# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/CBM13/fasta_for_each_cluster/cluster_131.txt # target HMM database: merged_hmms/CBM13.hmm # per-dom hits tabular output: hmmscan_out/domain_result/CBM13/CBM13_cluster_131.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: QKV71599.1|CBM13|GH30_5 [L=677] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-22 66.6 0.4 1.9e-22 66.6 0.4 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.3 2.9 1 1 121 136 .. 138 153 .. 128 162 .. 0.63 2 ! 66.6 0.4 1.9e-22 1.9e-22 5 135 .. 539 674 .. 535 677 .] 0.78 Alignments for each domain: == domain 1 score: -4.3 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlks 136 w ++ +a Q+W v++ QKV71599.1|CBM13|GH30_5 138 WNDDADATQRWWVERI 153 4444455566655444 PP == domain 2 score: 66.6 bits; conditional E-value: 1.9e-22 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan.vqlwdccnganQqWtltsdgtirlenhqsgkcLdva..assta..agaevqqytcngg.anQ 84 +ty+l++v+sg+ l + +++g++ v+ + +++++Q Wtlt+++ +n+qs +L ++ a +ga+v +++ + a+ QKV71599.1|CBM13|GH30_5 539 HTYQLTGVQSGRAL-TVADDGSGaVISTAVDGDRGQIWTLTPHTK-GHDNRQS-YVLGTRegNQRFAvrDGAAVLEKDRGRAdAAA 621 589***********.44477776477676455677******9982.3356664.57774333333236699999999995557788 PP CBM13.hmm 85 qWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlk 135 +W l+++g+g+y+++n a+g+ L+v+g+ ++ g+pv++w+ n+ganQ+W +++ QKV71599.1|CBM13|GH30_5 622 RWILSTTGDGTYTLVNEATGRLLEVSGQaTHeGAPVTVWTPNSGANQRWEITD 674 ****************999*******9985569****************9986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (677 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 82.25 // Query: QEU69621.1|CBM13|GH30_5 [L=675] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-18 54.0 11.5 4.8e-13 35.9 1.0 3.0 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.4 0.21 0.21 80 89 .. 143 152 .. 132 177 .. 0.65 2 ! 25.1 0.1 1e-09 1e-09 47 111 .. 537 603 .. 528 616 .. 0.80 3 ! 35.9 1.0 4.8e-13 4.8e-13 81 136 .. 614 673 .. 600 675 .] 0.86 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.21 CBM13.hmm 80 gganQqWrle 89 +a+Q+W+++ QEU69621.1|CBM13|GH30_5 143 ADADQRWWVD 152 2255666552 PP == domain 2 score: 25.1 bits; conditional E-value: 1e-09 CBM13.hmm 47 g.tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvg.....sgyykirnrasgkcLdvkg 111 g t++l+ +qsgk+++v +a+g+++++ t ng+a+QqW+l+ + y++ n a gk L v QEU69621.1|CBM13|GH30_5 537 GhTYTLTGVQSGKAVTV----AANGTSLVLGTGNGTAAQQWQLDARYgetgaRQRYVFANPAEGKRLAVRD 603 4589************8....389*********9*********8773354444469999999999999984 PP == domain 3 score: 35.9 bits; conditional E-value: 4.8e-13 CBM13.hmm 81 g..anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlks 136 ++ W +++g+g+++++n a+ ++L+v g+ ++ g+ v++w+ n+g+nQ+W+v+++ QEU69621.1|CBM13|GH30_5 614 ErdPATEWVMSTTGDGTWTLVNPATSRVLEVGGQaTNeGAAVTTWQPNSGSNQRWRVTDV 673 3446678*************************9996669****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (675 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 47.39 // Query: AYY13883.1|CBM13|GH30_5 [L=1077] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-21 64.1 0.5 1.2e-20 60.7 0.0 2.4 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 2.3 0.14 0.14 121 135 .. 155 168 .. 144 183 .. 0.61 2 ! 60.7 0.0 1.2e-20 1.2e-20 5 146 .. 549 694 .. 545 710 .. 0.79 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.14 CBM13.hmm 121 wdcngganQqWsvlk 135 w ++ +anQ+W + + AYY13883.1|CBM13|GH30_5 155 WNWDADANQRW-WID 168 45444556666.333 PP == domain 2 score: 60.7 bits; conditional E-value: 1.2e-20 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg.tirlenhqsgkcLd.va.assta.agaevqqytcngg..anQ 84 ++yrl++v+sg+ l + ++ g++v+++d + +Q W++++ + + n+ +L v+ ++ a +++++ ++ g ++ AYY13883.1|CBM13|GH30_5 549 HVYRLQGVQSGLSL-APGDGGDGVVIRDNADVPEQLWSVRKLTgG--VGNRER-HVLAnVDiGQRLAeRDGSLVLEPDEGEadDAA 630 579***********.4445566799999445788******87642..344442.26666766554455888899999877777678 PP CBM13.hmm 85 qWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaek 146 qW +++g+g+y+++n+ +g+ +dv+g +dg+pv++w+ ++ganQ+W+vl+++l ++++e AYY13883.1|CBM13|GH30_5 631 QWIMSTTGDGTYTFVNAGTGRLIDVSGEatDDGSPVTTWTPTSGANQRWTVLDETLLGTETVEL 694 9***************999*******888777********************999877776665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1077 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 130.88 // Query: QDY66860.1|CBM13|GH30_5 [L=1112] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-15 43.8 1.2 1.9e-15 43.8 1.2 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.8 1.2 1.9e-15 1.9e-15 5 135 .. 576 713 .. 572 731 .. 0.74 2 ? -3.8 0.0 0.74 0.74 126 150 .. 909 933 .. 900 952 .. 0.65 Alignments for each domain: == domain 1 score: 43.8 bits; conditional E-value: 1.9e-15 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.gan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg 81 g+y+l++++s++ l + ++ ga++ + + + a+ Q+Wt t+ + +i l+ g+ L v +++ga++++ + QDY66860.1|CBM13|GH30_5 576 GRYTLIGGQSQLAL-AAGEGGATIEQPATTAqEAEaQTWTATRLTggssnreRIALTDGA-GRTLGV----DDQGATLTVAGGEPA 655 799***********.445666667777755444556******765566663334443333.567776....368899988886444 PP CBM13.hmm 82 .anQ.qWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlk 135 + qW +++++ ++ ++n+++g +Ldv+g + g+ v +w +gg nQqW + QDY66860.1|CBM13|GH30_5 656 tDRRlQWIPTTTNGSTWSLVNASNGYALDVNGEstEPGASVGTWRSSGGGNQQWDLRS 713 4333489999888788*****888*******888655*****************7655 PP == domain 2 score: -3.8 bits; conditional E-value: 0.74 CBM13.hmm 126 ganQqWsvlksdlkikliaekvipd 150 + Ws++ks +k+ + + ++ d QDY66860.1|CBM13|GH30_5 909 TRDKAWSNWKSGDKNEQDTLGYALD 933 4456677777776666665555555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1112 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 140.39 // Query: QZZ32122.1|CBM13|GH30_5 [L=678] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-17 48.4 14.0 2e-12 33.9 1.2 2.7 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.2 0.6 0.96 0.96 126 136 .. 148 158 .. 141 168 .. 0.55 2 ! 24.5 0.3 1.6e-09 1.6e-09 43 112 .. 537 608 .. 492 619 .. 0.75 3 ! 33.9 1.2 2e-12 2e-12 81 135 .. 618 676 .. 609 678 .] 0.86 Alignments for each domain: == domain 1 score: -4.2 bits; conditional E-value: 0.96 CBM13.hmm 126 ganQqWsvlks 136 +a Q+W v + QZZ32122.1|CBM13|GH30_5 148 DATQRWWVDRI 158 34455544444 PP == domain 2 score: 24.5 bits; conditional E-value: 1.6e-09 CBM13.hmm 43 ltsdg.tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvg....sg.yykirnrasgkcLdvkgg 112 l s+g ++ l+ +qs+k+++ a+g+++++ + ngg +QqWrle+v ++ y++ n a gk L v ++ QZZ32122.1|CBM13|GH30_5 537 LFSKGkAYSLTGVQSNKAVT----LGANGTSLTINSANGGVAQQWRLEQVYgttgNRlRYVFANPAEGKRLAVRND 608 44555699******99****....679*************99******9954533334699999999999999864 PP == domain 3 score: 33.9 bits; conditional E-value: 2e-12 CBM13.hmm 81 g..anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlk 135 + a+ W l+++g+g+++++n+a+g+ L+v g+ ++ g+ v++w n+ganQ+W++ + QZZ32122.1|CBM13|GH30_5 618 TrdAATEWILSTTGDGTWTLVNAATGRLLEVGGQaTNeGAAVTTWYGNSGANQRWRIAR 676 3437789*************************9996669****************9876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (678 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 41.74 // Query: ARF78052.1|CBM13|GH30_5 [L=819] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-57 180.0 26.0 1.5e-38 119.1 4.8 4.0 4 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.4 0.3 0.019 0.019 121 154 .. 158 191 .. 146 239 .. 0.72 2 ? -1.0 0.0 0.099 0.099 24 76 .. 455 492 .. 436 502 .. 0.55 3 ! 70.6 4.3 1.1e-23 1.1e-23 7 134 .. 547 677 .. 542 683 .. 0.87 4 ! 119.1 4.8 1.5e-38 1.5e-38 6 132 .. 684 817 .. 679 819 .] 0.90 Alignments for each domain: == domain 1 score: 1.4 bits; conditional E-value: 0.019 CBM13.hmm 121 wdcngganQqWsvlksdlkikliaekvipdgnnn 154 w +anQ+W + +++++ ++++e++ + + ARF78052.1|CBM13|GH30_5 158 WNPQADANQRWWLAAAKARGADTFEAFSNSAPYF 191 4444466777766666666666666665555544 PP == domain 2 score: -1.0 bits; conditional E-value: 0.099 CBM13.hmm 24 agan.vqlwdccn.ganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqy 76 g++ v +++ ++ ga+Q+ tl+ +g ++n++ + +vqqy ARF78052.1|CBM13|GH30_5 455 GGTGaVAVYT-NStGAAQTVTLDLAG---FQNVD-------------TSVPVQQY 492 4554477777.433555777777666...23333.............22344444 PP == domain 3 score: 70.6 bits; conditional E-value: 1.1e-23 CBM13.hmm 7 yrlvnvnsgkclggstaaganvqlwdccn..ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcnggan 83 +lv+ nsg+ l++++a++++vq + n + +QqWt+t+++ t+ ++n+++g++L+ aa ++v++ + +g+++ ARF78052.1|CBM13|GH30_5 547 RQLVSDNSGMALAADAAQSSPVQHVA--NpaDPAQQWTFTKATggwdstaTYGITNARTGQALS------AAATTVSLAAPDGSTA 624 689*********77777777888655..332466******8766888899********99***9......67899999999899** PP CBM13.hmm 84 QqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvl 134 QqW l+++g+g ++++n+a+g+ Ldv+g+ +dg+p w+ +g+anQ W++ ARF78052.1|CBM13|GH30_5 625 QQWMLSTTGNGHVTLINKATGLLLDVSGAskSDGAPADAWQPTGAANQSWTIP 677 ***************************999999*****************875 PP == domain 4 score: 119.1 bits; conditional E-value: 1.5e-38 CBM13.hmm 6 tyrlvnvnsgkcl...ggstaaganvqlwdccn.ganQqWtltsdg..tirlenhqsgkcLdvaasstaagaevqqytcngganQq 85 +++l+ ++s+kc g+st+ a+v++++c + ++nQqW+l++++ ++++++++sg+cLdva+ sta+ga qy+c g++nQq ARF78052.1|CBM13|GH30_5 684 WTALTARHSSKCAgvsGASTTPAAPVVQYTC-GsADNQQWSLRPASpgYVTVVSRSSGQCLDVAGVSTADGALADQYPCGGADNQQ 768 678999*******666556666668*****5.54888********998999999999*******7777***********888**** PP CBM13.hmm 86 WrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWs 132 W + g+gy++++ r+sgkcLdv++ adg+ v qw+c+g++nQq++ ARF78052.1|CBM13|GH30_5 769 WSVRDMGGGYVTLVARHSGKCLDVANVstADGAAVEQWTCSGSPNQQFR 817 ***9999******************88999*****************96 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (819 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 37.83 // Query: QDO24864.1|CBM13|GH30_5 [L=688] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-19 57.7 5.8 1e-19 57.7 5.8 2.9 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.6 2.2 0.63 0.63 121 138 .. 