|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 303 GRCGSSYGFCNFG 315 6788888888765 PP == domain 7 score: 27.2 bits; conditional E-value: 1.8e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ + C+ ++CCsk+GyCGtt++YCg+gCq 869679|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 305 CGS--SYGFCNFGECCSKYGYCGTTEEYCGNGCQ 336 774..5578************************9 PP == domain 8 score: -2.3 bits; conditional E-value: 0.29 CBM18.hmm 20 wGyCGttsdYCgkgCq 35 +G C ++YC+ +Cq 869679|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 339 FGDCDQFNQYCD-SCQ 353 899********9.788 PP == domain 9 score: 22.4 bits; conditional E-value: 5.6e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ g C +n+CCsk+GyCGtt++YCg gCq 869679|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 371 CGS--GYGFCGNNECCSKSGYCGTTEEYCGYGCQ 402 774..7788************************9 PP == domain 10 score: 28.3 bits; conditional E-value: 8.3e-11 CBM18.hmm 7 ggntCplnaCCskwGyCGttsdYCgkgCq 35 + C +++CCsk GyCG t+++CgkgCq 869679|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 426 KYGYCSDDECCSKKGYCGKTEEHCGKGCQ 454 5577************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (477 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 9.02 // Query: 790805|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 [L=293] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-28 82.8 82.2 1.8e-14 40.0 24.0 3.9 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.0 24.0 1.8e-14 1.8e-14 1 36 [. 23 58 .. 23 63 .. 0.96 2 ? 1.3 0.1 0.023 0.023 18 25 .. 58 65 .. 58 68 .. 0.86 3 ! 24.0 22.4 1.8e-09 1.8e-09 1 37 [. 134 170 .. 134 174 .. 0.96 4 ! 31.0 18.7 1.2e-11 1.2e-11 2 36 .. 195 229 .. 194 231 .. 0.96 Alignments for each domain: == domain 1 score: 40.0 bits; conditional E-value: 1.8e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++ g+++C +n+CCskwGyCGt++++C++gCqs 790805|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 23 RCGPDYGNKKCTNNECCSKWGYCGTSEKHCSSGCQS 58 6**********************************9 PP == domain 2 score: 1.3 bits; conditional E-value: 0.023 CBM18.hmm 18 skwGyCGt 25 sk+G CG+ 790805|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 58 SKYGRCGS 65 89*****8 PP == domain 3 score: 24.0 bits; conditional E-value: 1.8e-09 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 +cg+++g +C + CCsk G CG + +YC +gCqsn 790805|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 134 NCGPNNGYVKCSFGDCCSKEGKCGFGYEYCYEGCQSN 170 5***********************************8 PP == domain 4 score: 31.0 bits; conditional E-value: 1.2e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg++ g ++C ++CCsk G CG + +YCg+gCqs 790805|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 195 CGPKYGFKKCSFGNCCSKDGRCGFGHEYCGEGCQS 229 **********************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (293 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 14.91 // Query: 545968|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18 [L=428] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-20 57.0 49.7 1e-12 34.4 17.1 3.4 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.4 17.1 1e-12 1e-12 7 36 .. 344 373 .. 340 375 .. 0.92 2 ? -0.5 0.3 0.08 0.08 17 25 .. 378 386 .. 376 392 .. 0.89 3 ! 29.7 21.1 2.9e-11 2.9e-11 7 36 .. 391 421 .. 383 426 .. 0.81 Alignments for each domain: == domain 1 score: 34.4 bits; conditional E-value: 1e-12 CBM18.hmm 7 ggntCplnaCCskwGyCGttsdYCgkgCqs 36 +g+ Cp+++CCsk+GyCGt++ YCg+ Cq 545968|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18 344 NGTICPNGKCCSKYGYCGTSDSYCGSTCQD 373 6899************************95 PP == domain 2 score: -0.5 bits; conditional E-value: 0.08 CBM18.hmm 17 CskwGyCGt 25 Cs G CG 545968|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18 378 CSYGGRCGV 386 9999***95 PP == domain 3 score: 29.7 bits; conditional E-value: 2.9e-11 CBM18.hmm 7 ggntC.plnaCCskwGyCGttsdYCgkgCqs 36 + +C ++++CCs++GyCG+++dYCg+gCq+ 545968|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18 391 NFGKClNPKECCSQYGYCGSSEDYCGTGCQQ 421 5579966669********************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (428 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 21.99 // Query: 1433589|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 [L=1804] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-36 109.9 95.2 2e-12 33.5 15.6 4.5 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.9 22.1 1.2e-11 1.2e-11 1 35 [. 23 56 .. 23 62 .. 0.93 2 ! 32.1 17.0 5.4e-12 5.4e-12 1 36 [. 126 163 .. 126 168 .. 0.92 3 ! 32.0 16.4 5.6e-12 5.6e-12 1 36 [. 180 217 .. 180 222 .. 0.92 4 ! 33.5 15.6 2e-12 2e-12 1 36 [. 234 271 .. 234 276 .. 