# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM13/fasta_for_each_cluster/cluster_43.txt # target HMM database: merged_hmms/CBM13.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM13/CBM13_cluster_43.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: AZM51968.1|CBM13 [L=440] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-41 127.3 12.9 2.6e-27 82.5 3.4 2.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 58.2 2.1 7.1e-20 7.1e-20 23 134 .. 288 396 .. 256 398 .. 0.69 2 ! 82.5 3.4 2.6e-27 2.6e-27 14 132 .. 322 437 .. 317 440 .] 0.87 Alignments for each domain: == domain 1 score: 58.2 bits; conditional E-value: 7.1e-20 CBM13.hmm 23 aaganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLd 108 aga vq++d ++ + + g + +++ kcLdv ++++a+g+++q+y+cngg +Q W ++++ +++ ra gkcLd AZM51968.1|CBM13 288 RAGAYVQQYDVQG-----LRHLARGggaalppQGKITGIG-RKCLDVKGGKAANGTPIQLYACNGGVAQSWIVQKD----GTF--RALGKCLD 368 3344466666433.....1111111234222222333333.48*****66669*************99*****877....567..5589**** PP CBM13.hmm 109 vkgg..adgtpvqqwdcngganQqWsvl 134 + +dg+++ + dc gga+Q+Wsv+ AZM51968.1|CBM13 369 NYRNarTDGNRIGLRDCGGGASQRWSVS 396 **888999*****************986 PP == domain 2 score: 82.5 bits; conditional E-value: 2.6e-27 CBM13.hmm 14 sgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnras 103 kcl gg++a+g+++ql++c++g +Q W +++dgt+r gkcLd ++ ++g ++ + +c gga+Q+W ++ ++i+++as AZM51968.1|CBM13 322 GRKCLdvkGGKAANGTPIQLYACNGGVAQSWIVQKDGTFR--AL--GKCLDNYRNARTDGNRIGLRDCGGGASQRWSVSAG----GQIVHAAS 406 579**887667799999*****766667*********877..33..68***5566668**********999*******655....89****** PP CBM13.hmm 104 gkcLdvkgg..adgtpvqqwdcngganQqWs 132 gk+L+v gg a+gt+vq+++ ng+ Q W AZM51968.1|CBM13 407 GKVLEVRGGstANGTRVQLHAPNGNKRQVWV 437 *******999********************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (440 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 25.86 // Query: ARE76032.1|CBM13 [L=449] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-35 108.7 18.7 7.5e-21 61.4 7.0 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 61.4 7.0 7.5e-21 7.5e-21 37 134 .. 298 403 .. 261 405 .. 0.69 2 ! 61.2 3.9 8.8e-21 8.8e-21 57 133 .. 371 445 .. 367 449 .] 0.89 Alignments for each domain: == domain 1 score: 61.4 bits; conditional E-value: 7.5e-21 CBM13.hmm 37 an.QqWtlt.....sdg........tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLdvkgg..a 113 + Qq+ ++ + + r++ kcLdv ++++a+g+++q+ytcng+a+Q W l ++ +++ ra gkcLd + + + ARE76032.1|CBM13 298 TYvQQFDVQglrrlA-AgagatlspQGRVTGIG-AKCLDVKGGKAANGTQIQLYTCNGSAAQSWILGKD----GTF--RAFGKCLDNARNasT 382 444444444322221.02333222111333332.49*****66669********************777....567..669*******88899 PP CBM13.hmm 114 dgtpvqqwdcngganQqWsvl 134 +g+++ ++dcng+a Q+Wsv ARE76032.1|CBM13 383 NGNKISLHDCNGSAAQRWSVN 403 9*****************986 PP == domain 2 score: 61.2 bits; conditional E-value: 8.8e-21 CBM13.hmm 57 gkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsv 133 gkcLd a +++++g ++++ +cng+a+Q+W ++ ++i+++asgk+Ldv+gg a+gt vq+++ n++ Q W ARE76032.1|CBM13 371 GKCLDNARNASTNGNKISLHDCNGSAAQRWSVNAK----GQIVHVASGKVLDVTGGatANGTVVQLYAANTNKRQVWVT 445 79***7755558********************777....89*************999********************65 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (449 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 29.61 // Query: QES37737.1|CBM13 [L=424] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-42 129.7 21.2 1.7e-28 86.3 8.4 2.4 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.0 0.15 0.15 80 95 .. 165 180 .. 156 199 .. 0.67 2 ! 57.2 4.9 1.4e-19 1.4e-19 50 131 .. 301 377 .. 241 377 .. 0.69 3 ! 86.3 8.4 1.7e-28 1.7e-28 14 133 .. 306 422 .. 299 424 .] 0.86 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.15 CBM13.hmm 80 gganQqWrlesvgsgy 95 +g++Q W++ +gsg+ QES37737.1|CBM13 165 DGGSQGWKVVRDGSGS 180 4455666665555444 PP == domain 2 score: 57.2 bits; conditional E-value: 1.4e-19 CBM13.hmm 50 rlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqW 131 +++ kcLd+ ++++a+g+++q+ytcn+g+ Q W +++ ++i ra gkcLd + ++g+++ ++dcngga+Q+W QES37737.1|CBM13 301 KVTGIG-RKCLDAKGGKAANGTQIQIYTCNSGPGQSWIPQQD----GTI--RALGKCLDNYRNasTNGNKISLYDCNGGASQRW 377 222222.48***8866769******************99888....789..5589******887899***************** PP == domain 3 score: 86.3 bits; conditional E-value: 1.7e-28 CBM13.hmm 14 sgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnras 103 kcl gg++a+g+++q+++c++g +Q W ++dgtir gkcLd +++++g ++++y+cngga+Q+W+++ ++++++as QES37737.1|CBM13 306 GRKCLdakGGKAANGTQIQIYTCNSGPGQSWIPQQDGTIR--AL--GKCLDNYRNASTNGNKISLYDCNGGASQRWKVNAK----GQVVHVAS 390 579**87666669999******766899*********877..33..68***5556658********************777....89****** PP CBM13.hmm 104 gkcLdvkgg..adgtpvqqwdcngganQqWsv 133 gk+Ldvkgg a+ t+vq+++ n+ Q W + QES37737.1|CBM13 391 GKVLDVKGGstANSTKVQLYAANTYKRQIWVM 422 *******999999**********9888***75 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (424 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 28.59 // Query: QTT73230.1|CBM13 [L=433] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-32 99.1 4.6 5.4e-32 97.7 4.6 1.7 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 97.7 4.6 5.4e-32 5.4e-32 13 133 .. 314 431 .. 308 433 .] 