144 161 .. 113 171 .. 0.73 2 ? -2.5 0.0 0.29 0.29 137 177 .. 422 462 .. 417 470 .. 0.76 3 ! 57.7 5.8 1e-19 1e-19 5 137 .. 543 683 .. 539 687 .. 0.78 Alignments for each domain: == domain 1 score: -3.6 bits; conditional E-value: 0.63 CBM13.hmm 121 wdcngganQqWsvlksdl 138 w n +a Q+W v + ++ QDO24864.1|CBM13|GH30_5 144 WNPNADATQRWWVDRIKK 161 455556666765555554 PP == domain 2 score: -2.5 bits; conditional E-value: 0.29 CBM13.hmm 137 dlkikliaekvipdgnnnilntqlpnivvlskNlesalivg 177 + ++++ ++++i g++ i ++ + sk ++a +v QDO24864.1|CBM13|GH30_5 422 KFDTARNFTHYIKPGDRLIKTDDTSSAAAVSKSGNGATVVH 462 55677888899999999999999999988888888887665 PP == domain 3 score: 57.7 bits; conditional E-value: 1e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan..vqlwdccn..ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 +ty l++v+sgk l +++g + +++++ + ++Q+W+l++ + ++ ++n gk L v +ga+v + + QDO24864.1|CBM13|GH30_5 543 HTYSLTGVQSGKALT-VADDGGKlvIKTASTDAatVTGQRWQLRQISgqtgnrqRYVFTNPVEGKRLAV-----RDGAPVLEAD-T 621 6899**********3.3345554224444433343467******6655666878888888888899997.....5888885555.4 PP CBM13.hmm 80 gg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 g ++ qW +++g+g+++++n+a+gk L+v g+ adg+ v++w+ n+g+nQ+W+v++++ QDO24864.1|CBM13|GH30_5 622 GPrdTATQWIMSTTGDGTWTLVNAATGKLLEVGGQatADGSAVTIWTPNSGSNQRWTVSDVT 683 55667789*************************889999*****************998876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (688 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 47.84 // Query: BCL32884.1|CBM13|GH30_5 [L=684] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-20 58.3 0.3 6.5e-20 58.3 0.3 2.3 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.2 1.3 0.47 0.47 121 134 .. 144 157 .. 106 168 .. 0.70 2 ? -2.8 0.1 0.36 0.36 35 48 .. 287 306 .. 269 348 .. 0.52 3 ! 58.3 0.3 6.5e-20 6.5e-20 5 135 .. 543 678 .. 539 682 .. 0.80 Alignments for each domain: == domain 1 score: -3.2 bits; conditional E-value: 0.47 CBM13.hmm 121 wdcngganQqWsvl 134 w + +a Q+W v BCL32884.1|CBM13|GH30_5 144 WNKDADATQRWWVD 157 33333444444333 PP == domain 2 score: -2.8 bits; conditional E-value: 0.36 CBM13.hmm 35 n.gan.QqWtltsdg....t 48 n ++ Q+W+ ++++ BCL32884.1|CBM13|GH30_5 287 NpSTFaQNWNTYPQEvrdlV 306 33333366666555444431 PP == domain 3 score: 58.3 bits; conditional E-value: 6.5e-20 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +ty+l++v+sgk l + +++g+ +++++ + +a+QqW+l++ + ++ l n +k L v +ga+v + +g BCL32884.1|CBM13|GH30_5 543 HTYELTGVQSGKAL-TVADNGTDLVIRSATArAAGQQWKLRKISgdtgnrqRYVLSNPVEDKRLAV-----RDGAPVLESD-TGPr 621 689***********.45588888666775655788******6654556777777777776688886.....5888885555.4666 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlk 135 + qW +s+g+g+++++n+a+g+ L+v g+ ++ + v++w+ n+ganQ+W+v + BCL32884.1|CBM13|GH30_5 622 dRATQWIMSSTGDGTWTLVNAATGRLLEVGGQaTHeSASVTLWTPNSGANQRWKVAE 678 55679*************************88755469***************9865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (684 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 116.24 // Query: ANJ28198.1|CBM13|GH30_5|GH43_24 [L=1397] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-16 47.8 0.1 3.9e-16 46.0 0.1 2.0 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.0 0.1 3.9e-16 3.9e-16 5 137 .. 543 685 .. 539 734 .. 0.76 Alignments for each domain: == domain 1 score: 46.0 bits; conditional E-value: 3.9e-16 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan.vqlwdcc.n.gan.QqWtltsdg........tirlenhqsgkcLdvaasstaag 70 +t+rlv+v+s+k l+ +++g++ +l d +++ Q Wt t+ + ++ l+ ++ g+ L ++a+g ANJ28198.1|CBM13|GH30_5|GH43_24 543 ETFRLVGVQSSKPLA--ATSGSPaTVLGDAAaAgADDaQLWTATRLSegdgttsdRFALRLAD-GRTLA----ANASG 613 6899********993..333333244555443345667******5555455654433333333.45666....568** PP CBM13.hmm 71 aevqqytcngg...anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlksd 137 +e++ t+ + a+ qW +++++ ++++ n a ++Ldv+g+ ++ g+ v +w+ ngg nQ++++ +++ ANJ28198.1|CBM13|GH30_5|GH43_24 614 TELRTLTDEQAradASAQWVANTTDGTTFTLLNPARERVLDVAGQsTSvGASVGLWTSNGGGNQRFTIVEPE 685 *******97667777889***8886667*****999*******9996669***************9987765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1397 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.58 // Query: QQM45979.1|CBM13|GH30_5 [L=681] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-20 61.0 4.2 1e-20 61.0 4.2 2.6 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.1 1.4 0.89 0.89 81 134 .. 149 157 .. 142 167 .. 0.51 2 ? -2.9 0.0 0.38 0.38 136 176 .. 421 461 .. 417 466 .. 0.79 3 ! 61.0 4.2 1e-20 1e-20 5 136 .. 543 679 .. 539 681 .] 0.84 Alignments for each domain: == domain 1 score: -4.1 bits; conditional E-value: 0.89 CBM13.hmm 81 ganQqWrlesvgsgyykirnrasgkcLdvkggadgtpvqqwdcngganQqWsvl 134 +a Q+W++ QQM45979.1|CBM13|GH30_5 149 DATQRWWV---------------------------------------------D 157 24455544.............................................3 PP == domain 2 score: -2.9 bits; conditional E-value: 0.38 CBM13.hmm 136 sdlkikliaekvipdgnnnilntqlpnivvlskNlesaliv 176 + ++++ ++++i g++ i ++ + sk ++a +v QQM45979.1|CBM13|GH30_5 421 TKFDTARNFTHYIKPGDRLIKTDDTSSAAAVSKKGNGATVV 461 55667788999999999999999999999999988888665 PP == domain 3 score: 61.0 bits; conditional E-value: 1e-20 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +ty+l++v+sgk l + +++g+++++++ + +a+Q W+l++ + ++ ++n gk L v +ga+v + g QQM45979.1|CBM13|GH30_5 543 HTYELTGVQSGKAL-TVADNGTSLVIRTSAGdAAGQEWKLRQISgdtgnrqRYVFTNPVEGKRLAV-----RDGAPVLEADS-GPr 621 689***********.55588999777775675777******665566788899999999899**97.....58999866664.556 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 ++ qW +++g+g+++++n+a+g+ L+v g+ +dg+ v++w+ n+g+nQ+W+v+++ QQM45979.1|CBM13|GH30_5 622 dKATQWIMSTTGDGTWTLVNAATGRLLEVGGQatNDGAAVTLWTPNSGSNQRWKVTDV 679 66789*************************989777*****************99986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (681 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 52.87 // Query: QWB21122.1|CBM13|GH30_5 [L=1053] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-20 58.8 1.5 6.6e-20 58.3 0.0 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.2 0.8 0.5 0.5 121 137 .. 141 157 .. 135 167 .. 0.57 2 ! 58.3 0.0 6.6e-20 6.6e-20 5 153 .. 535 685 .. 531 696 .. 0.78 Alignments for each domain: == domain 1 score: -3.2 bits; conditional E-value: 0.5 CBM13.hmm 121 wdcngganQqWsvlksd 137 wd++ ++ Q+W v +++ QWB21122.1|CBM13|GH30_5 141 WDWSADPGQRWWVDRVK 157 44444445555433333 PP == domain 2 score: 58.3 bits; conditional E-value: 6.6e-20 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngga 82 +tyrl++++sgk l+ a+ ++v++++ + + +Q W++++ + ++ l+n+ +g L v +++ ++ ++++ QWB21122.1|CBM13|GH30_5 535 HTYRLQGAQSGKSLA-PSADESGVVVRTADPaAPSQLWSVKRLTrgdsnreRYALVNAATGTRLAVR----DNE--AVLEE-SDTP 612 589***********4.3345555666664433566******55544555667777777766777752....222..23333.3677 PP CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgnn 153 + qW +++g+g+++++n+a+g+ Ldv g+ adg++v + +++anQ+W+v+++++ +++a+++++ g+ QWB21122.1|CBM13|GH30_5 613 AAQWIMSTTGDGTWTFVNAATGRLLDVVGQstADGARVSAYLPTSNANQRWAVTDETVLRTEQAKAFTVPGRT 685 789*************************9899******************************99999988876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1053 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 176.33 // Query: QNE44347.1|CBM13|GH30_5 [L=1333] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-15 41.9 0.5 7.2e-15 41.9 0.5 2.5 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.0 0.1 0.1 0.1 73 134 .. 158 174 .. 138 211 .. 0.69 2 ! 41.9 0.5 7.2e-15 7.2e-15 6 135 .. 591 731 .. 587 743 .. 0.73 3 ? -3.1 1.2 0.45 0.45 64 88 .. 952 974 .. 925 988 .. 0.57 Alignments for each domain: == domain 1 score: -1.0 bits; conditional E-value: 0.1 CBM13.hmm 73 vqqytcngganQqWrlesvgsgyykirnrasgkcLdvkggadgtpvqqwdcngganQqWsvl 134 ++qy+ + +a Q+W++ QNE44347.1|CBM13|GH30_5 158 LSQYDLDADATQRWWV---------------------------------------------D 174 4455543335555554.............................................3 PP == domain 2 score: 41.9 bits; conditional E-value: 7.2e-15 CBM13.hmm 6 tyrlvnvnsgkclggstaaga..nvqlwdccn.gan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn. 79 y++v+v+sgk l++ t +ga +++ + ++ +a+ Q Wt +++ +++l+ ++ g+ L +t+ g+e++ + QNE44347.1|CBM13|GH30_5 591 DYQFVGVQSGKALSTGTGTGAatTLTSSATTTeAAGrQSWTARTVPtesgderRVTLRAAD-GRYLA----ATSRGTELRSVDEAt 671 699**********555544442244444434467888******554456664445554444.78998....567888887777641 PP CBM13.hmm 80 ..gganQqWrlesvgsgyykirnras.gkcLdvkgg..adgtpvqqwdcngganQqWsvlk 135 g+++ +W+++++++ ++ ++ + + Ldv+g+ a g+ v ++ ngganQ+W v + QNE44347.1|CBM13|GH30_5 672 aaGDPASRWWVTTTDGSTFSLVG-EGvAQSLDVNGQssAEGAGVGVYGSNGGANQRWVVRD 731 2255899****988666799999.4447******989888*****************8866 PP == domain 3 score: -3.1 bits; conditional E-value: 0.45 CBM13.hmm 64 asstaagaevqqytcngganQqWrl 88 a+ + +g++vq y++ g+a W QNE44347.1|CBM13|GH30_5 952 APRDVSGMTVQFYPD-GSA-TSWAQ 974 334347888888885.443.44533 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1333 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 169.16 // Query: BCW34993.1|CBM13|GH30_5|GH43_24 [L=1421] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-16 46.8 1.1 2.2e-16 46.8 1.1 2.5 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.6 0.1 0.62 0.62 7 28 .. 