0.92 Alignments for each domain: == domain 1 score: 30.9 bits; conditional E-value: 1.2e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cgk + Cp+++CCsk+GyCG +sdYC++gCq 1433589|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 23 RCGK-DYNRSCPSGYCCSKYGYCGKSSDYCDAGCQ 56 6997.6799*************************9 PP == domain 2 score: 32.1 bits; conditional E-value: 5.4e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cg++++++ Cp+++CCsk+GyCG ++++C+ +gCqs 1433589|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 126 KCGPKNNNTVCPDDECCSKYGYCGHSDAHCDvdAGCQS 163 6*****************************84469**9 PP == domain 3 score: 32.0 bits; conditional E-value: 5.6e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cg+++ ++ Cp+++CCsk+GyCG ++++C+ +gCqs 1433589|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 180 KCGPKNHNTVCPDDECCSKYGYCGHSDAHCDvdAGCQS 217 6*****************************84469**9 PP == domain 4 score: 33.5 bits; conditional E-value: 2e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cg+++ ++ Cp+++CCsk+GyCG ++++C+ +gCqs 1433589|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18 234 KCGPKNHNTVCPDDECCSKYGYCGLSDAHCDvdAGCQS 271 6*****************************84469**9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1804 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 113.65 // Query: 654013|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 [L=494] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-26 78.3 79.4 3.4e-14 39.1 18.4 4.6 5 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.1 0.37 0.37 28 32 .. 54 58 .. 53 64 .. 0.66 2 ! 26.7 16.8 2.5e-10 2.5e-10 2 36 .. 354 386 .. 353 388 .. 0.91 3 ! 39.1 18.4 3.4e-14 3.4e-14 1 36 [. 404 439 .. 404 441 .. 0.96 4 ? -0.6 0.3 0.089 0.089 17 25 .. 444 452 .. 442 458 .. 0.89 5 ! 29.7 21.0 3.1e-11 3.1e-11 7 36 .. 457 487 .. 449 492 .. 0.81 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.37 CBM18.hmm 28 dYCgk 32 dYC++ 654013|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 54 DYCDN 58 67874 PP == domain 2 score: 26.7 bits; conditional E-value: 2.5e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + +Cp ++CCsk G CG+t +YCg+ Cqs 654013|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 354 CGR--NIGKCPYGQCCSKEGTCGNTLKYCGADCQS 386 786..4589*************************9 PP == domain 3 score: 39.1 bits; conditional E-value: 3.4e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++ +g+ Cp+++CCsk+GyCGt++ YCg+ Cq 654013|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 404 KCGPKVNGTICPNGKCCSKYGYCGTSDSYCGSTCQD 439 6*********************************95 PP == domain 4 score: -0.6 bits; conditional E-value: 0.089 CBM18.hmm 17 CskwGyCGt 25 Cs G CG 654013|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 444 CSYGGRCGV 452 9999***95 PP == domain 5 score: 29.7 bits; conditional E-value: 3.1e-11 CBM18.hmm 7 ggntC.plnaCCskwGyCGttsdYCgkgCqs 36 + +C ++++CCs++GyCG+++dYCg+gCq+ 654013|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 457 NFGKClNPKECCSQYGYCGSSEDYCGTGCQQ 487 5579966669********************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (494 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 23.91 // Query: 651150|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 [L=683] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-26 76.5 79.4 1.6e-14 40.1 18.7 4.3 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.4 20.4 2.5e-08 2.5e-08 2 36 .. 335 367 .. 334 372 .. 0.90 2 ! 40.1 18.7 1.6e-14 1.6e-14 1 36 [. 593 628 .. 593 630 .. 0.96 3 ? -1.2 0.3 0.14 0.14 17 25 .. 633 641 .. 631 644 .. 0.88 4 ! 29.5 21.6 3.4e-11 3.4e-11 7 37 .. 646 677 .. 638 681 .. 0.81 Alignments for each domain: == domain 1 score: 20.4 bits; conditional E-value: 2.5e-08 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + +Cp ++CCs+ G CG+t +YCg Cqs 651150|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 335 CGK--NIGKCPYGQCCSNEGTCGNTIKYCGIDCQS 367 887..5589*************************9 PP == domain 2 score: 40.1 bits; conditional E-value: 1.6e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++a+g+ Cp+++CCsk+GyCGt+++YCg+ Cq 651150|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 593 KCGPKANGTICPNGKCCSKYGYCGTSDAYCGSTCQD 628 6*********************************95 PP == domain 3 score: -1.2 bits; conditional E-value: 0.14 CBM18.hmm 17 CskwGyCGt 25 Cs G CG 651150|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 633 CSYGGRCGV 641 9999***95 PP == domain 4 score: 29.5 bits; conditional E-value: 3.4e-11 CBM18.hmm 7 ggntC.plnaCCskwGyCGttsdYCgkgCqsn 37 + +C ++++CCs++GyCG+++dYCg+gCq+n 651150|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 646 NFGKClNPKECCSQYGYCGSSEDYCGTGCQQN 677 5579966669********************97 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (683 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 33.16 // Query: 335074|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 [L=160] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-39 120.1 78.4 7.8e-17 47.6 21.1 3.7 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 41.9 20.3 4.5e-15 4.5e-15 1 36 [. 6 41 .. 6 46 .. 0.96 2 ! 42.6 21.0 2.8e-15 2.8e-15 1 36 [. 63 98 .. 63 103 .. 0.96 3 ! 47.6 21.1 7.8e-17 7.8e-17 1 36 [. 120 155 .. 120 160 .] 