0.87 Alignments for each domain: == domain 1 score: 97.7 bits; conditional E-value: 5.4e-32 CBM13.hmm 13 nsgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnra 102 gkcl gg+ ++g+++ql++c+++ +Q W l +dgt+r+ gkcLd a +++++g ++q+ +cngga+Q+W ++ ++i+++a QTT73230.1|CBM13 314 LGGKCLdvkGGKPDNGTQIQLYSCNGSVGQSWILAKDGTFRVM----GKCLDDARNASTDGNKIQLFDCNGGASQRWSVNAK----GQIVHVA 398 479***8866666**********766666*********99964....57***6655558********************777....89***** PP CBM13.hmm 103 sgkcLdvkgg..adgtpvqqwdcngganQqWsv 133 sgk+Ldv+gg a+gt+vq+++ n+g Q Wsv QTT73230.1|CBM13 399 SGKVLDVTGGstANGTKVQLYKANTGKRQLWSV 431 ********999********************86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (433 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.80 // Query: QLE75294.1|CBM13 [L=442] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-32 99.5 15.5 1.5e-27 83.2 8.6 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.6 0.6 8.7e-11 8.7e-11 52 91 .. 321 359 .. 260 364 .. 0.59 2 ! 83.2 8.6 1.5e-27 1.5e-27 14 132 .. 324 439 .. 319 442 .] 0.86 Alignments for each domain: == domain 1 score: 28.6 bits; conditional E-value: 8.7e-11 CBM13.hmm 52 enhqsgkcLdvaasstaagaevqqytcngganQqWrlesv 91 + +kcLdv ++++a+g++vq+ tcngg +Q W l ++ QLE75294.1|CBM13 321 TGIG-DKCLDVKGGTAANGTQVQLFTCNGGVAQSWILGKD 359 2222.48999887777899999999999998899988554 PP == domain 2 score: 83.2 bits; conditional E-value: 1.5e-27 CBM13.hmm 14 sgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnras 103 +kcl gg +a+g++vql +c++g +Q W l +d+t+r gkcLd a +++++g ++++ +cng+a+Q+W ++ ++i+++as QLE75294.1|CBM13 324 GDKCLdvkGGTAANGTQVQLFTCNGGVAQSWILGKDSTFR--AL--GKCLDNARNASTDGNRISLFDCNGQASQRWSVNAK----GQIVHVAS 408 689**98655559999******766667********9777..33..68***7755558********************777....89****** PP CBM13.hmm 104 gkcLdvkgg..adgtpvqqwdcngganQqWs 132 gk+Ldv+gg +gt++q+++ n++ Q W QLE75294.1|CBM13 409 GKVLDVTGGktVNGTKIQLYTANTNKRQLWV 439 *******999999*****************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (442 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 32.71 // Query: QEV50224.1|CBM13 [L=438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-43 133.9 22.7 3.8e-29 88.4 10.4 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.3 4.3 3.3e-20 3.3e-20 50 132 .. 315 392 .. 255 393 .. 0.71 2 ! 88.4 10.4 3.8e-29 3.8e-29 11 132 .. 317 435 .. 313 438 .] 0.87 Alignments for each domain: == domain 1 score: 59.3 bits; conditional E-value: 3.3e-20 CBM13.hmm 50 rlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWs 132 + ++ +gkcLdv ++++++g+++q+ytcng+ +Q W l ++ +++ ra gkcLd + + ++g+++ ++dcng+a Q+Ws QEV50224.1|CBM13 315 K-VSGLGGKCLDVKGGKADNGTQIQLYTCNGTVAQSWILGKD----GTF--RALGKCLDNSRNlsTNGNKIALYDCNGTAAQRWS 392 2.2333489****966668*************99*****777....567..5589******999999*****************7 PP == domain 2 score: 88.4 bits; conditional E-value: 3.8e-29 CBM13.hmm 11 nvnsgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirn 100 ++ gkcl gg++++g+++ql++c+++ +Q W l +dgt+r gkcLd + + +++g ++ +y+cng+a+Q+W ++ ++i++ QEV50224.1|CBM13 317 SGLGGKCLdvkGGKADNGTQIQLYTCNGTVAQSWILGKDGTFR--AL--GKCLDNSRNLSTNGNKIALYDCNGTAAQRWSVNAK----GQIVH 401 55689***887666699999*****766555*********877..33..68***6677778********************777....89*** PP CBM13.hmm 101 rasgkcLdvkgg..adgtpvqqwdcngganQqWs 132 asgk+Ldv+gg a+gt vq+++ n++ Q W QEV50224.1|CBM13 402 TASGKVLDVTGGatANGTAVQLYTANTNKRQVWV 435 **********999********************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (438 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 33.20 // Query: ATL26014.1|CBM13 [L=438] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-30 91.0 9.0 7.8e-30 90.7 7.9 1.7 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 90.7 7.9 7.8e-30 7.8e-30 14 132 .. 320 435 .. 311 438 .] 0.87 Alignments for each domain: == domain 1 score: 90.7 bits; conditional E-value: 7.8e-30 CBM13.hmm 14 sgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnras 103 kcl gg+ a+g+++ql++c++g +Q W l +dgt+r gkcLd ++ ++g ++++y+cngga+Q+W ++ ++i+++as ATL26014.1|CBM13 320 GAKCLdtkGGKPANGTQIQLYTCNGGPGQSWILGKDGTFR--AL--GKCLDNYRNAGTNGNKISLYDCNGGASQRWSVNAK----GQIVHAAS 404 579**8766666**********776888*********877..33..68***5566667********************777....89****** PP CBM13.hmm 104 gkcLdvkgg..adgtpvqqwdcngganQqWs 132 gk+Ldv+gg a+ t+vq+++ n++ Q W ATL26014.1|CBM13 405 GKVLDVTGGstANSTKVQLYTANTNKRQVWV 435 *******999999*****************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (438 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 35.25 // Query: QES31257.1|CBM13 [L=423] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-34 106.1 13.6 6e-29 87.8 7.2 2.6 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.0 0.15 0.15 80 95 .. 164 179 .. 155 196 .. 0.67 2 ! 30.1 0.4 2.9e-11 2.9e-11 50 108 .. 300 351 .. 239 351 .. 0.61 3 ! 87.8 7.2 6e-29 6e-29 14 132 .. 305 420 .. 298 423 .] 0.87 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.15 CBM13.hmm 80 gganQqWrlesvgsgy 95 +g++Q W++ +gsg+ QES31257.1|CBM13 164 DGGSQGWKVVRDGSGS 179 4455666665555444 PP == domain 2 score: 30.1 bits; conditional E-value: 2.9e-11 CBM13.hmm 50 rlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLd 108 +++ kcLdv ++++a+g+++q+ tcn+g+ Q W +++ +++ ra gkcLd QES31257.1|CBM13 300 KVTGIG-RKCLDVKGGKAANGTQIQIFTCNSGPGQSWIPQQD----GTV--RALGKCLD 351 322322.48****966669******************99766....456..45689998 PP == domain 3 score: 87.8 bits; conditional E-value: 6e-29 CBM13.hmm 14 sgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnras 103 kcl gg++a+g+++q+ +c++g +Q W ++dgt+r gkcLd +++++g ++++y+cngga+Q+W+++ ++i+++as QES31257.1|CBM13 305 GRKCLdvkGGKAANGTQIQIFTCNSGPGQSWIPQQDGTVR--AL--GKCLDNYRNASTNGNKISLYDCNGGASQRWKINAK----GQIVHVAS 389 579**88777779999******766899*********655..33..79***5556658********************777....89****** PP CBM13.hmm 104 gkcLdvkgg..adgtpvqqwdcngganQqWs 132 gk+Ldvkgg adgt+vq+++ n+ Q W QES31257.1|CBM13 390 GKVLDVKGGstADGTKVQLHAANTYKRQIWV 420 *******999************99888***5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (423 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 27.30 // Query: QSY49353.1|CBM13 [L=350] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-37 114.1 12.7 6.2e-31 94.3 6.7 2.5 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.0 0.12 0.12 78 94 .. 