429 452 .. 425 456 .. 0.58 2 ! 46.8 1.1 2.2e-16 2.2e-16 5 137 .. 532 671 .. 528 715 .. 0.74 3 ? -2.8 0.4 0.38 0.38 69 91 .. 1069 1093 .. 1041 1104 .. 0.48 Alignments for each domain: == domain 1 score: -3.6 bits; conditional E-value: 0.62 CBM13.hmm 7 yrlvnvnsgkcl.ggstaagan.v 28 +++n+++g+++ ++++++a+ v BCW34993.1|CBM13|GH30_5|GH43_24 429 SAVKNNGTGLVMvHTNDSDQAKtV 452 566777788888644444444335 PP == domain 2 score: 46.8 bits; conditional E-value: 2.2e-16 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan.vqlwdccnganQqWtlt....sdg....tirlenhqsgkcLdvaasstaagaev 73 ++y +v+v+sg+ + +++g++ +l d + Q W+ t dg ++ l+ + +g++L ++a+g+ + BCW34993.1|CBM13|GH30_5|GH43_24 532 QSYSFVGVQSGRAV--TASDGSPaTVLGDNVASPTQVWKATriadEDGatrdRFVLRLA-DGRALA----ADANGTVL 602 67999*******99..5577776577777333466******665533377544444443.478998....679***** PP CBM13.hmm 74 qqytcngg...anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 + t++ + ++ qW ++++++ ++ + n+a +++Ldv+++ a+g+ + +w+ ngganQ +++ +++ BCW34993.1|CBM13|GH30_5|GH43_24 603 RTLTDQEAgadPSAQWLFSTTDGTSFSLLNAARQQVLDVSNQstASGSWIGLWPSNGGANQAFTLRNAS 671 999986555566889***9886667*****988*******889999****************9765544 PP == domain 3 score: -2.8 bits; conditional E-value: 0.38 CBM13.hmm 69 agaevqqytcngganQ..qWrlesv 91 + ++v++ ++ ++ Q +W+++ + BCW34993.1|CBM13|GH30_5|GH43_24 1069 NVTSVTVSQNGQSSTQpvTWQITGD 1093 3333444443222222223444333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1421 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 147.78 // Query: AZQ39325.1|CBM13|GH30_5 [L=695] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-17 50.7 3.9 1.5e-17 50.7 3.9 1.8 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.2 0.8 0.96 0.96 126 135 .. 150 159 .. 142 168 .. 0.51 2 ! 50.7 3.9 1.5e-17 1.5e-17 5 141 .. 544 686 .. 540 693 .. 0.77 Alignments for each domain: == domain 1 score: -4.2 bits; conditional E-value: 0.96 CBM13.hmm 126 ganQqWsvlk 135 + Q+W v + AZQ39325.1|CBM13|GH30_5 150 DKTQRWWVDR 159 3345554444 PP == domain 2 score: 50.7 bits; conditional E-value: 1.5e-17 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.gan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg 81 +tyrl++v+sgk l + +++g+++++ + + + QqW+l+ ++ ++ + + +k L v +++++ ++ ++ AZQ39325.1|CBM13|GH30_5 544 HTYRLTGVQSGKDL-TIADNGNGLVIKSAGAtDPSgQQWRLEETSrgndnrkRYVFAEATQDKRLAV------RDGKLVAEPDEDS 622 689*********88.333777776666634344555******7775666677455544443467775......5677888887777 PP CBM13.hmm 82 ..anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlksdlkik 141 a+ qW +++g+g+++++n+a+g+ dv g+ ++ g+ v +w+ n+ganQ+W+v++++ ++ AZQ39325.1|CBM13|GH30_5 623 rdAAAQWIMSTTGDGTWTLVNAATGQLPDVGGQsTNeGAAVGVWQPNSGANQRWKVTEVASASA 686 778889*************************9996669******************99887655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (695 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 145.38 // Query: AXG52000.1|CBM13|GH30_5 [L=1065] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-22 65.4 0.0 4.4e-22 65.4 0.0 2.2 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.6 2.3 0.64 0.64 77 92 .. 147 162 .. 138 174 .. 0.55 2 ! 65.4 0.0 4.4e-22 4.4e-22 5 155 .. 540 696 .. 536 707 .. 0.79 Alignments for each domain: == domain 1 score: -3.6 bits; conditional E-value: 0.64 CBM13.hmm 77 tcngg.anQqWrlesvg 92 + g+ a Q+W++++v+ AXG52000.1|CBM13|GH30_5 147 DW-GAdAGQRWWVDQVK 162 32.22244555554443 PP == domain 2 score: 65.4 bits; conditional E-value: 4.4e-22 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 ++yrl++++sgk l + ++g++v++++ ++ +a+Q W++++ + ++ l+++ gk L v + +v + + + + AXG52000.1|CBM13|GH30_5 540 HVYRLQGAHSGKSL-TPSEDGSGVVIRTTDQaSAEQLWSVRQLTpgndhseRYALTSATHGKRLAV-----RDDQAVLLDPADTAp 619 5799**********.44588888888885554566******5544444455666666665566665.....366677777765556 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgnnni 155 ++ qW l+++g+g+++++n+a+g+ Ldv+g+ adg++v +++ +++anQ+W+ +++++ +++ae +++ g + + AXG52000.1|CBM13|GH30_5 620 dPAAQWILSTTGDGTWTFVNAATGRLLDVAGQstADGARVSTYTPTSAANQRWAATDETVLRTKQAEVFTVPGLAPK 696 66789*************************9899*************************999999998888776655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1065 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 167.65 // Query: QIY75672.1|CBM13|GH30_5 [L=685] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-19 56.1 5.6 3.2e-19 56.1 5.6 3.1 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.2 2.5 0.99 0.99 121 139 .. 144 162 .. 132 170 .. 0.68 2 ? -2.4 0.0 0.27 0.27 136 177 .. 421 462 .. 417 470 .. 0.76 3 ! 56.1 5.6 3.2e-19 3.2e-19 5 136 .. 543 682 .. 539 685 .] 0.79 Alignments for each domain: == domain 1 score: -4.2 bits; conditional E-value: 0.99 CBM13.hmm 121 wdcngganQqWsvlksdlk 139 w n +a Q+W v + +++ QIY75672.1|CBM13|GH30_5 144 WNPNADATQRWWVDRIKKD 162 5555566677766555554 PP == domain 2 score: -2.4 bits; conditional E-value: 0.27 CBM13.hmm 136 sdlkikliaekvipdgnnnilntqlpnivvlskNlesalivg 177 + ++++ ++++i g++ i ++ + sk ++a +v QIY75672.1|CBM13|GH30_5 421 TKFDTARNFTHYIKPGDRLIKTDDTSSAAAVSKSGNGATVVH 462 556677888899999999999999999999888888887665 PP == domain 3 score: 56.1 bits; conditional E-value: 3.2e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan.vqlwdcc.n...ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytc 78 +ty l++v+sgk l + +++g++ v+ + + a+Q+W+l++ + ++ ++n gk L v +ga+v + QIY75672.1|CBM13|GH30_5 543 HTYSLTGVQSGKAL-TVADDGSKlVI-KTAGtDaatVAAQRWQLRQISgqtgnrqRYVFTNLVEGKRLAV-----RDGAPVLEAD- 620 6899**********.44466765333.332212342366******6655666888999999998999997.....5888885555. PP CBM13.hmm 79 ngg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 +g a+ qW +++g+g+++++n+a+g+ L+v g+ adg+ v++w+ n+g+nQ+W+v+++ QIY75672.1|CBM13|GH30_5 621 TGPrdAATQWIASTTGDGTWTLVNAATGRLLEVGGQatADGSAVTIWTPNSGSNQRWTVSDV 682 455668899***999*******************889999*****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (685 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 49.71 // Query: ASN19209.1|CBM13|GH30_5|GH43_24 [L=1430] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-15 43.2 3.1 2.7e-15 43.2 3.1 2.6 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 43.2 3.1 2.7e-15 2.7e-15 5 141 .. 571 712 .. 567 754 .. 0.69 2 ? -2.2 0.3 0.23 0.23 70 127 .. 1111 1133 .. 1036 1144 .. 0.58 3 ? -2.0 0.4 0.21 0.21 9 46 .. 1338 1372 .. 1332 1425 .. 0.43 Alignments for each domain: == domain 1 score: 43.2 bits; conditional E-value: 2.7e-15 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan.vqlwdccnganQqWtlt....sdg....tirlenhqsgkcLdvaasstaagaev 73 ++y +v+v+sg+ + +++g++ +l d g+nQ W+ t dg ++ l+ + +g++L ++a+g+++ ASN19209.1|CBM13|GH30_5|GH43_24 571 QSYSFVGVQSGRAV--TASDGSPkTVLSDSVAGGNQVWKATliadEDGttrdRFVLRLA-DGRALA----ADANGTTL 641 67999*******99..5577886588888455799******887744466444444333.478998....678***** PP CBM13.hmm 74 qqytcngg...anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlksdlkik 141 + t+ + ++ qW ++++++ ++ + n+ ++Ldv+++ ++ g+ + +w+ ngganQ +++ +++ ASN19209.1|CBM13|GH30_5|GH43_24 642 RTITDEEArtdSSAQWLFSTTDGTSFSLLNAGVHQVLDVSNQsTHeGAWIGLWTSNGGANQAFTLRNASE--G 712 999986556655679***9886667*****5559******8895559***************97655443..3 PP == domain 2 score: -2.2 bits; conditional E-value: 0.23 CBM13.hmm 70 gaevqqytcngganQqWrlesvgsgyykirnrasgkcLdvkgg.adgtpvqqwdcngga 127 ++v+++ ++ t+ ++w+ +g++ ASN19209.1|CBM13|GH30_5|GH43_24 1111 S------------------------------------VTVTQNgQSSTQPVTWQVTGNT 1133 2....................................2233222223333333333333 PP == domain 3 score: -2.0 bits; conditional E-value: 0.21 CBM13.hmm 9 lvnvnsgkcl.......ggstaaganvqlwdccn.ganQqWtltsd 46 ++ v+s kc+ + ql + n +++ q t+ts+ ASN19209.1|CBM13|GH30_5|GH43_24 1338 VTAVASTKCVagkvtvtA---------QLTN--NdTKSVQATFTSA 1372 567778888832222211.........2222..2123333444432 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1430 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 172.11 // Query: AZP15340.1|CBM13|GH30_5 [L=679] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-21 62.5 11.4 9.2e-18 51.3 6.8 2.7 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.2 0.9 1 1 125 135 .. 147 157 .. 142 165 .. 0.53 2 ! 22.2 0.1 7.8e-09 7.8e-09 43 110 .. 537 607 .. 497 619 .. 0.75 3 ! 51.3 6.8 9.2e-18 9.2e-18 6 135 .. 543 677 .. 541 679 .] 0.82 Alignments for each domain: == domain 1 score: -4.2 bits; conditional E-value: 1 CBM13.hmm 125 gganQqWsvlk 135 +a Q+W v++ AZP15340.1|CBM13|GH30_5 147 ADATQRWWVER 157 34445554444 PP == domain 2 score: 22.2 bits; conditional E-value: 7.8e-09 CBM13.hmm 43 ltsdg.tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvg.....sg.yykirnrasgkcLdvk 110 l s+g +++l+ +qsgk+++v a+g+++++ + ng+ +Q Wrle ++ y++ n a gk L v AZP15340.1|CBM13|GH30_5 537 LFSKGaSYTLTGVQSGKAVTV----GANGTNLVINSANGTVAQEWRLEAKYgkkgsNRaRYVFANPAEGKRLAVR 607 445556899999999999997....489999*****99999999**99773343433335899998889888887 PP == domain 3 score: 51.3 bits; conditional E-value: 9.2e-18 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccngan.QqWtltsdg........tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +y+l++v+sgk + + +a+g+n+++++ ++ + Q W+l+++ ++ + n gk L v ++ +v + +++g+ AZP15340.1|CBM13|GH30_5 543 SYTLTGVQSGKAV-TVGANGTNLVINSANG-TVaQEWRLEAKYgkkgsnraRYVFANPAEGKRLAV-----RDNVPV-IEPDTGDr 620 699********99.55599***88888455.555******5533566787889999999899**97.....456666.44445666 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlk 135 ++ W l+++g+g+++++n+a+g+ L+v g+ ++ g+ v++w+ n+g+nQ+W++++ AZP15340.1|CBM13|GH30_5 621 dPATEWILSTTGDGTWTLVNQATGRLLEVGGQaTNeGAAVTTWQANSGSNQRWRITE 677 68899*************************9996669****************9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (679 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 49.09 // Query: QDO34985.1|CBM13|GH30_5 [L=688] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-19 57.7 5.8 1e-19 57.7 5.8 2.9 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.6 2.2 0.63 0.63 121 138 .. 