0.96 Alignments for each domain: == domain 1 score: 41.9 bits; conditional E-value: 4.5e-15 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++++++ Cp+n+CCs GyCGt+++YCg+gCqs 335074|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 6 KCGPNNNNTVCPDNKCCSRKGYCGTSDAYCGTGCQS 41 6**********************************9 PP == domain 2 score: 42.6 bits; conditional E-value: 2.8e-15 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++++++ Cp+n+CCsk GyCGt+++YCg+gCqs 335074|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 63 KCGPNNNNTVCPDNKCCSKKGYCGTSDAYCGTGCQS 98 6**********************************9 PP == domain 3 score: 47.6 bits; conditional E-value: 7.8e-17 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++++++ Cp+n+CCsk+GyCGtts+YCg+gCqs 335074|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 120 KCGPDNNNTVCPDNKCCSKYGYCGTTSAYCGTGCQS 155 6**********************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (160 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 6.40 // Query: 1185883|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 [L=816] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-58 181.0 192.6 6.2e-16 44.7 21.5 8.5 8 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.4 22.4 1.8e-11 1.8e-11 1 36 [. 23 57 .. 23 62 .. 0.93 2 ! 25.4 17.9 6.6e-10 6.6e-10 1 36 [. 285 322 .. 285 327 .. 0.89 3 ! 31.4 15.5 8.5e-12 8.5e-12 9 37 .. 372 399 .. 363 400 .. 0.84 4 ? 0.5 1.5 0.041 0.041 11 25 .. 396 407 .. 395 409 .. 0.82 5 ! 44.7 21.5 6.2e-16 6.2e-16 1 36 [. 493 528 .. 493 533 .. 0.96 6 ! 41.6 21.8 5.8e-15 5.8e-15 1 36 [. 575 610 .. 575 615 .. 0.96 7 ! 24.5 18.7 1.2e-09 1.2e-09 2 37 .. 714 749 .. 713 753 .. 0.95 8 ! 24.3 21.6 1.5e-09 1.5e-09 2 37 .. 773 808 .. 772 812 .. 0.96 Alignments for each domain: == domain 1 score: 30.4 bits; conditional E-value: 1.8e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcg+ +g Cp+++CCs+ GyCG + +YCg+gCqs 1185883|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 23 QCGE-ENGVSCPTGYCCSQQGYCGKSLEYCGEGCQS 57 7995.789***************************9 PP == domain 2 score: 25.4 bits; conditional E-value: 6.6e-10 CBM18.hmm 1 qcgkqagg.ntCplnaCCskwGyCGttsdYCgkg.Cqs 36 qcg+ g+ + Cp+n+CCs +G+CG+t+d Cg+g C s 1185883|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 285 QCGRRGGKvILCPGNLCCSRSGWCGNTEDNCGSGnCLS 322 7999887779**********************876876 PP == domain 3 score: 31.4 bits; conditional E-value: 8.5e-12 CBM18.hmm 9 ntCplnaCCskwGyCGttsdYCgkgCqsn 37 Cp+n+CCs+wG+CG++ +YC+ +C sn 1185883|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 372 VVCPGNECCSQWGWCGSSREYCE-NCDSN 399 68********************9.89997 PP == domain 4 score: 0.5 bits; conditional E-value: 0.041 CBM18.hmm 11 CplnaCCskwGyCGt 25 C++n sk+G CG+ 1185883|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 396 CDSN---SKYGKCGP 407 7777...99*****7 PP == domain 5 score: 44.7 bits; conditional E-value: 6.2e-16 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+++g++ Cp+n+CCsk+GyCGtt++YCgk+Cqs 1185883|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 493 KCGPKNGNTVCPNNKCCSKYGYCGTTDAYCGKNCQS 528 6**********************************9 PP == domain 6 score: 41.6 bits; conditional E-value: 5.8e-15 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg+++g++ Cp+++CCsk+GyCGtt++YCg+gCqs 1185883|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 575 KCGPKNGNTVCPDSKCCSKYGYCGTTDAYCGNGCQS 610 6**********************************9 PP == domain 7 score: 24.5 bits; conditional E-value: 1.2e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 cg+ gg++Cp ++CCs+ G CG + d+C +gCq n 1185883|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 714 CGPRYGGKKCPFGECCSEEGRCGFGFDFCFDGCQRN 749 **********************************86 PP == domain 8 score: 24.3 bits; conditional E-value: 1.5e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 cg++ gg++Cp ++CCsk G CG + dYC +gCq n 1185883|Orpsp1_1_GeneCatalog_proteins_20140826.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 773 CGPKYGGKKCPFGECCSKDGKCGFGFDYCFDGCQRN 808 9*********************************86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (816 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 24.56 // Query: 1034394|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 [L=491] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-58 181.3 221.0 1.3e-13 37.3 21.0 11.7 10 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.9 22.2 3.4e-13 3.4e-13 2 35 .. 26 58 .. 25 64 .. 0.92 2 ? -1.9 0.0 0.23 0.23 20 27 .. 61 68 .. 59 69 .. 0.79 3 ! 36.7 20.5 1.9e-13 1.9e-13 2 36 .. 88 120 .. 83 128 .. 0.91 4 ! 37.3 21.0 1.3e-13 1.3e-13 2 36 .. 167 199 .. 162 206 .. 0.89 5 ! 36.8 21.4 1.9e-13 1.9e-13 2 36 .. 228 260 .. 223 267 .. 0.89 6 ? -2.5 0.2 0.35 0.35 18 25 .. 284 291 .. 284 293 .. 0.81 7 ! 26.9 24.1 2.3e-10 2.3e-10 2 35 .. 319 350 .. 313 352 .. 0.90 8 ? -3.5 7.7 0.68 0.68 20 35 .. 353 367 .. 351 377 .. 0.87 9 ! 22.6 29.9 4.8e-09 4.8e-09 2 35 .. 385 416 .. 368 418 .. 0.92 10 ! 28.2 16.9 8.6e-11 8.6e-11 7 35 .. 440 468 .. 432 470 .. 