88 104 .. 74 130 .. 0.67 2 ! 31.1 0.3 1.5e-11 1.5e-11 51 95 .. 228 269 .. 167 273 .. 0.60 3 ! 94.3 6.7 6.2e-31 6.2e-31 14 132 .. 232 347 .. 227 350 .] 0.87 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.12 CBM13.hmm 78 cngganQqWrlesvgsg 94 +g++n W++ +gsg QSY49353.1|CBM13 88 ADGSNNKGWKVVRDGSG 104 34556666666444333 PP == domain 2 score: 31.1 bits; conditional E-value: 1.5e-11 CBM13.hmm 51 lenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgy 95 ++ +kcLdv ++++a+g+++q+ytc+gg +Q W l ++ g+ QSY49353.1|CBM13 228 VTGIG-DKCLDVKGGTAANGTQIQLYTCDGGVAQSWILGKD--GT 269 22222.48999998888999999999999998899999544..55 PP == domain 3 score: 94.3 bits; conditional E-value: 6.2e-31 CBM13.hmm 14 sgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnras 103 +kcl gg +a+g+++ql++c++g +Q W l +dgt+r gkcLd a +++a+g ++++y+cng+++Q+W +++ ++i+++as QSY49353.1|CBM13 232 GDKCLdvkGGTAANGTQIQLYTCDGGVAQSWILGKDGTFR--AL--GKCLDNARNASADGNRISLYDCNGQPSQRWSVNTK----GQIVHVAS 316 689**98655559999******877677*********877..33..68***7766669********************766....89****** PP CBM13.hmm 104 gkcLdvkgg..adgtpvqqwdcngganQqWs 132 gk+Ldv+gg a+gt++q+++ n++ Q W QSY49353.1|CBM13 317 GKVLDVTGGrtANGTKIQLYTPNTNKRQLWV 347 *******999********************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (350 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 22.47 // Query: QES40276.1|CBM13 [L=424] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-36 113.1 15.0 7.8e-30 90.7 7.3 2.7 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.6 0.0 0.078 0.078 80 95 .. 165 180 .. 155 198 .. 0.67 2 ! 35.1 0.9 8.9e-13 8.9e-13 47 108 .. 292 352 .. 241 353 .. 0.65 3 ! 90.7 7.3 7.8e-30 7.8e-30 14 133 .. 306 422 .. 299 424 .] 0.87 Alignments for each domain: == domain 1 score: -0.6 bits; conditional E-value: 0.078 CBM13.hmm 80 gganQqWrlesvgsgy 95 +g++Q W++ +gsg+ QES40276.1|CBM13 165 DGGSQDWKVVRDGSGS 180 4455666665555444 PP == domain 2 score: 35.1 bits; conditional E-value: 8.9e-13 CBM13.hmm 47 g......tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLd 108 g + +++ kcLdv ++++a+g+++q+ytcn+g+ Q W +++ ++i ra gkcLd QES40276.1|CBM13 292 GgavpppQGKVTGLG-RKCLDVKGGKAANGTQIQLYTCNSGPGQSWIPQQD----GTI--RALGKCLD 352 144443333443443.48*****66669******************99888....789..5589***9 PP == domain 3 score: 90.7 bits; conditional E-value: 7.8e-30 CBM13.hmm 14 sgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdva.asstaagaevqqytcngganQqWrlesvgsgyykirnra 102 kcl gg++a+g+++ql++c++g +Q W ++dgtir gkcLd ++s ++g ++++y+cngga+Q+W+++ ++i+++a QES40276.1|CBM13 306 GRKCLdvkGGKAANGTQIQLYTCNSGPGQSWIPQQDGTIR--AL--GKCLDNYrNPS-TNGNKISLYDCNGGAAQRWKVNAK----GQIVHVA 389 679**88777779999******766899*********877..33..68***665776.89*******************777....89***** PP CBM13.hmm 103 sgkcLdvkgg..adgtpvqqwdcngganQqWsv 133 sgk+Ldvkgg a+gt+vq+++ n+ Q W + QES40276.1|CBM13 390 SGKVLDVKGGstANGTKVQLSAANTYKRQIWVM 422 ********999************99888***75 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (424 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 29.07 // Query: QES52069.1|CBM13 [L=372] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-38 116.7 15.8 8e-31 93.9 9.3 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.6 0.4 1.3e-12 1.3e-12 54 95 .. 253 291 .. 184 295 .. 0.59 2 ! 93.9 9.3 8e-31 8e-31 13 132 .. 253 369 .. 249 372 .] 0.87 Alignments for each domain: == domain 1 score: 34.6 bits; conditional E-value: 1.3e-12 CBM13.hmm 54 hqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgy 95 +gkcLdv ++++a+g+++q+ytcng+a+Q W l ++ g+ QES52069.1|CBM13 253 L-GGKCLDVKGGKAANGTQIQLYTCNGSAAQSWILGKD--GT 291 2.379999996666899999999999999999999544..54 PP == domain 2 score: 93.9 bits; conditional E-value: 8e-31 CBM13.hmm 13 nsgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnra 102 gkcl gg++a+g+++ql++c+++a+Q W l +dgt+r gkcLd a +++++g ++++y+cng+a+Q+W ++ ++i+++a QES52069.1|CBM13 253 LGGKCLdvkGGKAANGTQIQLYTCNGSAAQSWILGKDGTFR----AFGKCLDNARNASTNGNRISLYDCNGSAAQRWSVNAK----GQIVHMA 337 589***98777779999******776677*********887....3379***7755558********************777....89***** PP CBM13.hmm 103 sgkcLdvkgg..adgtpvqqwdcngganQqWs 132 sgk+Ldv gg a+gt vq+++ ng+ Q W QES52069.1|CBM13 338 SGKVLDVVGGstANGTVVQLYTANGNKRQVWV 369 ********999********************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (372 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 26.37 // Query: QKV94498.1|CBM13 [L=423] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-43 133.4 21.2 1e-27 83.8 8.1 2.5 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.5 5.2 1.7e-21 1.7e-21 11 132 .. 242 377 .. 233 378 .. 0.70 2 ! 83.8 8.1 1e-27 1e-27 14 132 .. 305 420 .. 301 423 .] 0.88 Alignments for each domain: == domain 1 score: 63.5 bits; conditional E-value: 1.7e-21 CBM13.hmm 11 nvnsgkclggstaaga.....nvqlwdccn.gan.QqWtlt.....sdg....tirlenhq.s..gkcLdvaasstaagaevqqytcngganQ 84 +++ g c++gs++ + + ++ ++ g+ Qq+ ++ + + t+ + + + gkcLdv ++++a+g+++q+y+c+gg +Q QKV94498.1|CBM13 242 SATRGDCVKGSDSGEKpvmctPADAYPDKRaGTYvQQFDVQglrhlA-KgagaTLSPQGKVtGlgGKCLDVKGGKAANGTQIQLYHCTGGVAQ 333 55577777444422222344235666644566777888888444441.0355633333333223389*****66669*************99* PP CBM13.hmm 85 qWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWs 132 W le + +++ ra gkcLd +g+ ++g+++q++dc+g+a+Q+Ws QKV94498.1|CBM13 334 SWLLERD----GTF--RALGKCLDNAGNaaTNGNKIQLSDCTGKASQKWS 377 ****887....567..5589******999888*****************7 PP == domain 2 score: 83.8 bits; conditional E-value: 1e-27 CBM13.hmm 14 sgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnras 103 gkcl gg++a+g+++ql++c++g +Q W l++dgt+r gkcLd a++++++g ++q+ +c+g+a+Q+W ++ ++i++ as QKV94498.1|CBM13 305 GGKCLdvkGGKAANGTQIQLYHCTGGVAQSWLLERDGTFR--AL--GKCLDNAGNAATNGNKIQLSDCTGKASQKWSVNAK----GQIVHIAS 389 79***98777779999******877677*********877..33..68***7777778********************777....89****** PP CBM13.hmm 104 gkcLdvkgg..adgtpvqqwdcngganQqWs 132 gk+Ldv+gg ad t+vq+++ n+ Q W QKV94498.1|CBM13 390 GKVLDVTGGstADSTKVQLHSANSYKRQVWV 420 *******999999*********99888***5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (423 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 27.18 // Query: QNE30148.1|CBM13 [L=418] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-30 93.1 11.2 2.3e-21 63.1 5.1 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.3 0.3 1.5e-12 1.5e-12 39 96 .. 