144 161 .. 113 171 .. 0.73 2 ? -2.5 0.0 0.29 0.29 137 177 .. 422 462 .. 417 470 .. 0.76 3 ! 57.7 5.8 1e-19 1e-19 5 137 .. 543 683 .. 539 687 .. 0.78 Alignments for each domain: == domain 1 score: -3.6 bits; conditional E-value: 0.63 CBM13.hmm 121 wdcngganQqWsvlksdl 138 w n +a Q+W v + ++ QDO34985.1|CBM13|GH30_5 144 WNPNADATQRWWVDRIKK 161 455556666765555554 PP == domain 2 score: -2.5 bits; conditional E-value: 0.29 CBM13.hmm 137 dlkikliaekvipdgnnnilntqlpnivvlskNlesalivg 177 + ++++ ++++i g++ i ++ + sk ++a +v QDO34985.1|CBM13|GH30_5 422 KFDTARNFTHYIKPGDRLIKTDDTSSAAAVSKSGNGATVVH 462 55677888899999999999999999988888888887665 PP == domain 3 score: 57.7 bits; conditional E-value: 1e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan..vqlwdccn..ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 +ty l++v+sgk l +++g + +++++ + ++Q+W+l++ + ++ ++n gk L v +ga+v + + QDO34985.1|CBM13|GH30_5 543 HTYSLTGVQSGKALT-VADDGGKlvIKTASTDAatVTGQRWQLRQISgqtgnrqRYVFTNPVEGKRLAV-----RDGAPVLEAD-T 621 6899**********3.3345554224444433343467******6655666878888888888899997.....5888885555.4 PP CBM13.hmm 80 gg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 g ++ qW +++g+g+++++n+a+gk L+v g+ adg+ v++w+ n+g+nQ+W+v++++ QDO34985.1|CBM13|GH30_5 622 GPrdTATQWIMSTTGDGTWTLVNAATGKLLEVGGQatADGSAVTIWTPNSGSNQRWTVSDVT 683 55667789*************************889999*****************998876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (688 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 51.10 // Query: QDO13445.1|CBM13|GH30_5 [L=688] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-19 56.3 5.6 2.7e-19 56.3 5.6 3.0 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.7 4.1 1 1 121 139 .. 144 162 .. 121 172 .. 0.71 2 ? -2.5 0.0 0.29 0.29 137 177 .. 422 462 .. 417 470 .. 0.76 3 ! 56.3 5.6 2.7e-19 2.7e-19 5 137 .. 543 683 .. 539 687 .. 0.78 Alignments for each domain: == domain 1 score: -4.7 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlksdlk 139 w n +a Q+W v + +++ QDO13445.1|CBM13|GH30_5 144 WNSNADATQRWWVDRIKKD 162 5555566677755555544 PP == domain 2 score: -2.5 bits; conditional E-value: 0.29 CBM13.hmm 137 dlkikliaekvipdgnnnilntqlpnivvlskNlesalivg 177 + ++++ ++++i g++ i ++ + sk ++a +v QDO13445.1|CBM13|GH30_5 422 KFDTARNFTHYIKPGDRLIKTDDTSSAAAVSKSGNGATVVH 462 55677888899999999999999999988888888887665 PP == domain 3 score: 56.3 bits; conditional E-value: 2.7e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan..vqlwdccn..ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 +ty l++v+sgk l +++g + +++++ + ++Q+W+l++ + ++ ++n gk L v +ga+v + + QDO13445.1|CBM13|GH30_5 543 HTYSLTGVQSGKALT-VADDGGKlvIKTASTDAatVTGQRWQLRQISgqtgnrqRYVFTNPVEGKRLAV-----RDGAPVLEAD-T 621 6899**********3.3345554224444433343467******6655666878888888888899997.....5888885555.4 PP CBM13.hmm 80 gg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 g ++ qW +++g+g+++++n+a+g+ L+v g+ adg+ v++w+ n+g+nQ+W+v++++ QDO13445.1|CBM13|GH30_5 622 GPrdTATQWIMSTTGDGTWTLVNAATGRLLEVGGQatADGSAVTIWTPNSGSNQRWTVSDVT 683 55667789*************************889999*****************998876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (688 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 51.80 // Query: AUG28546.1|CBM13|GH30_5 [L=1369] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-18 52.0 2.2 5.5e-18 52.0 2.2 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.4 0.8 1 1 124 136 .. 153 165 .. 149 174 .. 0.53 2 ! 52.0 2.2 5.5e-18 5.5e-18 5 146 .. 572 721 .. 568 731 .. 0.73 Alignments for each domain: == domain 1 score: -4.4 bits; conditional E-value: 1 CBM13.hmm 124 ngganQqWsvlks 136 n ++ Q+W +++ AUG28546.1|CBM13|GH30_5 153 NADSTQRWWIEAL 165 3344455544444 PP == domain 2 score: 52.0 bits; conditional E-value: 5.5e-18 CBM13.hmm 5 gtyrlvnvnsgkclggst.aaga.nvqlwdcc.ngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 ty+l + +sgk l t ++ a +++ + + ++a Q+Wt +s + ++ l++ + g+ L ++g+++++ t + AUG28546.1|CBM13|GH30_5 572 ATYQLLGTQSGKAL---TvQNAAlTIRSSATTaDAATaQTWTAVSLSgagtdrqRVLLRSGD-GRYLA------SSGTSLTLATES 647 57999999******...313333334444433234555******876677665444444444.67887......699999999986 PP CBM13.hmm 80 gg.....anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaek 146 ++ qW ++ ++++y + n+as ++Ldv+gg +dgt v +w+ n+ganQ W++ + +++ ++ AUG28546.1|CBM13|GH30_5 648 AEqaaadPAAQWVPNTLDGRSYSFLNVASTRVLDVNGGgtSDGTSVGLWTSNNGANQSWTLAPTAIDTVANVTV 721 33444444788**98777889***************888999*****************887777666655554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1369 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 197.87 // Query: AXG59005.1|CBM13|GH30_5 [L=679] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-20 58.8 7.1 4.5e-20 58.8 7.1 3.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.7 0.21 0.21 121 138 .. 139 156 .. 132 175 .. 0.69 2 ! 58.8 7.1 4.5e-20 4.5e-20 6 140 .. 539 677 .. 534 679 .] 0.80 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.21 CBM13.hmm 121 wdcngganQqWsvlksdl 138 w n +a Q+W v + ++ AXG59005.1|CBM13|GH30_5 139 WNKNADATQRWWVDRIKK 156 444555566665554444 PP == domain 2 score: 58.8 bits; conditional E-value: 4.5e-20 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccnganQqWtlt....sdg....tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 y+l++v+sgk + + +a+g+n+++ + +++++QqW+lt + ++++ n gk L v ++ +v + t++g AXG59005.1|CBM13|GH30_5 539 DYTLTGVQSGKAV-TVAANGTNLVIGTGNGSTAQQWQLTgrygE-TgsrqRYEFSNPAEGKRLAV-----RDNVPV-IETDTGErd 616 699********99.5559999977777344666******55552.0577799**999999***98.....355555.555556666 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlki 140 a+ W l+++g+g+++++n+++g+ L+v g+ + g+ v++w+ n+g+nQ+W+++++++ + AXG59005.1|CBM13|GH30_5 617 AAAEWILSTTGDGTWTLVNASTGRLLEVGGQatGEGAAVTTWQPNSGSNQRWTITDVTAAS 677 8899***************777*******8876669******************9988655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (679 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 53.23 // Query: QDI72926.1|CBM13|GH30_5 [L=679] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-22 66.3 2.0 9.9e-19 54.5 1.5 2.5 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.8 0.9 0.71 0.71 124 135 .. 146 157 .. 142 169 .. 0.53 2 ! 18.7 0.0 8.9e-08 8.9e-08 46 110 .. 540 606 .. 517 617 .. 0.81 3 ! 54.5 1.5 9.9e-19 9.9e-19 5 136 .. 542 677 .. 538 679 .] 0.80 Alignments for each domain: == domain 1 score: -3.8 bits; conditional E-value: 0.71 CBM13.hmm 124 ngganQqWsvlk 135 + +a Q+W v + QDI72926.1|CBM13|GH30_5 146 HADATQRWWVDR 157 333445554444 PP == domain 2 score: 18.7 bits; conditional E-value: 8.9e-08 CBM13.hmm 46 dg.tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvg..sg...yykirnrasgkcLdvk 110 +g t++l+ +qsgk+++va ++g+ +++ + +g+a+Q+Wrl+ v +g y ++n +g+ L+v QDI72926.1|CBM13|GH30_5 540 KGrTYTLTGVQSGKAVTVA----DDGTGLVIGAGDGSAAQRWRLSAVRpdDGvrqRYEFTNPVDGRRLTVR 606 45699******99****83....7999******9999*******999666445547999998888888886 PP == domain 3 score: 54.5 bits; conditional E-value: 9.9e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 +ty+l++v+sgk + + +++g+++++ + +++a+Q+W+l+++ +++++n +g+ L+v + +v + +g QDI72926.1|CBM13|GH30_5 542 RTYTLTGVQSGKAV-TVADDGTGLVIGAGDGSAAQRWRLSAVRpddgvrqRYEFTNPVDGRRLTV-----RDDVPVAEPH-TGErd 620 689*********99.5558999966566355566******55555569999999999999****8.....2344443333.33344 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 ++ W +++g+g+++++n+a+g+ L+v g+ dg+ v++w+ n+ganQ+W+v+++ QDI72926.1|CBM13|GH30_5 621 PAAEWIMSTTGDGTWTLVNAATGRLLEVGGQatHDGAAVTTWQPNSGANQRWTVTDV 677 6789*************************989777******************9986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (679 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 51.41 // Query: AZM79440.1|CBM13|GH30_5 [L=679] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-15 44.2 9.5 6.5e-13 35.5 0.3 2.8 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.3 1.1 0.51 0.51 124 136 .. 145 157 .. 140 176 .. 0.61 2 ! 14.3 0.1 2.1e-06 2.1e-06 47 92 .. 541 582 .. 527 604 .. 0.71 3 ! 35.5 0.3 6.5e-13 6.5e-13 83 136 .. 621 676 .. 594 678 .. 0.87 Alignments for each domain: == domain 1 score: -3.3 bits; conditional E-value: 0.51 CBM13.hmm 124 ngganQqWsvlks 136 + +a Q+W v++ AZM79440.1|CBM13|GH30_5 145 DADATQRWWVQRI 157 2244455544443 PP == domain 2 score: 14.3 bits; conditional E-value: 2.1e-06 CBM13.hmm 47 gtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvg 92 +t++l+ +qsgk+++va ++g+++++ t ++++ qWrl+ v AZM79440.1|CBM13|GH30_5 541 HTYTLTGVQSGKAVTVA----GDGTNLVLGTGADASAEQWRLSAVR 582 37777777777777762....5777777777777777777776664 PP == domain 3 score: 35.5 bits; conditional E-value: 6.5e-13 CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlks 136 + W +s+g+g+++++n+a+g+ L+v g+ ++ g+ v++w+ n+ganQ+W+++++ AZM79440.1|CBM13|GH30_5 621 AAEWMASSTGDGTWTLVNAATGRLLEVGGQaTHaGAAVTTWPPNSGANQRWTLTDV 676 457*************************9885559****************99875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (679 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 53.46 // Query: QYF96390.1|CBM13|GH30_5 [L=1371] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-18 52.1 1.7 5.3e-18 52.1 1.7 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 0.7 0.79 0.79 124 136 .. 153 165 .. 148 174 .. 0.54 2 ! 52.1 1.7 5.3e-18 5.3e-18 5 145 .. 572 720 .. 568 731 .. 