0.88 Alignments for each domain: == domain 1 score: 35.9 bits; conditional E-value: 3.4e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ +g +C++n+CCsk+GyCGtt++YCg+gCq 1034394|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 26 CGS-ENGVHCKNNECCSKYGYCGTTDAYCGQGCQ 58 895.6799*************************9 PP == domain 2 score: -1.9 bits; conditional E-value: 0.23 CBM18.hmm 20 wGyCGtts 27 +G+C++++ 1034394|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 61 FGHCNSSP 68 89999876 PP == domain 3 score: 36.7 bits; conditional E-value: 1.9e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + C++n+CCsk+GyCGtt++YCg+gCqs 1034394|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 88 CG--VDYGICKNNKCCSKYGYCGTTDAYCGDGCQS 120 66..36689*************************9 PP == domain 4 score: 37.3 bits; conditional E-value: 1.3e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + C++n+CCsk+GyCGtt++YCg+gCqs 1034394|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 167 CG--VEYGICKNNKCCSKYGYCGTTDEYCGDGCQS 199 66..36689*************************9 PP == domain 5 score: 36.8 bits; conditional E-value: 1.9e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + C++n+CCsk+GyCGtt++YCg+gCqs 1034394|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 228 CG--VEYGICKNNKCCSKYGYCGTTDEYCGDGCQS 260 55..36678*************************9 PP == domain 6 score: -2.5 bits; conditional E-value: 0.35 CBM18.hmm 18 skwGyCGt 25 s++G CG 1034394|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 284 SSSGKCGV 291 78899996 PP == domain 7 score: 26.9 bits; conditional E-value: 2.3e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ + C+ ++CCsk+GyCGtt++YCg+gCq 1034394|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 319 CGS--SYGFCNFGECCSKYGYCGTTEEYCGNGCQ 350 774..5578************************9 PP == domain 8 score: -3.5 bits; conditional E-value: 0.68 CBM18.hmm 20 wGyCGttsdYCgkgCq 35 +G C ++YC+ +Cq 1034394|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 353 FGDCDQFNQYCD-SCQ 367 899********9.787 PP == domain 9 score: 22.6 bits; conditional E-value: 4.8e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ g C +n+CCsk+GyCGtt++YCg gCq 1034394|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 385 CGS--GYGFCGNNECCSKSGYCGTTEEYCGYGCQ 416 774..7788************************9 PP == domain 10 score: 28.2 bits; conditional E-value: 8.6e-11 CBM18.hmm 7 ggntCplnaCCskwGyCGttsdYCgkgCq 35 + C +++CCsk GyCG t+++CgkgCq 1034394|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 440 KYGYCSDDECCSKKGYCGKTEEHCGKGCQ 468 5577************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (491 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.02 // Query: 663752|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 [L=415] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-48 149.2 195.7 9.5e-14 37.7 20.9 10.6 9 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.0 20.5 1.5e-13 1.5e-13 2 36 .. 12 44 .. 7 52 .. 0.91 2 ! 37.7 20.9 9.5e-14 9.5e-14 2 36 .. 91 123 .. 86 131 .. 0.90 3 ! 36.2 22.3 2.9e-13 2.9e-13 2 36 .. 152 184 .. 148 189 .. 0.88 4 ? -2.3 0.2 0.29 0.29 18 25 .. 208 215 .. 208 217 .. 0.81 5 ! 26.8 24.4 2.3e-10 2.3e-10 2 35 .. 243 274 .. 237 276 .. 0.90 6 ? -3.5 8.0 0.7 0.7 20 35 .. 277 291 .. 275 302 .. 0.86 7 ! 19.4 33.5 5.1e-08 5.1e-08 2 35 .. 309 340 .. 290 342 .. 0.92 8 ! 28.5 16.9 7e-11 7e-11 7 35 .. 364 392 .. 356 394 .. 0.88 9 ? -3.7 0.1 0.82 0.82 21 25 .. 397 401 .. 397 404 .. 0.64 Alignments for each domain: == domain 1 score: 37.0 bits; conditional E-value: 1.5e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + C++n+CCsk+GyCGtt++YCg+gCqs 663752|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 12 CG--VDYGICKNNKCCSKYGYCGTTDAYCGDGCQS 44 66..36689*************************9 PP == domain 2 score: 37.7 bits; conditional E-value: 9.5e-14 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + C++n+CCsk+GyCGtt++YCg+gCqs 663752|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 91 CG--VEYGICKNNKCCSKYGYCGTTDEYCGDGCQS 123 66..36689*************************9 PP == domain 3 score: 36.2 bits; conditional E-value: 2.9e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + C++n+CCsk+GyCGtt++YCg+gCqs 663752|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 152 CG--VEYGICKNNKCCSKYGYCGTTDEYCGDGCQS 184 55..36678*************************9 PP == domain 4 score: -2.3 bits; conditional E-value: 0.29 CBM18.hmm 18 skwGyCGt 25 s++G CG 663752|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 208 SSSGKCGV 215 78899996 PP == domain 5 score: 26.8 bits; conditional E-value: 2.3e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ + C+ ++CCsk+GyCGtt++YCg+gCq 663752|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 243 CGS--SYGFCNFGECCSKYGYCGTTEEYCGNGCQ 274 774..5578************************9 PP == domain 6 score: -3.5 bits; conditional E-value: 0.7 CBM18.hmm 20 wGyCGttsdYCgkgCq 35 +G C ++YC+ +Cq 663752|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 277 FGDCDQFNQYCD-SCQ 291 899********9.687 PP == domain 7 score: 19.4 bits; conditional E-value: 5.1e-08 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ g C +n+CCsk+GyCGtt++YCg gCq 663752|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 309 CGS--GYGFCGNNECCSKSGYCGTTEEYCGYGCQ 340 774..7788************************9 PP == domain 8 score: 28.5 bits; conditional E-value: 7e-11 CBM18.hmm 7 ggntCplnaCCskwGyCGttsdYCgkgCq 35 + C +++CCsk GyCG t+++CgkgCq 663752|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 364 KYGYCSDDECCSKKGYCGKTEEHCGKGCQ 392 5577************************9 PP == domain 9 score: -3.7 bits; conditional E-value: 0.82 CBM18.hmm 21 GyCGt 25 GyC+ 663752|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 397 GYCND 401 78865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (415 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.84 // Query: 620805|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 [L=707] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-24 71.9 83.8 5.3e-14 38.5 18.4 4.5 5 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.4 0.1 0.68 0.68 28 32 .. 