286 336 .. 235 341 .. 0.64 2 ! 63.1 5.1 2.3e-21 2.3e-21 56 132 .. 341 415 .. 333 418 .] 0.88 Alignments for each domain: == domain 1 score: 34.3 bits; conditional E-value: 1.5e-12 CBM13.hmm 39 QqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyy 96 tl+++g r ++ ++kcLdv ++++a+g+++q+ytcng+a+Q W l ++ + QNE30148.1|CBM13 286 AGATLSPQG--R-VSGIGSKCLDVKGGKAANGTRIQLYTCNGSAAQSWILGKD----G 336 333334444..3.3333469***9966669******************99665....3 PP == domain 2 score: 63.1 bits; conditional E-value: 2.3e-21 CBM13.hmm 56 sgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWs 132 gkcLd a +++++g ++++y+cng+a+Q+W ++ ++i+++asgk+Ld++gg a+gt vq+++ n++ Q W QNE30148.1|CBM13 341 LGKCLDNARNASTNGNRISLYDCNGSAAQRWSVNAK----GQIVHVASGKVLDATGGatANGTVVQLYTANTNKRQVWV 415 379***7755558********************777....89*************999********************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (418 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 28.54 // Query: AXE24934.1|CBM13 [L=454] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-32 98.5 5.5 6.1e-32 97.5 5.5 1.6 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 97.5 5.5 6.1e-32 6.1e-32 11 132 .. 333 451 .. 325 454 .] 0.87 Alignments for each domain: == domain 1 score: 97.5 bits; conditional E-value: 6.1e-32 CBM13.hmm 11 nvnsgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdva.asstaagaevqqytcngganQqWrlesvgsgyykir 99 ++ gkcl gg++a+g+++ql++c+++ +Q W l +dgt+r gkcLd a ++s a+g ++q+++cng+a+Q+W ++ ++i+ AXE24934.1|CBM13 333 SGIAGKCLdarGGKAANGTQIQLYTCNGSVAQSWILGKDGTFR--AL--GKCLDNArNGS-ANGNKIQLWDCNGSAAQRWSVNAK----GQIV 416 5568****88766669999******766555*********877..33..68***774555.9********************777....89** PP CBM13.hmm 100 nrasgkcLdvkgg..adgtpvqqwdcngganQqWs 132 ++asgk+Ldvkgg a+ t vq+++ n+g Q W+ AXE24934.1|CBM13 417 HVASGKVLDVKGGatANSTVVQLYTPNTGKGQLWK 451 ***********999999*****************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (454 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 96.53 // Query: QEU95933.1|CBM13 [L=424] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-35 109.4 14.1 5.1e-30 91.3 8.2 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.5 0.3 4.5e-11 4.5e-11 23 95 .. 272 343 .. 240 345 .. 0.55 2 ! 91.3 8.2 5.1e-30 5.1e-30 14 132 .. 306 421 .. 300 424 .] 0.88 Alignments for each domain: == domain 1 score: 29.5 bits; conditional E-value: 4.5e-11 CBM13.hmm 23 aaganvqlwdccn....ganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgy 95 ag+ vq++d ++ +++ +l+++g +++ kcLd+ ++++a+g++vq+ytcn g+ Q W l ++ g+ QEU95933.1|CBM13 272 RAGTYVQQYDVQGlrhlARGGGAELSPQG--KVTGIG-AKCLDIKGGKAANGTQVQLYTCNKGPGQSWILGKD--GT 343 33334555554321111122333333433..222222.48***98666699*********9999999*99544..44 PP == domain 2 score: 91.3 bits; conditional E-value: 5.1e-30 CBM13.hmm 14 sgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnras 103 kcl gg++a+g++vql++c++g +Q W l +dgt+r gkcLd +++++g ++++y+cngga+Q+W +++ ++i+++as QEU95933.1|CBM13 306 GAKCLdikGGKAANGTQVQLYTCNKGPGQSWILGKDGTFR--AL--GKCLDNYRNAATNGNKISLYDCNGGASQRWSVNTK----GQIVHVAS 390 579**99777779*********765899*********877..33..68***5566667********************766....89****** PP CBM13.hmm 104 gkcLdvkgg..adgtpvqqwdcngganQqWs 132 gk+Ldv+gg a+ t+vq+++ n + Q W QEU95933.1|CBM13 391 GKVLDVAGGstANSTKVQLYTANANKRQVWV 421 *******999999**********9******5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (424 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 32.80 // Query: AQT72961.1|CBM13 [L=460] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-36 112.0 16.5 2.1e-29 89.3 10.6 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.3 0.3 1.5e-12 1.5e-12 24 95 .. 309 379 .. 282 383 .. 0.67 2 ! 89.3 10.6 2.1e-29 2.1e-29 15 132 .. 343 457 .. 342 460 .] 0.88 Alignments for each domain: == domain 1 score: 34.3 bits; conditional E-value: 1.5e-12 CBM13.hmm 24 aganvqlwdccn....ganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgy 95 ag+ vq++d ++ +a+ tl ++g +++ +kcLdv ++++a+g+++q+ytcng+a+Q W l ++ g+ AQT72961.1|CBM13 309 AGTYVQQYDVQGlrrlAAGAGATLPPQG--KVTGIG-SKCLDVKGGKAANGTQIQLYTCNGSAAQSWILGKD--GT 379 4555777775432222233444444444..333333.59***9966669**********99999***99544..55 PP == domain 2 score: 89.3 bits; conditional E-value: 2.1e-29 CBM13.hmm 15 gkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasg 104 +kcl gg++a+g+++ql++c+++a+Q W l +dgt+r gkcLd a +++++g ++++y+cng+a+Q+W ++ ++i+++asg AQT72961.1|CBM13 343 SKCLdvkGGKAANGTQIQLYTCNGSAAQSWILGKDGTFR----AFGKCLDNARNASTNGNKISLYDCNGSAAQRWSVNAK----GQIVHVASG 427 69**88777779999******776677*********887....3379***7755558********************777....89******* PP CBM13.hmm 105 kcLdvkgg..adgtpvqqwdcngganQqWs 132 k+Ldv+gg a+gt vq+++ n++ Q W+ AQT72961.1|CBM13 428 KVLDVTGGatANGTVVQLYTANTNKRQVWA 457 ******999********************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (460 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 32.31 // Query: QKM68476.1|CBM13 [L=170] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-26 80.2 0.0 2.1e-26 79.5 0.0 1.3 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.5 0.0 2.1e-26 2.1e-26 13 134 .. 