0.73 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 0.79 CBM13.hmm 124 ngganQqWsvlks 136 n +a Q+W +++ QYF96390.1|CBM13|GH30_5 153 NADATQRWWIEAL 165 3344455544444 PP == domain 2 score: 52.1 bits; conditional E-value: 5.3e-18 CBM13.hmm 5 gtyrlvnvnsgkclggst.aaga.nvqlwdcc.ngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 ty+l + +sgk l t ++ a +++ + + ++a Q+Wt +s + ++ l++ + g+ L ++g+++++ t + QYF96390.1|CBM13|GH30_5 572 ATYQLLGTQSGKAL---TvQNAAlTIRSSATTaDAATaQTWTAVSLSgagtdrqRVLLRSGD-GRYLA------SSGTSLTLATES 647 57999999******...313333334444433234555******876677665444444444.67887......699999999986 PP CBM13.hmm 80 gg.....anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliae 145 ++ qW ++ ++++y + n+as ++Ldv+gg +dgt v +w+ n+ganQ W++ + +++ ++ QYF96390.1|CBM13|GH30_5 648 AEqaaadPAAQWVPNTLDGRSYSFLNVASTRVLDVNGGgtSDGTSVGLWTSNNGANQSWTLAPTAIDTVADVT 720 33444444788**98777889***************888999*****************88777766665554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1371 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 197.49 // Query: ANS63076.1|CBM13|GH30_5 [L=1049] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-22 65.4 0.0 4.3e-22 65.4 0.0 2.2 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.7 3.5 1 1 77 92 .. 131 146 .. 121 158 .. 0.56 2 ! 65.4 0.0 4.3e-22 4.3e-22 5 155 .. 524 680 .. 520 691 .. 0.79 Alignments for each domain: == domain 1 score: -4.7 bits; conditional E-value: 1 CBM13.hmm 77 tcngg.anQqWrlesvg 92 + g+ a Q+W++++v+ ANS63076.1|CBM13|GH30_5 131 DW-GAdAGQRWWVDQVK 146 32.22244555544443 PP == domain 2 score: 65.4 bits; conditional E-value: 4.3e-22 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 ++yrl++++sgk l + ++g++v++++ ++ +a+Q W++++ + ++ l+++ gk L v + +v + + + + ANS63076.1|CBM13|GH30_5 524 HVYRLQGAHSGKSL-TPSEDGSGVVIRTTDQaSAEQLWSVRQLTpgndhseRYALTSATHGKRLAV-----RDDQAVLLDPADTAp 603 5799**********.44588888888885554566******5544444455666666665566665.....366677777765556 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgnnni 155 ++ qW l+++g+g+++++n+a+g+ Ldv+g+ adg++v +++ +++anQ+W+ +++++ +++ae +++ g + + ANS63076.1|CBM13|GH30_5 604 dPAAQWILSTTGDGTWTFVNAATGRLLDVAGQstADGARVSTYTPTSAANQRWAATDETVLRTKQAEVFTVPGLAPK 680 66789*************************9899*************************999999998888776655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1049 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 170.29 // Query: AXI90261.1|CBM13|GH30_5 [L=676] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-18 53.2 1.4 2.4e-18 53.2 1.4 2.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 1.0 0.79 0.79 125 136 .. 146 157 .. 141 167 .. 0.52 2 ! 53.2 1.4 2.4e-18 2.4e-18 5 136 .. 541 674 .. 537 676 .] 0.80 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 0.79 CBM13.hmm 125 gganQqWsvlks 136 +a Q+W v + AXI90261.1|CBM13|GH30_5 146 ADATQRWWVDRI 157 234456654444 PP == domain 2 score: 53.2 bits; conditional E-value: 2.4e-18 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +ty+l++++sgk l + + +g++++++ ++ ++ Q+W+l +++ +++++n + L+v + ++ +++g AXI90261.1|CBM13|GH30_5 541 RTYTLTGAQSGKAL-TLAGNGTGLVIAGGDG-SGaQRWRLGAVHrddgtrqRYEFTNGDR--RLTV-----RDDV-PVAEPRTGRp 616 6899**********.5568999955555255.555*****95555556888899999874..9997.....2333.4566677777 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlks 136 ++ qW +++g+g+++++n+a+g+ L+v g+ ++ g+ v++w+ n+ganQ+W+++++ AXI90261.1|CBM13|GH30_5 617 dPAAQWIASTTGDGTWTLVNAATGRLLEVGGQaTHeGAAVTTWPPNSGANQRWRITDV 674 66789***999*******************9885569****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (676 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 56.12 // Query: QHC56726.1|CBM13|GH30_5 [L=1217] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-16 45.2 3.5 7.1e-16 45.2 3.5 2.6 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.7 1.0 0.082 0.082 85 141 .. 114 169 .. 86 186 .. 0.65 2 ? -3.5 0.1 0.6 0.6 23 44 .. 477 499 .. 448 535 .. 0.51 3 ! 45.2 3.5 7.1e-16 7.1e-16 6 139 .. 578 722 .. 574 736 .. 0.71 Alignments for each domain: == domain 1 score: -0.7 bits; conditional E-value: 0.082 CBM13.hmm 85 qWrlesvgsgy.ykirnrasgkcLdvkggadgtpvqqwdcngganQqWsvlksdlkik 141 W+ +++g y ++ +n+a+ +L +k +ad +d++ + Q+W v+k +++++ QHC56726.1|CBM13|GH30_5 114 WWKPDTTGAAYgGTTTNYADRAALLAKWNADD--PASYDWTADETQRWWVEKLAAEQQ 169 46666666555467788888544444434554..567888888889997776655544 PP == domain 2 score: -3.5 bits; conditional E-value: 0.6 CBM13.hmm 23 aagan.vqlwdccn.ganQqWtlt 44 a+g++ ++++ ++ +a+Q+ tl+ QHC56726.1|CBM13|GH30_5 477 ADGTGaTIVHS-NTaTASQTITLD 499 34443222333.222333555554 PP == domain 3 score: 45.2 bits; conditional E-value: 7.1e-16 CBM13.hmm 6 tyrlvnvnsgkcl.ggstaagan.vqlwdccn.gan.QqWtltsdg......tirlenhq.s.gkcLdvaasstaagaevqqytcn 79 +y+lv+ +sgk l ++ t a ++ +l++ ++ +a+ Q+Wt++ + t r + q + g++L + t+ag+ ++ + + QHC56726.1|CBM13|GH30_5 578 HYQLVGTQSGKALtATTTGAATTiTTLAT-DSaAAAkQNWTVHEVPagereaT-RRVVLQtTdGRVLGA----TTAGTDLRSVSVD 657 69***********4333344445456666.5455555******5544588854.444444345899994....4556666555543 PP CBM13.hmm 80 gg...anQqWrlesvgsgyykirnras.gkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlk 139 ++ a+ +W ++s+++ +++++n +s + Ldv+g+ a t v ++ ngganQ W++ + + QHC56726.1|CBM13|GH30_5 658 SAkatAATRWIVNSTDGVNVTLVN-ESiAQSLDVNGQssAENTAVGVYGSNGGANQSWTLRDLAPA 722 33445899****9996668*****.8879******9886668****************98776554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1217 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 156.71 // Query: QMV11604.1|CBM13|GH30_5 [L=679] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-20 58.8 7.1 4.5e-20 58.8 7.1 3.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.7 0.21 0.21 121 138 .. 139 156 .. 132 175 .. 0.69 2 ! 58.8 7.1 4.5e-20 4.5e-20 6 140 .. 539 677 .. 534 679 .] 0.80 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.21 CBM13.hmm 121 wdcngganQqWsvlksdl 138 w n +a Q+W v + ++ QMV11604.1|CBM13|GH30_5 139 WNKNADATQRWWVDRIKK 156 444555566665554444 PP == domain 2 score: 58.8 bits; conditional E-value: 4.5e-20 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccnganQqWtlt....sdg....tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 y+l++v+sgk + + +a+g+n+++ + +++++QqW+lt + ++++ n gk L v ++ +v + t++g QMV11604.1|CBM13|GH30_5 539 DYTLTGVQSGKAV-TVAANGTNLVIGTGNGSTAQQWQLTgrygE-TgsrqRYEFSNPAEGKRLAV-----RDNVPV-IETDTGErd 616 699********99.5559999977777344666******55552.0577799**999999***98.....355555.555556666 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlki 140 a+ W l+++g+g+++++n+++g+ L+v g+ + g+ v++w+ n+g+nQ+W+++++++ + QMV11604.1|CBM13|GH30_5 617 AAAEWILSTTGDGTWTLVNASTGRLLEVGGQatGEGAAVTTWQPNSGSNQRWTITDVTAAS 677 8899***************777*******8876669******************9988655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (679 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 47.55 // Query: BCW60390.1|CBM13|GH30_5 [L=1172] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-10 27.8 1.9 1.5e-10 27.8 1.9 3.5 5 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.6 0.5 0.16 0.16 81 135 .. 171 180 .. 139 195 .. 0.64 2 ? -1.5 0.1 0.14 0.14 25 55 .. 455 492 .. 443 514 .. 0.41 3 ! 27.8 1.9 1.5e-10 1.5e-10 6 140 .. 601 760 .. 596 774 .. 0.68 4 ? -1.6 0.1 0.16 0.16 69 134 .. 940 960 .. 921 1002 .. 0.71 5 ? -3.0 0.1 0.42 0.42 59 88 .. 1121 1152 .. 1091 1166 .. 0.53 Alignments for each domain: == domain 1 score: -1.6 bits; conditional E-value: 0.16 CBM13.hmm 81 ganQqWrlesvgsgyykirnrasgkcLdvkggadgtpvqqwdcngganQqWsvlk 135 ++nQ+W++e + BCW60390.1|CBM13|GH30_5 171 DQNQRWWVE---------------------------------------------R 180 245555543.............................................3 PP == domain 2 score: -1.5 bits; conditional E-value: 0.14 CBM13.hmm 25 ganvqlwdccnganQqWtltsdg.......tirlenhq 55 ga+ ++ c+ +nQ+ + t++ + ++n + BCW60390.1|CBM13|GH30_5 455 GATGDQAKCKVLTNQKYNTTRNFthyirpgDFLIQNDN 492 33333333221344444444332222222223333332 PP == domain 3 score: 27.8 bits; conditional E-value: 1.5e-10 CBM13.hmm 6 tyrlvnvnsgkclggstaaga.nvq.lwdccn.gan.QqWtltsdg........tirlenhqsgkcLdv.......aasstaagae 72 +y+l + +sgk+l + a+g+ ++ l + g + Q Wt++++g ++ + ++ +g++L+ ++s +a+ ++ BCW60390.1|CBM13|GH30_5 601 SYHLSGEASGKYL-TGRANGTaSIEeLGG-DAaGVApQMWTFNAVGaggfgndrRWVVSSK-DGRVLTGnggvlngSQSGAASLGS 683 68999999*****.333555523442333.2223444999999777778887643333333.467777534443213333348888 PP CBM13.hmm 73 vqqytcngganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngga.......nQqWsvlksdlki 140 +++ + +++ qW +++++++++ ++n+ +L+v+g+ a gt v + + +g++ Q W++++ ++ + BCW60390.1|CBM13|GH30_5 684 LSVEQAKATPSAQWIVTTENGKQWSLVNAGAAIALQVSGNqtAAGTSVALASSTGTTatasanpHQAWAFTDIADLK 760 8888886778999***9998999*****7779******999888***999999553324444448999999877655 PP == domain 4 score: -1.6 bits; conditional E-value: 0.16 CBM13.hmm 69 agaevqqytcngganQqWrlesvgsgyykirnrasgkcLdvkggadgtpvqqwdcngganQqWsvl 134 g+ + tc+++a+ +W s++ BCW60390.1|CBM13|GH30_5 940 EGSYIAKNTCDSNASTRW---------------------------------------------SNW 960 444444455544455555.............................................443 PP == domain 5 score: -3.0 bits; conditional E-value: 0.42 CBM13.hmm 59 cLdva.asstaagaevqqytcngg.anQqWrl 88 +++v+ t+++ +v++ t ++ +n W+ BCW60390.1|CBM13|GH30_5 1121 IVTVTaPDGTTKQYRVTVSTGKDAcKNNGWKT 1152 33333111223455555555444454555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1172 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 122.77 // Query: SDR87740.1|CBM13|GH30_5 [L=651] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-17 48.2 0.8 1.8e-16 47.1 0.8 1.6 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.1 0.8 1.8e-16 1.8e-16 5 138 .. 510 648 .. 507 651 .] 