54 58 .. 53 62 .. 0.64 2 ! 22.9 20.2 3.9e-09 3.9e-09 2 36 .. 354 386 .. 353 391 .. 0.90 3 ! 38.5 18.4 5.3e-14 5.3e-14 1 36 [. 617 652 .. 617 654 .. 0.96 4 ? -1.4 0.5 0.16 0.16 17 25 .. 657 665 .. 655 668 .. 0.88 5 ! 28.8 21.2 5.8e-11 5.8e-11 7 36 .. 670 700 .. 662 705 .. 0.81 Alignments for each domain: == domain 1 score: -3.4 bits; conditional E-value: 0.68 CBM18.hmm 28 dYCgk 32 dYC++ 620805|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 54 DYCDN 58 67764 PP == domain 2 score: 22.9 bits; conditional E-value: 3.9e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + +Cp ++CCsk G CG+t +YCg+ Cqs 620805|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 354 CGR--NIGKCPYGQCCSKEGTCGNTLKYCGADCQS 386 786..4589*************************9 PP == domain 3 score: 38.5 bits; conditional E-value: 5.3e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++ +g+ Cp+++CCsk+GyCGt++ YCg+ Cq 620805|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 617 KCGPKVNGTICPNGKCCSKYGYCGTSDSYCGSTCQD 652 6*********************************95 PP == domain 4 score: -1.4 bits; conditional E-value: 0.16 CBM18.hmm 17 CskwGyCGt 25 Cs G CG 620805|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 657 CSYGGRCGV 665 9999***95 PP == domain 5 score: 28.8 bits; conditional E-value: 5.8e-11 CBM18.hmm 7 ggntC.plnaCCskwGyCGttsdYCgkgCqs 36 + +C ++++CCs++GyCG+++dYCg+gCq+ 620805|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18 670 NFGKClNPKECCSQYGYCGSSEDYCGTGCQQ 700 5579966669********************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (707 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 32.91 // Query: 394026|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 [L=232] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-28 84.5 82.1 1.2e-14 40.6 23.9 3.9 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.6 23.9 1.2e-14 1.2e-14 1 37 [. 23 59 .. 23 63 .. 0.96 2 ? 1.7 0.1 0.017 0.017 18 25 .. 58 65 .. 58 68 .. 0.86 3 ! 24.5 22.4 1.3e-09 1.3e-09 1 37 [. 134 170 .. 134 174 .. 0.96 4 ! 31.5 18.7 8.4e-12 8.4e-12 2 36 .. 195 229 .. 194 231 .. 0.96 Alignments for each domain: == domain 1 score: 40.6 bits; conditional E-value: 1.2e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 +cg++ g+++C +n+CCskwGyCGt++++C++gCqs+ 394026|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 23 RCGPDYGNKKCTNNECCSKWGYCGTSEKHCSSGCQSK 59 6**********************************95 PP == domain 2 score: 1.7 bits; conditional E-value: 0.017 CBM18.hmm 18 skwGyCGt 25 sk+G CG+ 394026|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 58 SKYGRCGS 65 89*****8 PP == domain 3 score: 24.5 bits; conditional E-value: 1.3e-09 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 +cg+++g +C + CCsk G CG + +YC +gCqsn 394026|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 134 NCGPNNGYVKCSFGDCCSKEGKCGFGYEYCYEGCQSN 170 5***********************************8 PP == domain 4 score: 31.5 bits; conditional E-value: 8.4e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg++ g ++C ++CCsk G CG + +YCg+gCqs 394026|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 195 CGPKYGFKKCSFGNCCSKDGRCGFGHEYCGEGCQS 229 **********************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (232 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 12.37 // Query: 15745|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 [L=195] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-30 91.8 74.0 2.1e-16 46.2 17.5 3.4 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.2 17.5 2.1e-16 2.1e-16 1 36 [. 22 57 .. 22 59 .. 0.97 2 ! 30.5 20.9 1.7e-11 1.7e-11 2 36 .. 94 128 .. 89 133 .. 0.96 3 ! 27.3 19.5 1.7e-10 1.7e-10 2 35 .. 154 187 .. 153 190 .. 0.96 Alignments for each domain: == domain 1 score: 46.2 bits; conditional E-value: 2.1e-16 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++ ++++C +n+CCskwGyCGt++d+C++gCqs 15745|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 22 RCGSEFSNKKCLNNECCSKWGYCGTSKDHCKAGCQS 57 6**********************************9 PP == domain 2 score: 30.5 bits; conditional E-value: 1.7e-11 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg++ ++++C + CCsk G CG + +YCg+gCqs 15745|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 94 CGPKYNNKKCSFGDCCSKDGKCGFGHEYCGDGCQS 128 9*********************************9 PP == domain 3 score: 27.3 bits; conditional E-value: 1.7e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg++ g ++C + CCsk G CG + +YCg+gCq 15745|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18|CBM18 154 CGPKYGYKKCSFGDCCSKDGECGFGHKYCGNGCQ 187 *********************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (195 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 30.45 // Query: 48067|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18 [L=139] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-24 72.5 54.0 5.6e-15 41.6 20.1 3.4 4 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 41.6 20.1 5.6e-15 5.6e-15 2 35 .. 