43 166 .. 30 169 .. 0.82 Alignments for each domain: == domain 1 score: 79.5 bits; conditional E-value: 2.1e-26 CBM13.hmm 13 nsgkclggstaaganvqlwdccnganQqWtltsdg..tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnras 103 g+cl aa++ +++ dc+++a+Qq+++ s+g +++++ +++cLdv staa a+v+ y c g++nQ++r+ + g g y+i+ QKM68476.1|CBM13 43 FAGLCL-ELRAADKLLVQSDCTGAADQQFEFASVGggAYEIRELGTNQCLDVKEASTAADAPVIGYECGGQPNQRFRVVPGGEG-YVIET-FA 132 3899**.23344445999**877788********99********9779****95556***********777*******666555.68988.77 PP CBM13.hmm 104 gkcLdvkgg..adgtpvqqwdcng.ganQqWsvl 134 gkcLdvkgg a g+p++q +c+ + +Q ++++ QKM68476.1|CBM13 133 GKCLDVKGGseAAGAPIVQTECELaKESQTFTIE 166 9******999888*********998889988775 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (170 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 44.95 // Query: QDY78059.1|CBM13 [L=170] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-26 78.9 0.0 7e-26 77.8 0.0 1.5 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 77.8 0.0 7e-26 7e-26 13 133 .. 43 165 .. 31 169 .. 0.82 Alignments for each domain: == domain 1 score: 77.8 bits; conditional E-value: 7e-26 CBM13.hmm 13 nsgkclggstaaganvqlwdccnganQqWtltsdg..tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnras 103 g+cl aa++++++ dc+++a+Qq+++ s+g +++++ +++cLdv sta a+v+ y c g++nQ++r+ + g g y+i+ QDY78059.1|CBM13 43 FAGLCL-ELRAADKSLIQSDCTGAADQQFEFASVGggAYEIRELGTNRCLDVKEASTAVDAPVIGYECGGQPNQRFRVVPGGEG-YVIET-FA 132 389***.3446666799***878788********99********9779****95556***********777*******666555.68988.77 PP CBM13.hmm 104 gkcLdvkgg..adgtpvqqwdcng.ganQqWsv 133 gkcLdvkgg a g+p++q +c+ + +Q +++ QDY78059.1|CBM13 133 GKCLDVKGGseAAGAPIVQTECELaKESQVFAI 165 9******999888*********99777887765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (170 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 15.53 // Query: AZK95480.1|CBM13 [L=170] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-26 80.2 0.0 2.1e-26 79.5 0.0 1.3 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 79.5 0.0 2.1e-26 2.1e-26 13 134 .. 43 166 .. 30 169 .. 0.82 Alignments for each domain: == domain 1 score: 79.5 bits; conditional E-value: 2.1e-26 CBM13.hmm 13 nsgkclggstaaganvqlwdccnganQqWtltsdg..tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnras 103 g+cl aa++ +++ dc+++a+Qq+++ s+g +++++ +++cLdv staa a+v+ y c g++nQ++r+ + g g y+i+ AZK95480.1|CBM13 43 FAGLCL-ELRAADKLLVQSDCTGAADQQFEFASVGggAYEIRELGTNQCLDVKEASTAADAPVIGYECGGQPNQRFRVVPGGEG-YVIET-FA 132 3899**.23344445999**877788********99********9779****95556***********777*******666555.68988.77 PP CBM13.hmm 104 gkcLdvkgg..adgtpvqqwdcng.ganQqWsvl 134 gkcLdvkgg a g+p++q +c+ + +Q ++++ AZK95480.1|CBM13 133 GKCLDVKGGseAAGAPIVQTECELaKESQTFTIE 166 9******999888*********998889988775 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (170 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 64.39 // Query: UQX04458.1|CBM13 [L=446] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-45 141.0 26.0 9.4e-30 90.4 10.8 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 64.5 7.1 8.4e-22 8.4e-22 53 134 .. 325 402 .. 262 405 .. 0.72 2 ! 90.4 10.8 9.4e-30 9.4e-30 12 132 .. 326 443 .. 321 446 .] 0.87 Alignments for each domain: == domain 1 score: 64.5 bits; conditional E-value: 8.4e-22 CBM13.hmm 53 nhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvl 134 + +gkcLdv ++++a+g+++q+ytcng+ +Q W l ++ +++ ra gkcLd + + a+g+++ +wdcng+a Q+Wsv UQX04458.1|CBM13 325 SGPGGKCLDVKGGKAANGTQIQLYTCNGTVAQSWILGKD----GTL--RALGKCLDNSRNlaANGNKISLWDCNGSAAQRWSVN 402 23348******66669*************99*****777....679..5589******99*999*****************986 PP == domain 2 score: 90.4 bits; conditional E-value: 9.4e-30 CBM13.hmm 12 vnsgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnr 101 + gkcl gg++a+g+++ql++c+++ +Q W l +dgt+r gkcLd + + +a+g ++++++cng+a+Q+W ++ ++i++ UQX04458.1|CBM13 326 GPGGKCLdvkGGKAANGTQIQLYTCNGTVAQSWILGKDGTLR--AL--GKCLDNSRNLAANGNKISLWDCNGSAAQRWSVNAK----GQIVHT 410 5589***98777779999******766555*********655..44..68***6677879********************777....89**** PP CBM13.hmm 102 asgkcLdvkgg..adgtpvqqwdcngganQqWs 132 asgk+Ldvkgg a+gt vq+++ n++ Q W UQX04458.1|CBM13 411 ASGKVLDVKGGstANGTVVQLYTANTDKRQVWV 443 *********999**************999***5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (446 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 33.41 // Query: XKJ38267.1|CBM13 [L=450] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-41 128.6 22.8 1.8e-27 83.0 9.6 2.2 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 59.5 5.2 2.8e-20 2.8e-20 38 132 .. 302 404 .. 264 405 .. 0.71 2 ! 83.0 9.6 1.8e-27 1.8e-27 16 132 .. 334 447 .. 333 450 .] 0.88 Alignments for each domain: == domain 1 score: 59.5 bits; conditional E-value: 2.8e-20 CBM13.hmm 38 n.QqWtlt......sdg.......tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLdvkgg..ad 114 Qq+ ++ + g + r++ +kcLdv ++++a+g+++q+y+cng+a+Q W l ++ +++ ra gkcLd + + ++ XKJ38267.1|CBM13 302 YvQQFDVQglrrlaA-GagaalspQGRVTGIG-SKCLDVKGGKAANGTQIQLYACNGSAAQSWILGKD----GTF--RAFGKCLDDARNasTN 386 344554443333320.1334333323444444.59*****66669********************777....567..669*******777999 PP CBM13.hmm 115 gtpvqqwdcngganQqWs 132 g+++ ++dcng+a Q+Ws XKJ38267.1|CBM13 387 GNKISLHDCNGTAAQRWS 404 *****************7 PP == domain 2 score: 83.0 bits; conditional E-value: 1.8e-27 CBM13.hmm 16 kcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgk 105 kcl gg++a+g+++ql++c+++a+Q W l +dgt+r gkcLd a +++++g ++++ +cng+a+Q+W ++ ++i+++asgk XKJ38267.1|CBM13 334 KCLdvkGGKAANGTQIQLYACNGSAAQSWILGKDGTFR----AFGKCLDDARNASTNGNKISLHDCNGTAAQRWSVNAK----GQIVHVASGK 418 8**88777779999******776677*********887....3379***6655558********************777....89******** PP CBM13.hmm 106 cLdvkgg..adgtpvqqwdcngganQqWs 132 +Ld++gg a+gt vq+++ n++ Q W XKJ38267.1|CBM13 419 VLDATGGatANGTVVQLYTANTNKRQVWV 447 *****999********************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (450 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 29.82 // Query: UUY48321.1|CBM13 [L=444] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-38 117.5 16.9 2.9e-30 92.1 9.9 2.2 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.8 0.6 1.3e-13 1.3e-13 56 108 .. 