0.73 Alignments for each domain: == domain 1 score: 47.1 bits; conditional E-value: 1.8e-16 CBM13.hmm 5 gtyrlvnvnsgkcl..ggstaaganvqlwdccn.ganQqWtltsdg.tirlenhqsgkcLdvaassta.agaevqqytcngg..an 83 +tyr+v+v+sg+ l gs+++ ++++++ + +++Q Wt+t+ + ++ + h+ ++ d a +++++ + +g + SDR87740.1|CBM13|GH30_5 510 RTYRFVGVQSGRSLatRGSGSE--GLVVRTTDAaNGDQLWTVTRLTgGWTNREHHQLRARDG--RQVAvRSGALVLEAAQGPpdEA 591 589***********33333333..4555553332366******8866555555553234442..2223455666777765667556 PP CBM13.hmm 84 QqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdl 138 +W l+++g+g+y+ n+a ++v g+ adg+ v w+ n g+nQ+W+v+++++ SDR87740.1|CBM13|GH30_5 592 ARWYLSTTGDGTYTMANVAGPGNIEVGGQatADGSAVGAWQPNAGPNQRWRVTDETV 648 79***************999999****889999*******************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (651 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 120.49 // Query: AMW11790.1|CBM13|GH30_5 [L=684] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-16 46.5 1.0 2.8e-16 46.5 1.0 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.2 1.6 0.99 0.99 121 137 .. 146 162 .. 138 170 .. 0.62 2 ! 46.5 1.0 2.8e-16 2.8e-16 5 136 .. 545 681 .. 540 683 .. 0.75 Alignments for each domain: == domain 1 score: -4.2 bits; conditional E-value: 0.99 CBM13.hmm 121 wdcngganQqWsvlksd 137 w ++ + Q+W v + + AMW11790.1|CBM13|GH30_5 146 WNRHADKTQRWWVDRIK 162 44455555666554444 PP == domain 2 score: 46.5 bits; conditional E-value: 2.8e-16 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.gan.QqWtltsdg......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +tyrl++v+sgk l + + +g+++++ + + + + qW++++ ++ l+ +k L v +++++ ++ g AMW11790.1|CBM13|GH30_5 545 HTYRLTGVQSGKDL-TIAGNGTGLVIKTPDAsDPSgRQWRVEQIRgednrkRYVLTETGADKRLAV------RDGALVAEPDAGRr 623 689*********88.344888985556656345555******443333344444444443345543......66677788877778 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 a+ qW +++g+g+++++n+a+g+ dv g+ +dg+ v +w+ n+g+nQ+W+v+++ AMW11790.1|CBM13|GH30_5 624 dAAAQWIASTTGDGTWTLVNAATGQLPDVGGQstNDGASVGVWQPNSGSNQRWRVTEV 681 77889***999*******************989777*****************99986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (684 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.40 // Query: AFO80904.1|CBM13|GH30_5 [L=661] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-21 63.0 1.3 2.4e-21 63.0 1.3 2.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.2 0.12 0.12 81 101 .. 136 149 .. 123 156 .. 0.69 2 ! 63.0 1.3 2.4e-21 2.4e-21 7 132 .. 530 657 .. 526 660 .. 0.83 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.12 CBM13.hmm 81 ganQqWrlesvgsgyykirnr 101 ++nQ+W+l + ki+nr AFO80904.1|CBM13|GH30_5 136 DPNQRWWL--D-----KIKNR 149 36788877..3.....45554 PP == domain 2 score: 63.0 bits; conditional E-value: 2.4e-21 CBM13.hmm 7 yrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg..a 82 +++++v+sgk l s+++g+ vq ++ + +++Q+Wtlt+ + +++++n +g++L +ag++v++ + g + AFO80904.1|CBM13|GH30_5 530 VTFTGVQSGKSL--SAENGSLVQ-RTTDAsATAQRWTLTDRTgrygnrdRFTITNTGTGQVLA------TAGGAVTLAAA-GPcdP 605 6788999***99..667776455.553543666******776688888999999999899998......58999988885.55666 PP CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWs 132 + qW+l+++g+g+++++n+a+g+ Ldv+g adg+++ +++ ++g+nQ+W+ AFO80904.1|CBM13|GH30_5 606 AAQWTLSTTGDGTWTFVNAATGQLLDVTGEsrADGARIGLYKPTNGPNQRWQ 657 678*************************878********************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (661 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 140.39 // Query: QIG38692.1|CBM13|GH30_5 [L=1200] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-18 52.2 0.7 4.9e-18 52.2 0.7 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.6 0.29 0.29 122 135 .. 151 164 .. 134 178 .. 0.59 2 ! 52.2 0.7 4.9e-18 4.9e-18 5 146 .. 568 717 .. 565 733 .. 0.74 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.29 CBM13.hmm 122 dcngganQqWsvlk 135 d++ +a Q+W +++ QIG38692.1|CBM13|GH30_5 151 DWDADATQRWWIEA 164 33334444443333 PP == domain 2 score: 52.2 bits; conditional E-value: 4.9e-18 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.gan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg 81 +ty+l +v+sgk l+++ ++ a +++ + ++ ga Q Wt+++ + ++ l+n++ g+ L + + g++++ t + QIG38692.1|CBM13|GH30_5 568 HTYQLLGVQSGKALAADPSSLA-IRTSATTTaGATaQAWTVRTLEgagtdrqRFVLQNRD-GRLLGTS----GGGTTLSTSTVEAA 647 5799**********43333333.4444433345555******665566776788888887.6799844....45555555554222 PP CBM13.hmm 82 ...anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaek 146 ++ qW +++++++y + ++a ++Ldv+g+ adg+ v +++ ngganQ+W++ +++++ ++ +++ QIG38692.1|CBM13|GH30_5 648 asdPALQWIASTTDGKTYSLLSVAGEQVLDVNGQstADGASVGLYTSNGGANQRWTLADVAVTGAKSVRT 717 2226689*998888889*****9999******9899*******************999988877666554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1200 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 175.32 // Query: QZD54715.1|CBM13|GH30_5 [L=984] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-22 66.7 0.0 1.8e-22 66.7 0.0 2.4 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.8 4.1 0.36 0.36 121 134 .. 150 163 .. 140 179 .. 0.61 2 ! 66.7 0.0 1.8e-22 1.8e-22 6 149 .. 542 690 .. 537 697 .. 0.84 Alignments for each domain: == domain 1 score: -2.8 bits; conditional E-value: 0.36 CBM13.hmm 121 wdcngganQqWsvl 134 w ++ +anQ+W + QZD54715.1|CBM13|GH30_5 150 WNWDADANQRWWID 163 44444455555332 PP == domain 2 score: 66.7 bits; conditional E-value: 1.8e-22 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 +yr+ +v+sgk + + ++ga+++l++ + +a+Q Wt+++ + +++++n+ +g L v a g +v + g+ QZD54715.1|CBM13|GH30_5 542 VYRFDGVQSGKSI-APSEDGAGIVLRTDDAsSAEQLWTIDQLTdgvsnreQYQIVNAATGTRLAV-----AEGLAVLESAE-GDps 620 68999999***99.56689999999994444566******6655688889********9999997.....56666666665.5546 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvip 149 + +W l+++g+g+y+ +n+ +g++Ldv+g adg+pvq+++ + ++nQ+W+v ++++ ++ ++e++++ QZD54715.1|CBM13|GH30_5 621 EAAKWYLSTTGDGTYVPVNVGTGRVLDVWGEatADGSPVQTYTPTAASNQRWTVVDETVLETVKVETYTV 690 6789*************************878999********999***********9999988888766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (984 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 160.17 // Query: BAJ75049.1|CBM13|GH30_5 [L=1174] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-15 44.1 0.8 3.8e-15 42.8 0.0 2.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.3 0.1 1 1 81 89 .. 158 166 .. 149 177 .. 0.56 2 ! 42.8 0.0 3.8e-15 3.8e-15 5 147 .. 574 723 .. 571 736 .. 0.71 Alignments for each domain: == domain 1 score: -4.3 bits; conditional E-value: 1 CBM13.hmm 81 ganQqWrle 89 +++Q+W+l+ BAJ75049.1|CBM13|GH30_5 158 DSAQRWWLD 166 234555443 PP == domain 2 score: 42.8 bits; conditional E-value: 3.8e-15 CBM13.hmm 5 gtyrlvnvnsgkcl.ggstaaganvqlwdcc.ngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcng 80 +t++lv+v+sg+ l g +++ ++ + + + ++a Q Wt+++ + +++len + g L s +ga+ + t+ BAJ75049.1|CBM13|GH30_5 574 QTVQLVGVQSGLALhG---DDDLTIETDATTpEAARaQGWTVRTIDgagtnrhRFTLENGD-GAFLG----S-RDGATALIDTDAA 650 6799**********31...222234444433233444*****9664466776677777776.45776....2.5888888888754 PP CBM13.hmm 81 g....anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlksdlkikliaekv 147 + ++ qW ++ ++ +y + n+a ++Ldv+g+ +d gt v +w+ ng+ nQ W++ ++ ++ + ++ BAJ75049.1|CBM13|GH30_5 651 TaaadPATQWMGSTLDGTTYSVLNVAAERVLDVDGAsSDaGTAVGLWTSNGAGNQTWRLVSTTAVGSDPVSAA 723 444445889*775554446***************9997779****************9988777666655555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1174 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 178.30 // Query: AXE76297.1|CBM13|GH30_5 [L=678] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-18 51.7 7.0 7e-18 51.7 7.0 2.5 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.8 0.8 0.74 0.74 125 135 .. 145 155 .. 138 164 .. 0.56 2 ? -3.1 0.0 0.44 0.44 149 174 .. 281 306 .. 269 311 .. 0.75 3 ! 51.7 7.0 7e-18 7e-18 5 136 .. 540 676 .. 535 678 .] 0.82 Alignments for each domain: == domain 1 score: -3.8 bits; conditional E-value: 0.74 CBM13.hmm 125 gganQqWsvlk 135 +a Q+W v + AXE76297.1|CBM13|GH30_5 145 ADATQRWWVNR 155 34445554444 PP == domain 2 score: -3.1 bits; conditional E-value: 0.44 CBM13.hmm 149 pdgnnnilntqlpnivvlskNlesal 174 + n i++t+ ++ + kNl +++ AXE76297.1|CBM13|GH30_5 281 DETNPGIFSTNWNSYPADVKNLVGQM 306 45566799999999999999999887 PP == domain 3 score: 51.7 bits; conditional E-value: 7e-18 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg........tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +ty+l++v+sgk l + +++g+++++ + ++a+ qW+l++ + ++++ +++sgk L v +ga+v+ + +g AXE76297.1|CBM13|GH30_5 540 HTYELTGVQSGKDL-TVADDGSKLVIKTGASAAGRQWQLQQISgddadnrkRYMFISASSGKRLAV-----RNGAPVVEPD-TGRr 618 6899********88.3447888877677344677999999555566677889999999999***98.....5888885555.4556 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 a+ qW +s+g+g+++++n+ +gk L+v g+ +dg+ v++w+ n+ganQ W+ +++ AXE76297.1|CBM13|GH30_5 619 dAATQWITSSTGDGTWTLVNAGTGKLLEVGGQatNDGAAVTTWQPNSGANQLWKATDV 676 68899***************999*******989777*****************88765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (678 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 54.88 // Query: AXA96358.1|CBM13|GH30_5 [L=1362] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-17 50.5 0.4 1.7e-17 50.5 0.4 2.2 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.8 0.5 0.35 0.35 123 136 .. 155 168 .. 98 180 .. 0.64 2 ! 50.5 0.4 1.7e-17 1.7e-17 6 147 .. 576 725 .. 571 741 .. 