26 58 .. 25 61 .. 0.92 2 ? 0.1 0.0 0.054 0.054 20 27 .. 61 68 .. 59 69 .. 0.79 3 ? -0.6 0.1 0.087 0.087 18 25 .. 83 90 .. 83 92 .. 0.81 4 ! 38.4 21.8 5.8e-14 5.8e-14 2 36 .. 88 120 .. 87 125 .. 0.88 Alignments for each domain: == domain 1 score: 41.6 bits; conditional E-value: 5.6e-15 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ +g +C++n+CCsk+GyCGtt++YCg+gCq 48067|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18 26 CGS-ENGVHCKNNECCSKYGYCGTTDEYCGQGCQ 58 995.6799*************************9 PP == domain 2 score: 0.1 bits; conditional E-value: 0.054 CBM18.hmm 20 wGyCGtts 27 +G+C++++ 48067|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18 61 FGHCNSSP 68 899*9876 PP == domain 3 score: -0.6 bits; conditional E-value: 0.087 CBM18.hmm 18 skwGyCGt 25 s++G CG 48067|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18 83 SSSGRCGV 90 78899996 PP == domain 4 score: 38.4 bits; conditional E-value: 5.8e-14 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + C++n+CCsk+GyCGtt++YCg+gCqs 48067|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18 88 CG--VEYGICKNNKCCSKYGYCGTTDAYCGTGCQS 120 66..36689*************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (139 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 4.99 // Query: 823304|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18 [L=288] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-11 29.7 16.8 1.2e-10 27.7 16.8 2.1 1 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.7 16.8 1.2e-10 1.2e-10 2 36 .. 194 226 .. 193 228 .. 0.91 Alignments for each domain: == domain 1 score: 27.7 bits; conditional E-value: 1.2e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg+ + +Cp ++CCsk G CG+t +YCg+ Cqs 823304|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18 194 CGR--NIGKCPYGQCCSKEGTCGNTLKYCGADCQS 226 886..4589*************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (288 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 44.78 // Query: 560929|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 [L=541] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-71 222.3 213.2 4.7e-16 45.1 21.1 8.8 8 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.5 21.7 6.8e-11 6.8e-11 1 36 [. 23 57 .. 23 62 .. 0.93 2 ! 26.4 16.3 3.1e-10 3.1e-10 2 34 .. 87 119 .. 86 130 .. 0.87 3 ! 38.1 20.3 7e-14 7e-14 1 36 [. 163 198 .. 163 204 .. 0.96 4 ! 39.0 20.7 3.6e-14 3.6e-14 1 36 [. 220 255 .. 220 260 .. 0.96 5 ! 39.8 21.3 2.1e-14 2.1e-14 1 36 [. 277 312 .. 277 317 .. 0.96 6 ! 45.1 21.1 4.7e-16 4.7e-16 1 36 [. 334 369 .. 334 374 .. 0.96 7 ! 23.6 20.6 2.4e-09 2.4e-09 2 37 .. 441 476 .. 440 480 .. 0.96 8 ! 26.0 15.2 4.4e-10 4.4e-10 2 36 .. 498 532 .. 497 536 .. 0.97 Alignments for each domain: == domain 1 score: 28.5 bits; conditional E-value: 6.8e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 qcgk ++ Cp+++CCs+ GyCG + +YCg gCq 560929|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 23 QCGK-ENNVSCPSGYCCSQEGYCGKSIEYCGVGCQT 57 7996.779***************************6 PP == domain 2 score: 26.4 bits; conditional E-value: 3.1e-10 CBM18.hmm 2 cgkqagg.ntCplnaCCskwGyCGttsdYCgkgC 34 cg+q ++ Cp+n+CCs +G+CG++ YCg+ C 560929|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 87 CGQQGNKiVVCPGNECCSIYGWCGSSRPYCGD-C 119 9988877689*********************5.4 PP == domain 3 score: 38.1 bits; conditional E-value: 7e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++++++ Cp+n+CCs GyCGt+++YCg+gCqs 560929|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 163 KCGPNNNDTVCPDNKCCSRKGYCGTSDAYCGTGCQS 198 6**********************************9 PP == domain 4 score: 39.0 bits; conditional E-value: 3.6e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++++++ Cp+n+CCs GyCGt+++YCg+gCqs 560929|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 220 KCGPNNNNTVCPDNKCCSRKGYCGTSDAYCGTGCQS 255 6**********************************9 PP == domain 5 score: 39.8 bits; conditional E-value: 2.1e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++++++ Cp+n+CCsk GyCGt+++YCg+gCqs 560929|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 277 KCGPNNNNTVCPDNKCCSKKGYCGTSDAYCGTGCQS 312 6**********************************9 PP == domain 6 score: 45.1 bits; conditional E-value: 4.7e-16 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++++++ Cp+n+CCsk+GyCGtts+YCg+gCqs 560929|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 334 KCGPDNNNTVCPDNKCCSKYGYCGTTSAYCGTGCQS 369 6**********************************9 PP == domain 7 score: 23.6 bits; conditional E-value: 2.4e-09 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 cg++ g+ +C ++CCs+ G CG + d+C +gCq+n 560929|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 441 CGPKYGNRKCGFGECCSQDGRCGFGFDFCFEGCQKN 476 **********************************87 PP == domain 8 score: 26.0 bits; conditional E-value: 4.4e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg++ g+ +C ++CCsk G CG + d+C +gCq 560929|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 498 CGPKYGNRKCSFGNCCSKDGRCGFGFDFCFDGCQR 532 9********************************95 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (541 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 48.09 // Query: 1753560|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18 [L=120] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-18 53.2 49.1 2.7e-12 33.0 18.7 2.3 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.1 22.4 4e-10 4e-10 1 37 [. 