326 372 .. 259 372 .. 0.70 2 ! 92.1 9.9 2.9e-30 2.9e-30 14 132 .. 326 441 .. 322 444 .] 0.88 Alignments for each domain: == domain 1 score: 37.8 bits; conditional E-value: 1.3e-13 CBM13.hmm 56 sgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLd 108 ++kcLdv ++++a+g+++q+ytcng+a+Q W l ++ +++ ra gkcLd UUY48321.1|CBM13 326 GSKCLDVKGGKAANGTQIQLYTCNGSAAQSWILGKD----GTF--RAFGKCLD 372 269*****66669********************777....567..6699**98 PP == domain 2 score: 92.1 bits; conditional E-value: 2.9e-30 CBM13.hmm 14 sgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnras 103 +kcl gg++a+g+++ql++c+++a+Q W l +dgt+r gkcLd a +++a+g ++++y+cng+a+Q+W ++ ++i+++as UUY48321.1|CBM13 326 GSKCLdvkGGKAANGTQIQLYTCNGSAAQSWILGKDGTFR----AFGKCLDNARNASANGNRISLYDCNGSAAQRWSVNAR----GQIVHVAS 410 689**88777779999******776677*********887....3379***7766669********************877....89****** PP CBM13.hmm 104 gkcLdvkgg..adgtpvqqwdcngganQqWs 132 gk+Ldv+gg a+gt vq+++ n++ Q W+ UUY48321.1|CBM13 411 GKVLDVTGGatANGTVVQLYTANTNKRQVWT 441 *******999********************6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (444 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 31.90 // Query: UBI40736.1|CBM13 [L=415] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-36 109.9 9.3 2.7e-29 88.9 5.7 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.4 0.1 2.5e-11 2.5e-11 47 95 .. 284 334 .. 232 338 .. 0.65 2 ! 88.9 5.7 2.7e-29 2.7e-29 13 133 .. 296 413 .. 290 415 .] 0.88 Alignments for each domain: == domain 1 score: 30.4 bits; conditional E-value: 2.5e-11 CBM13.hmm 47 g.....tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgy 95 g + r+ +kcLdv ++++a+g++vq+ tcngg +Q W ++++ g+ UBI40736.1|CBM13 284 GvalppQGRVAGLA-KKCLDVKGGKAANGTRVQLFTCNGGVAQSWIVQKD--GT 334 35444333433333.58***9966669**********99999***99655..55 PP == domain 2 score: 88.9 bits; conditional E-value: 2.7e-29 CBM13.hmm 13 nsgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnra 102 +kcl gg++a+g+ vql +c++g +Q W +++dgt+r gkcLd a+++ +g ++q+ +c+gg++Q+W+++ ++i+++a UBI40736.1|CBM13 296 LAKKCLdvkGGKAANGTRVQLFTCNGGVAQSWIVQKDGTFR--AL--GKCLDNAGNAKKNGNTIQLSDCTGGPAQKWKVDAK----GRIVHVA 380 4789**886666699999*****766667*********877..33..68***7777778********************777....89***** PP CBM13.hmm 103 sgkcLdvkgg..adgtpvqqwdcngganQqWsv 133 sgk+Ldv+gg a+gt +q+++ ng+ Q Wsv UBI40736.1|CBM13 381 SGKVLDVTGGrtANGTMIQLYSANGSKGQVWSV 413 ********999**************999***86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (415 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 28.63 // Query: UKW33317.1|CBM13 [L=415] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-36 109.9 9.3 2.7e-29 88.9 5.7 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.4 0.1 2.5e-11 2.5e-11 47 95 .. 284 334 .. 232 338 .. 0.65 2 ! 88.9 5.7 2.7e-29 2.7e-29 13 133 .. 296 413 .. 290 415 .] 0.88 Alignments for each domain: == domain 1 score: 30.4 bits; conditional E-value: 2.5e-11 CBM13.hmm 47 g.....tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgy 95 g + r+ +kcLdv ++++a+g++vq+ tcngg +Q W ++++ g+ UKW33317.1|CBM13 284 GvalppQGRVAGLA-KKCLDVKGGKAANGTRVQLFTCNGGVAQSWIVQKD--GT 334 35444333433333.58***9966669**********99999***99655..55 PP == domain 2 score: 88.9 bits; conditional E-value: 2.7e-29 CBM13.hmm 13 nsgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnra 102 +kcl gg++a+g+ vql +c++g +Q W +++dgt+r gkcLd a+++ +g ++q+ +c+gg++Q+W+++ ++i+++a UKW33317.1|CBM13 296 LAKKCLdvkGGKAANGTRVQLFTCNGGVAQSWIVQKDGTFR--AL--GKCLDNAGNAKKNGNTIQLSDCTGGPAQKWKVDAK----GRIVHVA 380 4789**886666699999*****766667*********877..33..68***7777778********************777....89***** PP CBM13.hmm 103 sgkcLdvkgg..adgtpvqqwdcngganQqWsv 133 sgk+Ldv+gg a+gt +q+++ ng+ Q Wsv UKW33317.1|CBM13 381 SGKVLDVTGGrtANGTMIQLYSANGSKGQVWSV 413 ********999**************999***86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (415 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 29.58 // Query: WKX71611.1|CBM13 [L=431] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-37 113.8 17.8 1.3e-30 93.3 10.2 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.2 0.8 3.4e-12 3.4e-12 54 94 .. 312 349 .. 248 353 .. 0.55 2 ! 93.3 10.2 1.3e-30 1.3e-30 13 132 .. 312 428 .. 307 431 .] 0.88 Alignments for each domain: == domain 1 score: 33.2 bits; conditional E-value: 3.4e-12 CBM13.hmm 54 hqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsg 94 +gkcLdv ++ a+g+++q+ytcng+a Q W l+++ g WKX71611.1|CBM13 312 L-GGKCLDVKGGQVANGTQIQLYTCNGSATQSWILSKD--G 349 2.257777774444677777777777777777777444..3 PP == domain 2 score: 93.3 bits; conditional E-value: 1.3e-30 CBM13.hmm 13 nsgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnra 102 gkcl gg+ a+g+++ql++c+++a Q W l++dgt+r gkcLd a +++++g ++++ +cngga+Q+W ++ ++i+++a WKX71611.1|CBM13 312 LGGKCLdvkGGQVANGTQIQLYTCNGSATQSWILSKDGTFR--AL--GKCLDNARNASTNGNKISLFDCNGGASQRWSVNAK----GQIVHVA 396 479***9977777**********776677*********877..33..68***7755558********************777....89***** PP CBM13.hmm 103 sgkcLdvkgg..adgtpvqqwdcngganQqWs 132 sgk+Ldv+gg a+gt++q+++ n++ Q W WKX71611.1|CBM13 397 SGKVLDVTGGstANGTKIQLYTANTNKRQVWV 428 ********999********************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (431 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 31.83 // Query: WKU46111.1|CBM13 [L=435] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-36 110.4 16.7 6.6e-29 87.7 7.4 1.8 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 36.2 1.8 4.1e-13 4.1e-13 53 115 .. 