0.67 Alignments for each domain: == domain 1 score: -2.8 bits; conditional E-value: 0.35 CBM13.hmm 123 cngganQqWsvlks 136 +n +a Q+W +++ AXA96358.1|CBM13|GH30_5 155 WNADATQRWWIEAL 168 22344455544444 PP == domain 2 score: 50.5 bits; conditional E-value: 1.7e-17 CBM13.hmm 6 tyrlvnvnsgkclggstaaga..nvqlwdccn.gan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn. 79 y+l +v+sgk l t +g+ +++ ++ + +a Q+Wt ts + ++ l+ + +g+ L ++g+++++ + + AXA96358.1|CBM13|GH30_5 576 AYQLLGVQSGKAL---TVQGSalTIRSAATTAdAATaQTWTATSLTgagsdrqRVLLRAA-DGRYLA------SSGTNLTVISATp 651 69999********...444442223333323234555******77656655433333333.356666......3444443333321 PP CBM13.hmm 80 ..gg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekv 147 + ++ qW ++ +++ + + n+as ++Ldv+g+ adgt v +w+ n+ganQ W++ +++++ ++++ AXA96358.1|CBM13|GH30_5 652 eqAAtnPAAQWMPTTLDGRGFSLLNVASTRVLDVNGAgtADGTSVGLWTSNNGANQAWTLAPTAVQSVPDVTTT 725 1122335678*997665666***************8899*******************9988877776655555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1362 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 153.99 // Query: QTU66926.1|CBM13|GH30_5 [L=1049] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-21 64.2 0.0 1.1e-21 64.2 0.0 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.6 4.8 1 1 121 140 .. 130 149 .. 120 158 .. 0.66 2 ! 64.2 0.0 1.1e-21 1.1e-21 6 156 .. 525 681 .. 520 693 .. 0.85 Alignments for each domain: == domain 1 score: -4.6 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlksdlki 140 wd+n ++ Q+W v ++++ki QTU66926.1|CBM13|GH30_5 130 WDWNADQGQRWWVDQVKDKI 149 66666666666555555544 PP == domain 2 score: 64.2 bits; conditional E-value: 1.1e-21 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 +yrl++ +sgk + +g++v+l++ + +++ Q W++++ + +++l+n+++g L v ++ +v +++g QTU66926.1|CBM13|GH30_5 525 VYRLQGTQSGKSF-APSPDGTGVVLRTTDAASArQLWSVEQLTsgtgnreRYTLTNADTGGRLAV-----RDNQAVLEEARTGEvp 604 699999*****99.45578999**9995555555******76666778899*******7568887.....3566677778888899 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgnnnil 156 a+ qW +++g+g+++++n+a+g+ Ldv+g+ adg++v +++ +++anQ W+v+++++ ++++ae++++ g + +l QTU66926.1|CBM13|GH30_5 605 AAAQWLMSTTGDGSWTLVNAATGRLLDVTGQssADGAKVSTYTPTSAANQLWAVSDETVLSTERAEAFTVPGLRPKL 681 8899*************************989999*******************************99998877666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1049 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 146.00 // Query: QHF21831.1|CBM13|GH30_5 [L=1222] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-17 50.8 1.3 1.4e-17 50.8 1.3 2.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.4 0.4 0.55 0.55 121 135 .. 151 165 .. 129 181 .. 0.62 2 ! 50.8 1.3 1.4e-17 1.4e-17 5 137 .. 582 725 .. 579 743 .. 0.74 Alignments for each domain: == domain 1 score: -3.4 bits; conditional E-value: 0.55 CBM13.hmm 121 wdcngganQqWsvlk 135 +d++ + Q+W v++ QHF21831.1|CBM13|GH30_5 151 YDWTADETQRWWVER 165 344444445553333 PP == domain 2 score: 50.8 bits; conditional E-value: 1.4e-17 CBM13.hmm 5 gtyrlvnvnsgkcl..ggstaagan.vqlwdccn..ganQqWtltsdg......tirlenhq.sgkcLdvaasstaagaevqqytc 78 ++y+lv+ +sgk l + s+aa+ + l++ ++ +a+Q+Wt++ + t r++ ++ +g++L + t+ag+ ++ + QHF21831.1|CBM13|GH30_5 582 HRYQLVGTQSGKALtgNPSGAAT-TiTGLAT-DSatAAKQTWTVREVAagereaTRRVVLVNgDGRVLGA----TTAGTDLRSLSV 661 589***********633333444.4366666.4333566******776678888556666664489**94....456666655554 PP CBM13.hmm 79 ngg...anQqWrlesvgsgyykirnras.gkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 + + a+ +W ++++++ ++ ++n +s + Ldv+gg ad + v +++ ngganQ+Ws+ + + QHF21831.1|CBM13|GH30_5 662 DAAkttAATRWIVNTTDGANFSLVN-ESiAQSLDVNGGssADNASVGVYTSNGGANQRWSLRDLA 725 322344899****9887778*****.8879******9999999****************987654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1222 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 161.52 // Query: AXE90864.1|CBM13|GH30_5 [L=1056] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-19 55.4 0.0 5.2e-19 55.4 0.0 2.4 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.8 5.0 0.37 0.37 121 137 .. 141 157 .. 131 169 .. 0.66 2 ! 55.4 0.0 5.2e-19 5.2e-19 5 152 .. 535 684 .. 531 694 .. 0.85 Alignments for each domain: == domain 1 score: -2.8 bits; conditional E-value: 0.37 CBM13.hmm 121 wdcngganQqWsvlksd 137 wd++ +anQ+W v +++ AXE90864.1|CBM13|GH30_5 141 WDWSADANQRWWVDQVK 157 66666666776444443 PP == domain 2 score: 55.4 bits; conditional E-value: 5.2e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.gan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg 81 ++yrl++++sgk l + +a+g++v++++ ++ +a+ Q W++++ + ++ l+n+++g+ L v ++ +v q + ++ AXE90864.1|CBM13|GH30_5 535 HVYRLQGAQSGKSL-APAADGDGVVVRT-NDpAAKsQLWSVKRLTrgegnrdRYALVNASDGRRLAV-----RDNEAVLQEA--DA 611 5799**********.6668999999999.6566666******655557788899*****98999*98.....4556677777..57 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgn 152 ++ qW +++g+g+++++n+a+g+ Ldv g+ adg++v +++anQ+W v+++++ ++ a+++++ g+ AXE90864.1|CBM13|GH30_5 612 PAAQWIMSTTGDGTWTFVNAATGRLLDVVGQstADGARVSAFLPTSAANQRWGVTDETVLRTQPAKAFTVPGH 684 7788*************************9899*******999999************999999888887765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1056 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 145.03 // Query: QGV82400.1|CBM13|GH30_5 [L=835] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-63 199.8 29.5 1e-28 87.1 4.7 4.3 4 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 2.2 0.9 0.01 0.01 119 146 .. 151 178 .. 143 198 .. 0.72 2 ! 61.3 4.6 8.3e-21 8.3e-21 7 135 .. 560 694 .. 555 698 .. 0.85 3 ! 81.0 4.4 7.4e-27 7.4e-27 20 115 .. 669 769 .. 667 769 .. 0.89 4 ! 87.1 4.7 1e-28 1e-28 47 130 .. 746 831 .. 744 833 .. 0.95 Alignments for each domain: == domain 1 score: 2.2 bits; conditional E-value: 0.01 CBM13.hmm 119 qqwdcngganQqWsvlksdlkikliaek 146 + w+ n +anQ+W +++++++ ++ +e+ QGV82400.1|CBM13|GH30_5 151 KHWKPNADANQRWWLKAAKDRGANGFEA 178 5688888888888666666665555555 PP == domain 2 score: 61.3 bits; conditional E-value: 8.3e-21 CBM13.hmm 7 yrlvnvnsgkclggstaagan.vqlwdccn.ganQqWtltsdg........tirlenhqsgkcLdvaasstaagaevqqytcngga 82 ++ n nsg+ l+ +t+ g + +++++ + +++QqWt+t+ + t+rl+n++sgk+L+ + + +++ + ++a QGV82400.1|CBM13|GH30_5 560 RQILNDNSGMALAVETTGGRTtLVQRAPNPaDTAQQWTFTRSSagdwsstaTHRLTNVRSGKALS------LNRGVLTLVDAGSSA 639 58999*******8778777644777775533455******76667888889*************9......378899999985569 PP CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlk 135 +Q+W l+++g+g ++++nra+g Ldv+ g +dg+ v ++ ++g+nQ W++ QGV82400.1|CBM13|GH30_5 640 QQRWMLSTTGDGHHTVINRATGELLDVAHGstTDGASVGVHRPTTGSNQSWTFRS 694 99**************************777999*****************9865 PP == domain 3 score: 81.0 bits; conditional E-value: 7.4e-27 CBM13.hmm 20 gstaaganvqlwdccnganQqWtltsdg...tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnra 102 gst++ga+v +++ ++g+nQ Wt++s+g +l+ ++sgkcLdv++ sta+ga+v qy+cngg+nQqW+l + + g+++++ r+ QGV82400.1|CBM13|GH30_5 669 GSTTDGASVGVHRPTTGSNQSWTFRSAGgdpWKTLTMRHSGKCLDVSNASTADGASVFQYACNGGTNQQWELRPASAGQVQVVARH 754 6889999999999776899********99*75566666699******8888*********************************** PP CBM13.hmm 103 sgkcLdvkgg..adg 115 sgkcLdv+++ adg QGV82400.1|CBM13|GH30_5 755 SGKCLDVSNAstADG 769 ********7676665 PP == domain 4 score: 87.1 bits; conditional E-value: 1e-28 CBM13.hmm 47 gtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQq 130 g+++++ ++sgkcLdv++ sta+ga+v qy+cngganQ W + + g+gy++++ r+sgkcLd+ g+ adg+ v+q++cngg+nQq QGV82400.1|CBM13|GH30_5 746 GQVQVVARHSGKCLDVSNASTADGASVFQYACNGGANQLWSVRTGGDGYVTLVARHSGKCLDIGGAatADGAAVTQYACNGGTNQQ 831 6789999999*******8888*********************9999******************999999***************8 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (835 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 38.34 // Query: ANS70108.1|CBM13|GH30_5 [L=679] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-20 58.8 7.1 4.5e-20 58.8 7.1 3.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.7 0.21 0.21 121 138 .. 139 156 .. 132 175 .. 0.69 2 ! 58.8 7.1 4.5e-20 4.5e-20 6 140 .. 539 677 .. 534 679 .] 0.80 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.21 CBM13.hmm 121 wdcngganQqWsvlksdl 138 w n +a Q+W v + ++ ANS70108.1|CBM13|GH30_5 139 WNKNADATQRWWVDRIKK 156 444555566665554444 PP == domain 2 score: 58.8 bits; conditional E-value: 4.5e-20 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccnganQqWtlt....sdg....tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 y+l++v+sgk + + +a+g+n+++ + +++++QqW+lt + ++++ n gk L v ++ +v + t++g ANS70108.1|CBM13|GH30_5 539 DYTLTGVQSGKAV-TVAANGTNLVIGTGNGSTAQQWQLTgrygE-TgsrqRYEFSNPAEGKRLAV-----RDNVPV-IETDTGErd 616 699********99.5559999977777344666******55552.0577799**999999***98.....355555.555556666 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlki 140 a+ W l+++g+g+++++n+++g+ L+v g+ + g+ v++w+ n+g+nQ+W+++++++ + ANS70108.1|CBM13|GH30_5 617 AAAEWILSTTGDGTWTLVNASTGRLLEVGGQatGEGAAVTTWQPNSGSNQRWTITDVTAAS 677 8899***************777*******8876669******************9988655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (679 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 53.86 // Query: QHF22993.1|CBM13|GH30_5 [L=1227] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.5e-19 54.9 0.9 7.5e-19 54.9 0.9 2.7 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.3 0.8 0.04 0.04 96 140 .. 136 178 .. 103 196 .. 0.65 2 ! 54.9 0.9 7.5e-19 7.5e-19 5 137 .. 587 730 .. 584 746 .. 0.74 3 ? -3.4 0.6 0.57 0.57 70 74 .. 955 959 .. 919 1001 .. 