17 53 .. 17 57 .. 0.96 2 ! 33.0 18.7 2.7e-12 2.7e-12 2 36 .. 78 112 .. 77 114 .. 0.96 Alignments for each domain: == domain 1 score: 26.1 bits; conditional E-value: 4e-10 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqsn 37 +cg+++g +C + CCsk G CG + +YC +gCqsn 1753560|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18 17 NCGPNNGYVKCSFGDCCSKEGKCGFGYEYCYEGCQSN 53 5***********************************8 PP == domain 2 score: 33.0 bits; conditional E-value: 2.7e-12 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg++ g ++C ++CCsk G CG + +YCg+gCqs 1753560|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18|CBM18 78 CGPKYGFKKCSFGNCCSKDGRCGFGHEYCGEGCQS 112 **********************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (120 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 19.86 // Query: 790769|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM13|CBM13|CBM18|CBM18|CBM18 [L=803] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-24 71.3 83.2 2e-14 39.9 18.7 4.5 5 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.6 0.1 0.77 0.77 28 32 .. 54 58 .. 53 62 .. 0.63 2 ! 20.1 20.4 3e-08 3e-08 2 36 .. 455 487 .. 454 492 .. 0.90 3 ! 39.9 18.7 2e-14 2e-14 1 36 [. 713 748 .. 713 750 .. 0.96 4 ? -1.5 0.3 0.17 0.17 17 25 .. 753 761 .. 752 764 .. 0.88 5 ! 28.9 20.9 5.5e-11 5.5e-11 7 36 .. 766 796 .. 758 801 .. 0.81 Alignments for each domain: == domain 1 score: -3.6 bits; conditional E-value: 0.77 CBM18.hmm 28 dYCgk 32 dYC++ 790769|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM13|CBM13|CBM18|CBM18|CBM18 54 DYCDN 58 67764 PP == domain 2 score: 20.1 bits; conditional E-value: 3e-08 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + +Cp ++CCs+ G CG+t +YCg Cqs 790769|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM13|CBM13|CBM18|CBM18|CBM18 455 CGK--NIGKCPYGQCCSNEGTCGNTIKYCGIDCQS 487 887..5589*************************9 PP == domain 3 score: 39.9 bits; conditional E-value: 2e-14 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 +cg++a+g+ Cp+++CCsk+GyCGt+++YCg+ Cq 790769|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM13|CBM13|CBM18|CBM18|CBM18 713 KCGPKANGTICPNGKCCSKYGYCGTSDAYCGSTCQD 748 6*********************************95 PP == domain 4 score: -1.5 bits; conditional E-value: 0.17 CBM18.hmm 17 CskwGyCGt 25 Cs G CG 790769|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM13|CBM13|CBM18|CBM18|CBM18 753 CSYGGRCGV 761 9999***96 PP == domain 5 score: 28.9 bits; conditional E-value: 5.5e-11 CBM18.hmm 7 ggntC.plnaCCskwGyCGttsdYCgkgCqs 36 + +C ++++CCs++GyCG+++dYCg+gCq+ 790769|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM13|CBM13|CBM18|CBM18|CBM18 766 NFGKClNPKECCSQYGYCGSSEDYCGTGCQQ 796 5579966669********************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (803 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 37.95 // Query: 1019140|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18 [L=616] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-08 20.5 20.4 2.2e-08 20.5 20.4 2.3 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.1 0.51 0.51 28 32 .. 16 20 .. 15 25 .. 0.64 2 ! 20.5 20.4 2.2e-08 2.2e-08 2 36 .. 413 445 .. 412 450 .. 0.90 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.51 CBM18.hmm 28 dYCgk 32 dYC++ 1019140|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18 16 DYCDN 20 67764 PP == domain 2 score: 20.5 bits; conditional E-value: 2.2e-08 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cgk + +Cp ++CCs+ G CG+t +YCg Cqs 1019140|Neolan1_GeneCatalog_proteins_20200610.aa.fasta|CBM18 413 CGK--NIGKCPYGQCCSNEGTCGNTIKYCGIDCQS 445 887..5589*************************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (616 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 75.84 // Query: 871158|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 [L=470] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-59 182.7 220.6 2.6e-14 39.5 19.6 11.1 10 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.5 19.6 2.6e-14 2.6e-14 2 35 .. 26 58 .. 25 60 .. 0.92 2 ! 36.6 21.1 2e-13 2e-13 2 36 .. 74 106 .. 69 113 .. 0.89 3 ! 35.0 22.2 6.5e-13 6.5e-13 2 36 .. 147 179 .. 144 184 .. 0.88 4 ! 35.0 22.2 6.5e-13 6.5e-13 2 36 .. 208 240 .. 205 245 .. 0.88 5 ? -2.5 0.2 0.34 0.34 18 25 .. 264 271 .. 264 273 .. 0.81 6 ! 3.8 2.0 0.0037 0.0037 14 26 .. 297 309 .. 293 310 .. 0.74 7 ! 27.0 23.9 2e-10 2e-10 2 35 .. 299 330 .. 298 332 .. 0.89 8 ? -1.2 6.3 0.14 0.14 20 35 .. 333 347 .. 331 359 .. 0.87 9 ! 29.2 25.2 4.2e-11 4.2e-11 7 36 .. 368 397 .. 353 399 .. 0.86 10 ! 25.3 20.0 7.1e-10 7.1e-10 7 35 .. 419 447 .. 402 449 .. 