315 372 .. 265 373 .. 0.69 2 ! 87.7 7.4 6.6e-29 6.6e-29 13 132 .. 316 432 .. 306 435 .] 0.87 Alignments for each domain: == domain 1 score: 36.2 bits; conditional E-value: 4.1e-13 CBM13.hmm 53 nhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLdvkgg..adg 115 +gkcLdv ++++ +g+++q+ytcng+ +Q W l ++ +++ ra gkcLd + + +dg WKU46111.1|CBM13 315 GL-GGKCLDVKGGKAVNGTQIQLYTCNGSVAQSWILGND----GTF--RALGKCLDNARNasTDG 372 22.489****966657*************99*****766....567..5579****997655445 PP == domain 2 score: 87.7 bits; conditional E-value: 6.6e-29 CBM13.hmm 13 nsgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnra 102 gkcl gg++ +g+++ql++c+++ +Q W l +dgt+r gkcLd a +++++g ++ + +cngga+Q+W ++ ++i+++a WKU46111.1|CBM13 316 LGGKCLdvkGGKAVNGTQIQLYTCNGSVAQSWILGNDGTFR--AL--GKCLDNARNASTDGNKIELFDCNGGASQRWSVNAK----GQIVHVA 400 489***9877777**********766555*********877..33..68***7755558********************777....89***** PP CBM13.hmm 103 sgkcLdvkgg..adgtpvqqwdcngganQqWs 132 sgk+Ldv+gg a+gt+vq+++ n+ Q W+ WKU46111.1|CBM13 401 SGKVLDVTGGstANGTKVQLHAANTYKRQLWT 432 ********999************99888***6 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (435 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 33.75 // Query: WAL94136.1|CBM13 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-29 87.8 9.1 1.1e-28 87.0 7.2 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.12 0.12 80 95 .. 178 193 .. 169 212 .. 0.68 2 ! 87.0 7.2 1.1e-28 1.1e-28 14 132 .. 319 434 .. 312 437 .] 0.86 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.12 CBM13.hmm 80 gganQqWrlesvgsgy 95 +g++Q W++ +gsg+ WAL94136.1|CBM13 178 DGGSQGWKVVRDGSGS 193 4555666665555554 PP == domain 2 score: 87.0 bits; conditional E-value: 1.1e-28 CBM13.hmm 14 sgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnras 103 kcl gg++a+g+++q+++c++g +Q W l++d+tir gkcLd +++++g ++ + +c+gga+Q+W+++ ++i+++as WAL94136.1|CBM13 319 GRKCLdakGGKAANGTQIQIHTCNSGPGQSWILQKDSTIR--AL--GKCLDNYRNASTNGNKIALSDCHGGASQRWKVNAK----GQIVHVAS 403 679**87666669999******766899********9777..44..68***5556658********************777....89****** PP CBM13.hmm 104 gkcLdvkgg..adgtpvqqwdcngganQqWs 132 gk+Ldvkgg a+gt+vq+++ n+ Q W WAL94136.1|CBM13 404 GKVLDVKGGstANGTKVQLYAANTYKRQIWV 434 *******999*************9888***5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 33.22 // Query: XQC74204.1|CBM13 [L=460] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-45 139.8 19.2 4.8e-29 88.1 7.6 2.4 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.5 3.7 4e-22 4e-22 24 134 .. 309 416 .. 286 418 .. 0.74 2 ! 88.1 7.6 4.8e-29 4.8e-29 13 132 .. 341 457 .. 338 460 .] 0.88 Alignments for each domain: == domain 1 score: 65.5 bits; conditional E-value: 4e-22 CBM13.hmm 24 aganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLdv 109 ag+ vq++d ++ + g + r+ +gkcLdv ++++a+g+++q+ytcng+a+Q W l + +++ ra gkcLd XQC74204.1|CBM13 309 AGTYVQQYDVQG---LRVLAA--GagavlppQGRVGGL-GGKCLDVKGGKAANGTQIQLYTCNGSAAQSWILGVD----GTF--RAFGKCLDN 389 455566666422...222222..223444332233333.489*****66669********************655....456..679****** PP CBM13.hmm 110 kgg..adgtpvqqwdcngganQqWsvl 134 + + adg++++++dcng++ Q+Wsv XQC74204.1|CBM13 390 ARNatADGNRITLHDCNGTPAQRWSVN 416 *8789*******************986 PP == domain 2 score: 88.1 bits; conditional E-value: 4.8e-29 CBM13.hmm 13 nsgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnra 102 gkcl gg++a+g+++ql++c+++a+Q W l dgt+r gkcLd a ++ta+g ++++ +cng+++Q+W ++ ++i+++a XQC74204.1|CBM13 341 LGGKCLdvkGGKAANGTQIQLYTCNGSAAQSWILGVDGTFR----AFGKCLDNARNATADGNRITLHDCNGTPAQRWSVNAK----GQIVHVA 425 479***98777779999******776677*********877....3379***777778*********************777....89***** PP CBM13.hmm 103 sgkcLdvkgg..adgtpvqqwdcngganQqWs 132 sgk+Ldvkgg a+gt vq+++ n++ Q W XQC74204.1|CBM13 426 SGKVLDVKGGatANGTVVQLHTANTNKRQVWV 457 ********999********************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (460 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 31.25 // Query: WPO75170.1|CBM13 [L=437] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-35 109.6 16.7 3e-28 85.5 8.0 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.3 1.4 1.9e-13 1.9e-13 23 108 .. 285 365 .. 253 366 .. 0.63 2 ! 85.5 8.0 3e-28 3e-28 14 132 .. 319 434 .. 314 437 .] 0.87 Alignments for each domain: == domain 1 score: 37.3 bits; conditional E-value: 1.9e-13 CBM13.hmm 23 aaganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLd 108 ag+ vq++d ++ + ++g + r++ gkcLdv ++++a+g+++q+ytcngg +Q W l+++ ++ ra gkcLd WPO75170.1|CBM13 285 RAGTYVQQYDVQG-----LRHLAHGggaalppQGRITGLG-GKCLDVKGGKAANGTQIQLYTCNGGVAQSWILQKD----RTF--RALGKCLD 365 3444466666433.....1111111245444444555554.79***9966669*************99*****877....355..45789998 PP == domain 2 score: 85.5 bits; conditional E-value: 3e-28 CBM13.hmm 14 sgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnras 103 gkcl gg++a+g+++ql++c++g +Q W l++d t+r gkcLd +++++g ++++ +c+gga+Q+W ++ ++i+++as WPO75170.1|CBM13 319 GGKCLdvkGGKAANGTQIQLYTCNGGVAQSWILQKDRTFR--AL--GKCLDNHRNASTNGNKISLRDCDGGASQRWSVSAK----GQIVHVAS 403 79***98777779999******766667********9777..33..68***5555658********************777....89****** PP CBM13.hmm 104 gkcLdvkgg..adgtpvqqwdcngganQqWs 132 gk+Ldv+gg ad t++q+++ n++ Q W WPO75170.1|CBM13 404 GKVLDVTGGstADSTRIQLYTANTNKRQVWV 434 *******999999*****************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (437 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 28.17 // Query: XMS36458.1|CBM13 [L=448] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.1e-44 137.2 22.0 3.9e-29 88.4 8.6 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.7 5.5 2.9e-21 2.9e-21 40 134 .. 317 404 .. 270 406 .. 0.74 2 ! 88.4 8.6 3.9e-29 3.9e-29 11 132 .. 327 445 .. 323 448 .] 0.87 Alignments for each domain: == domain 1 score: 62.7 bits; conditional E-value: 2.9e-21 CBM13.hmm 40 qWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQq 130 tl+++g r ++ gkcLd+ ++++a+g+++q+ytcng+a+Q W l ++ +++ ra gkcLd + + ++g+++ ++dcng+a Q+ XMS36458.1|CBM13 317 GATLSPQG--R-VSGIAGKCLDAKGGKAANGTQIQLYTCNGSAAQSWILGKD----GTF--RAFGKCLDNARNaaTNGNKISLHDCNGTAAQR 400 33444444..2.233348****8866769********************777....567..669*******888888**************** PP CBM13.hmm 131 Wsvl 134 Wsv XMS36458.1|CBM13 401 WSVN 404 *986 PP == domain 2 score: 88.4 bits; conditional E-value: 3.9e-29 CBM13.hmm 11 nvnsgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirn 100 ++ gkcl gg++a+g+++ql++c+++a+Q W l +dgt+r gkcLd a +++++g ++++ +cng+a+Q+W ++ ++i++ XMS36458.1|CBM13 327 SGIAGKCLdakGGKAANGTQIQLYTCNGSAAQSWILGKDGTFR----AFGKCLDNARNAATNGNKISLHDCNGTAAQRWSVNAK----GQIVH 411 5668****87666669999******776677*********887....3379***7766657********************777....89*** PP CBM13.hmm 101 rasgkcLdvkgg..adgtpvqqwdcngganQqWs 132 +asgk+Ldv+gg a+ tpvq+++ n+g Q W XMS36458.1|CBM13 412 VASGKVLDVTGGatANSTPVQLYTANTGKGQVWV 445 **********999999*************9***5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (448 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 31.09 // Query: XUK12831.1|CBM13 [L=433] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-34 105.8 14.0 3.9e-29 88.4 6.7 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 29.8 0.7 3.6e-11 3.6e-11 34 95 .. 280 352 .. 247 356 .. 0.56 2 ! 88.4 6.7 3.9e-29 3.9e-29 11 132 .. 312 430 .. 310 433 .] 0.88 Alignments for each domain: == domain 1 score: 29.8 bits; conditional E-value: 3.6e-11 CBM13.hmm 34 cn.gan.QqWtlt.......sdg.....tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgy 95 ++ g+ Qq+ ++ ++g + r ++ +gkcLdv ++++a+g+++ + tcngg +Q W l ++ g+ XUK12831.1|CBM13 280 KRaGTYvQQFDVQglryfaaHTGaqlppQGR-VSGLGGKCLDVKGGKAANGTQIELFTCNGGVAQSWILGKD--GT 352 2234555666666444444323354443333.3333489****966669*************99***99544..55 PP == domain 2 score: 88.4 bits; conditional E-value: 3.9e-29 CBM13.hmm 11 nvnsgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirn 100 ++ gkcl gg++a+g+++ l +c++g +Q W l +dgt+r gkcLd a +++++g ++++ +c+gga+Q+W ++ ++i++ XUK12831.1|CBM13 312 SGLGGKCLdvkGGKAANGTQIELFTCNGGVAQSWILGKDGTFR--AL--GKCLDNARNANTNGNRISLFDCHGGASQRWSVNAK----GQIVH 396 55689***98777779999******766667*********877..33..68***7766778********************777....89*** PP CBM13.hmm 101 rasgkcLdvkgg..adgtpvqqwdcngganQqWs 132 +asgk+Ldv+gg a+gt++q+++ n++ Q W XUK12831.1|CBM13 397 VASGKVLDVAGGstANGTKIQLYTANTNKRQVWV 430 **********999********************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (433 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 29.82 // Query: UUU38299.1|CBM13 [L=427] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-36 112.4 16.4 2.1e-29 89.3 9.2 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 35.6 0.7 6.2e-13 6.2e-13 54 109 .. 308 356 .. 245 357 .. 0.69 2 ! 89.3 9.2 2.1e-29 2.1e-29 15 132 .. 310 424 .. 305 427 .] 0.88 Alignments for each domain: == domain 1 score: 35.6 bits; conditional E-value: 6.2e-13 CBM13.hmm 54 hqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLdv 109 + kcLdv ++++ +g+++q+ytcng+a+Q W + ++ +++ ra gkcLd UUU38299.1|CBM13 308 I-GAKCLDVKGGKAVNGTQIQLYTCNGSAAQSWIVGKD----GTF--RAFGKCLDN 356 2.248****966657********************766....567..6699***95 PP == domain 2 score: 89.3 bits; conditional E-value: 2.1e-29 CBM13.hmm 15 gkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasg 104 kcl gg++ +g+++ql++c+++a+Q W + +dgt+r gkcLd a s++++g ++++y+cng+a+Q+W ++ ++i+++asg UUU38299.1|CBM13 310 AKCLdvkGGKAVNGTQIQLYTCNGSAAQSWIVGKDGTFR----AFGKCLDNARSASTNGNKISLYDCNGSAAQRWSVNAK----GQIVHVASG 394 69**88777779*********776677*********887....3379***6666667********************777....89******* PP CBM13.hmm 105 kcLdvkgg..adgtpvqqwdcngganQqWs 132 k+Ldv+gg a+gt vq+++ n++ Q W UUU38299.1|CBM13 395 KVLDVTGGatANGTVVQLYTANTNKRQVWV 424 ******999********************5 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (427 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 29.72 // Query: XUZ89561.1|CBM13 [L=425] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-29 90.1 5.7 2.6e-29 89.0 5.3 1.7 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.0 5.3 2.6e-29 2.6e-29 13 132 .. 306 422 .. 300 425 .] 0.87 Alignments for each domain: == domain 1 score: 89.0 bits; conditional E-value: 2.6e-29 CBM13.hmm 13 nsgkcl...ggstaaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnra 102 gkcl +g+ a+g+++ql++c+++a Q W l++dgt+r gkcLd a ++ta+g ++q+ +c+gg++Q+W ++ + ++i+++a XUZ89561.1|CBM13 306 LGGKCLdvkAGNPANGTQIQLYRCNGSATQSWILDRDGTFR--AL--GKCLDNADNATADGNRIQLRDCDGGPSQRWSVNAE----GQITHVA 390 479***8866666**********776677*********877..33..68***776677*********************877....89***** PP CBM13.hmm 103 sgkcLdvkgg..adgtpvqqwdcngganQqWs 132 sgk+Ldv+gg +dgt++q+++ n+ Q W+ XUZ89561.1|CBM13 391 SGKVLDVTGGrtTDGTRIQLHSANSYKRQVWA 422 ********999999*********99888*996 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (425 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 33.67 // [ok]