0.89 Alignments for each domain: == domain 1 score: 39.5 bits; conditional E-value: 2.6e-14 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ +g +C++n+CCsk+GyCGtt++YCg+gCq 871158|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 26 CGS-ENGVHCKNNECCSKYGYCGTTDEYCGQGCQ 58 895.6799*************************9 PP == domain 2 score: 36.6 bits; conditional E-value: 2e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + C++n+CCsk+GyCGtt++YCg+gCqs 871158|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 74 CG--VEYGICKNNKCCSKYGYCGTTDAYCGTGCQS 106 66..36689*************************9 PP == domain 3 score: 35.0 bits; conditional E-value: 6.5e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + C +n+CCsk+GyCGtt++YCg+gCqs 871158|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 147 CG--VEYGICTNNKCCSKYGYCGTTDEYCGDGCQS 179 55..36678*************************9 PP == domain 4 score: 35.0 bits; conditional E-value: 6.5e-13 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCqs 36 cg + C +n+CCsk+GyCGtt++YCg+gCqs 871158|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 208 CG--VEYGICTNNKCCSKYGYCGTTDEYCGDGCQS 240 55..36678*************************9 PP == domain 5 score: -2.5 bits; conditional E-value: 0.34 CBM18.hmm 18 skwGyCGt 25 s++G CG 871158|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 264 SSSGKCGV 271 78899996 PP == domain 6 score: 3.8 bits; conditional E-value: 0.0037 CBM18.hmm 14 naCCskwGyCGtt 26 ++C s++G+C+ + 871158|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 297 GRCGSSYGFCNFG 309 6788888888765 PP == domain 7 score: 27.0 bits; conditional E-value: 2e-10 CBM18.hmm 2 cgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 cg+ + C+ ++CCsk+GyCGtt++YCg+gCq 871158|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 299 CGS--SYGFCNFGECCSKYGYCGTTEEYCGNGCQ 330 774..5578************************9 PP == domain 8 score: -1.2 bits; conditional E-value: 0.14 CBM18.hmm 20 wGyCGttsdYCgkgCq 35 +G C+ ++YC+ +Cq 871158|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 333 FGDCNQFNQYCD-SCQ 347 899********9.677 PP == domain 9 score: 29.2 bits; conditional E-value: 4.2e-11 CBM18.hmm 7 ggntCplnaCCskwGyCGttsdYCgkgCqs 36 g C +n+CCsk+GyCGtt++YCg gCq+ 871158|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 368 GYGFCGNNECCSKYGYCGTTEEYCGYGCQQ 397 55679999*********************6 PP == domain 10 score: 25.3 bits; conditional E-value: 7.1e-10 CBM18.hmm 7 ggntCplnaCCskwGyCGttsdYCgkgCq 35 + C +++CCsk GyCG t+++CgkgCq 871158|Neocon1_GeneCatalog_proteins_20220615.aa.fasta|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18|CBM18 419 KYGYCSDDECCSKKGYCGKTEEHCGKGCQ 447 55679***********************9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (470 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 6.20 // Query: 3136|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 [L=928] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-14 37.9 28.7 8.1e-09 21.9 8.7 2.4 2 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.9 8.7 8.1e-09 8.1e-09 1 25 [. 22 46 .. 22 48 .. 0.95 2 ! 21.6 12.1 1e-08 1e-08 1 34 [. 55 87 .. 55 97 .. 0.88 Alignments for each domain: == domain 1 score: 21.9 bits; conditional E-value: 8.1e-09 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGt 25 +cg++ +g+ Cp+++CCs+ GyCG+ 3136|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 22 RCGPNYNGAVCPEGECCSEEGYCGS 46 6***********************7 PP == domain 2 score: 21.6 bits; conditional E-value: 1e-08 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgC 34 +cgk+ + +Cp+++ Cs G+CGt+++YCg C 3136|PirE2_1_GeneCatalog_proteins_20110421.aa.fasta|CBM18|CBM18 55 RCGKNYYNRRCPDDEYCSVDGFCGTGPAYCGR-C 87 6*****************************95.4 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (928 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.26 // Query: 669747|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 [L=1639] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-28 84.8 70.8 1.8e-12 33.6 15.6 3.5 3 CBM18.hmm Domain annotation for each model (and alignments): >> CBM18.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 31.1 22.1 1.1e-11 1.1e-11 1 35 [. 23 56 .. 23 62 .. 0.93 2 ! 32.2 17.0 4.8e-12 4.8e-12 1 36 [. 126 163 .. 126 168 .. 0.92 3 ! 33.6 15.6 1.8e-12 1.8e-12 1 36 [. 180 217 .. 180 222 .. 0.92 Alignments for each domain: == domain 1 score: 31.1 bits; conditional E-value: 1.1e-11 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCgkgCq 35 +cgk + Cp+++CCsk+GyCG +sdYC++gCq 669747|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 23 RCGK-DYNRSCPSGYCCSKYGYCGKSSDYCDAGCQ 56 6997.6799*************************9 PP == domain 2 score: 32.2 bits; conditional E-value: 4.8e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cg++++++ Cp+++CCsk+GyCG ++++C+ +gCqs 669747|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 126 KCGPKNNNTVCPDDECCSKYGYCGHSDAHCDvdAGCQS 163 6*****************************84469**9 PP == domain 3 score: 33.6 bits; conditional E-value: 1.8e-12 CBM18.hmm 1 qcgkqaggntCplnaCCskwGyCGttsdYCg..kgCqs 36 +cg+++ ++ Cp+++CCsk+GyCG ++++C+ +gCqs 669747|Neosp1_GeneCatalog_proteins_20170918.aa.fasta|CBM18|CBM18|CBM18 180 KCGPKNHNTVCPDDECCSKYGYCGLSDAHCDvdAGCQS 217 6*****************************84469**9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1639 residues searched) Target model(s): 1 (38 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 112.84 // [ok]