0.52 Alignments for each domain: == domain 1 score: 0.3 bits; conditional E-value: 0.04 CBM13.hmm 96 ykirnras.gkcLdvkggadgtpvqqwdcngganQqWsvlksdlki 140 ++ +n+a+ + L + + + +d++++ Q+W v+k + ++ QHF22993.1|CBM13|GH30_5 136 GTSTNYADrDALLAKW---NAGDASSYDWTSDETQRWWVEKLAEEK 178 4556666644555555...334566788888888888666655444 PP == domain 2 score: 54.9 bits; conditional E-value: 7.5e-19 CBM13.hmm 5 gtyrlvnvnsgkcl.ggstaagan.vqlwdccn.ganQqWtltsdg........tirlenhqs.gkcLdvaasstaagaevqqytc 78 ++y+lv+ +sgk l g+ t a ++ +l++ + +a+Q Wt++ + +++l++ s g++L +t+ag+ ++ + QHF22993.1|CBM13|GH30_5 587 HRYQLVGTQSGKALtGNPTGAATTiTTLATDSTaAAKQSWTVREVApgereatrRVMLQS--SdGRVLG----ATSAGTDLRTLSV 666 589***********76666666664667773454555******77777888533444444..4479**9....5688888888887 PP CBM13.hmm 79 ngg...anQqWrlesvgsgy.ykirnras.gkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 + + a+ +W ++++ +g+ y+++n +s g+ Ldv+g+ + t v ++ ngganQ W+ + + QHF22993.1|CBM13|GH30_5 667 DAAkadAATRWIVSTT-DGTaYTLVN-ESiGLSLDVNGQssTENTAVGVYGSNGGANQSWTPRDLA 730 444556789***9877.5555*****.888*******88754479***************866555 PP == domain 3 score: -3.4 bits; conditional E-value: 0.57 CBM13.hmm 70 gaevq 74 + +vq QHF22993.1|CBM13|GH30_5 955 QVSVQ 959 22222 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1227 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.06 // Query: BCJ62685.1|CBM13|GH30_5 [L=694] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.3e-22 64.9 1.3 6.3e-22 64.9 1.3 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.1 0.43 0.43 77 89 .. 162 174 .. 154 182 .. 0.57 2 ! 64.9 1.3 6.3e-22 6.3e-22 5 134 .. 560 692 .. 556 694 .] 0.85 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.43 CBM13.hmm 77 tcngganQqWrle 89 ++ +++Q+W++e BCJ62685.1|CBM13|GH30_5 162 NDAADPAQRWWVE 174 3222345666554 PP == domain 2 score: 64.9 bits; conditional E-value: 6.3e-22 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngga 82 +tyrl++v+sg+ l ta+g++v++++ +++Q W++t+ + ++++ + +++ L v ++ga+++ t n g+ BCJ62685.1|CBM13|GH30_5 560 RTYRLQGVQSGRSL---TASGSGVVIRTDAAtDTGQSWRITRLTggydnraRYTVGTAAGDRHLAVV----DQGAALVTATANPGP 638 689*********99...888888777773443677******66556666788888888855677752....6999******99999 PP CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvl 134 qW l+++g+g+y+++n+a+g+ Ldv+g+ +dg++v +w n+ganQ+W+++ BCJ62685.1|CBM13|GH30_5 639 TAQWLLSTTGDGTYTLVNVATGRLLDVAGQatGDGATVSTWLPNSGANQRWRIT 692 999*************************9889999****************987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (694 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 120.87 // Query: QDN92624.1|CBM13|GH30_5 [L=688] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-19 56.3 5.6 2.7e-19 56.3 5.6 3.0 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.7 4.1 1 1 121 139 .. 144 162 .. 121 172 .. 0.71 2 ? -2.5 0.0 0.29 0.29 137 177 .. 422 462 .. 417 470 .. 0.76 3 ! 56.3 5.6 2.7e-19 2.7e-19 5 137 .. 543 683 .. 539 687 .. 0.78 Alignments for each domain: == domain 1 score: -4.7 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlksdlk 139 w n +a Q+W v + +++ QDN92624.1|CBM13|GH30_5 144 WNSNADATQRWWVDRIKKD 162 5555566677755555544 PP == domain 2 score: -2.5 bits; conditional E-value: 0.29 CBM13.hmm 137 dlkikliaekvipdgnnnilntqlpnivvlskNlesalivg 177 + ++++ ++++i g++ i ++ + sk ++a +v QDN92624.1|CBM13|GH30_5 422 KFDTARNFTHYIKPGDRLIKTDDTSSAAAVSKSGNGATVVH 462 55677888899999999999999999988888888887665 PP == domain 3 score: 56.3 bits; conditional E-value: 2.7e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan..vqlwdccn..ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 +ty l++v+sgk l +++g + +++++ + ++Q+W+l++ + ++ ++n gk L v +ga+v + + QDN92624.1|CBM13|GH30_5 543 HTYSLTGVQSGKALT-VADDGGKlvIKTASTDAatVTGQRWQLRQISgqtgnrqRYVFTNPVEGKRLAV-----RDGAPVLEAD-T 621 6899**********3.3345554224444433343467******6655666878888888888899997.....5888885555.4 PP CBM13.hmm 80 gg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 g ++ qW +++g+g+++++n+a+g+ L+v g+ adg+ v++w+ n+g+nQ+W+v++++ QDN92624.1|CBM13|GH30_5 622 GPrdTATQWIMSTTGDGTWTLVNAATGRLLEVGGQatADGSAVTIWTPNSGSNQRWTVSDVT 683 55667789*************************889999*****************998876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (688 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 47.34 // Query: QYX78681.1|CBM13|GH30_5 [L=687] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-17 48.9 1.4 5e-17 48.9 1.4 2.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.5 3.2 1 1 121 138 .. 144 161 .. 133 169 .. 0.65 2 ! 48.9 1.4 5e-17 5e-17 5 136 .. 543 681 .. 539 685 .. 0.73 Alignments for each domain: == domain 1 score: -4.5 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlksdl 138 w n +a Q+W v + ++ QYX78681.1|CBM13|GH30_5 144 WNKNADATQRWWVDRIKK 161 555556666665555554 PP == domain 2 score: 48.9 bits; conditional E-value: 5e-17 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.gan.QqWtltsdg........tirlenhqsgkcLdvaasstaagaevqqytcng 80 +ty++++v+s+k l + + +g+++++ + + ++n QqWtl++ g ++ l+ s+k L + +++++ ++ QYX78681.1|CBM13|GH30_5 543 HTYTFTGVQSSKNL-SVGPDGKSLVIKTPSTaAGNtQQWTLDRIGkgktdnrtRYALTETTSHKRLAI------RFGSLVAERDTA 621 68999999999988.444888886666657667778******98843444444444444444444443......333344444333 PP CBM13.hmm 81 g..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 + + qW l+s+g+g+++++n+a+g dv g+ +dg+ v +w+ n+g nQ+W+++++ QYX78681.1|CBM13|GH30_5 622 TrdEAAQWILSSTGDGTWTLVNVATGELPDVYGQstTDGAGVGVWTPNSGLNQRWKLTDV 681 3334568*************************989999*****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (687 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 144.96 // Query: QTU47347.1|CBM13|GH30_5 [L=684] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-19 56.7 3.2 2.1e-19 56.7 3.2 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -5.7 3.9 1 1 123 134 .. 146 157 .. 121 168 .. 0.60 2 ! 56.7 3.2 2.1e-19 2.1e-19 5 136 .. 543 680 .. 539 684 .] 0.81 Alignments for each domain: == domain 1 score: -5.7 bits; conditional E-value: 1 CBM13.hmm 123 cngganQqWsvl 134 + +a Q+W v QTU47347.1|CBM13|GH30_5 146 KDADATQRWWVD 157 222333444333 PP == domain 2 score: 56.7 bits; conditional E-value: 2.1e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdgtirlenhqsgkcLd.va.assta.agaevqqytcngg..anQ 84 +ty+l++v+sgk l + +a+g+++++ + + +a+Q+Wtl+++gt n+ +L+ +a + a g+++++ +++g+ ++ QTU47347.1|CBM13|GH30_5 543 HTYTLNGVQSGKNL-ALAADGKSLVIKNPNAaTAAQRWTLDRVGTGPTGNRTR-YVLTeAAsHKRLAvRGGSLVAEPDTGArdTAT 626 6899********99.67799999666665654566******999555555552.366633332222359*********99998788 PP CBM13.hmm 85 qWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 qW l+s+g+ +++++n a+g+ dv g+ +dg+ v +w n+g+nQ+W+++++ QTU47347.1|CBM13|GH30_5 627 QWILSSTGDSTWTLVNTATGQLADVGGQstNDGAGVGLWIPNSGTNQRWKLTDV 680 9*************************989777*****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (684 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 141.21 // Query: QHC60258.1|CBM13|GH30_5 [L=1226] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-19 54.7 0.7 8.4e-19 54.7 0.7 2.7 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.4 0.7 0.037 0.037 96 141 .. 136 179 .. 102 196 .. 0.66 2 ! 54.7 0.7 8.4e-19 8.4e-19 5 142 .. 587 735 .. 584 747 .. 0.74 3 ? -3.5 0.5 0.6 0.6 69 91 .. 954 977 .. 920 1003 .. 0.55 Alignments for each domain: == domain 1 score: 0.4 bits; conditional E-value: 0.037 CBM13.hmm 96 ykirnras.gkcLdvkggadgtpvqqwdcngganQqWsvlksdlkik 141 ++ +n+a+ + L + + + +d++++ Q+W v+k + +++ QHC60258.1|CBM13|GH30_5 136 GTSTNYADrDALLAKW---NAGDASSYDWSSDETQRWWVEKLAEEKQ 179 4556776644555555...3345677888888888886666554443 PP == domain 2 score: 54.7 bits; conditional E-value: 8.4e-19 CBM13.hmm 5 gtyrlvnvnsgkcl.ggstaagan.vqlwdccn.gan.QqWtltsdg......tirlenhq.s.gkcLdvaasstaagaevqqytc 78 ++y+lv+ +sgk l g+ t a ++ +l++ ++ +a+ Q Wt++ + t r + q + g++L +t+ag+ ++ + QHC60258.1|CBM13|GH30_5 587 HRYQLVGTQSGKALtGNPTGAATTiTTLAT-DSaAAAkQAWTVREVApgereaT-RRVVLQsTdGRVLG----ATGAGTDLRTLSV 666 589***********7666666666466777.5455555******8877788853.44444423489999....5678888888886 PP CBM13.hmm 79 ngg...anQqWrlesvgsgy.ykirnras.gkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikl 142 + + a+ +W ++++ +g+ y+++n +s g+ Ldv+g+ + t+v ++ ngganQ W++ + + ++++ QHC60258.1|CBM13|GH30_5 667 DAAkadAATRWIVSTT-DGTaYTLVN-ESiGLSLDVNGQssTENTTVGVYGSNGGANQSWTLRDLAPSAAQ 735 433555789***9877.5555*****.888*******8875447****************99877666554 PP == domain 3 score: -3.5 bits; conditional E-value: 0.6 CBM13.hmm 69 agaevqqytcnggan.QqWrlesv 91 ++ +vq + + g+++ Q ++l+ + QHC60258.1|CBM13|GH30_5 954 QQVSVQFQRDGGTSWaQSYQLQYQ 977 333333333322232133444444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1226 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 149.76 // Query: BCJ69078.1|CBM13 [L=188] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-24 72.9 0.1 4.1e-23 68.8 0.0 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 68.8 0.0 4.1e-23 4.1e-23 39 136 .. 44 150 .. 18 156 .. 0.81 2 ! 2.8 0.1 0.0072 0.0072 9 43 .. 152 186 .. 148 187 .. 0.64 Alignments for each domain: == domain 1 score: 68.8 bits; conditional E-value: 4.1e-23 CBM13.hmm 39 QqWtltsdgtirlenhqsgkcLd.vaasstaagaevqqytcngg..anQqWrlesvg.sgyykirnrasgkcLdvkgg...adgtpvqqwdcn 124 t++g + + n +gkc+d v a++ +g +v+qytc+++ +nQ+W ++ +++irn+ sg+c+d+ g a+gt ++q +c+ BCJ69078.1|CBM13 44 SIVDTTAAGPFNIYNPVTGKCMDlVGAGAGRPGDPVIQYTCDNTeaDNQRWYVDYRRgFSSFTIRNAKSGLCVDLPGTaapANGTALIQRTCT 136 5667788899999999999****66677767**********888999******76643448***************9899999*********5 PP CBM13.hmm 125 g..ganQqWsvlks 136 ++nQ + ++++ BCJ69078.1|CBM13 137 PspNDNQLFYFEDE 150 53477888877665 PP == domain 2 score: 2.8 bits; conditional E-value: 0.0072 CBM13.hmm 9 lvnvnsgkclggstaaganvqlwdccnganQqWtl 43 l+nv+ + c++g + +ga++ ++ c +++ +W+l BCJ69078.1|CBM13 152 LRNVKGDSCVAGADGNGATLGTYICLVADDHWWQL 186 56777777776666677777777743344577764 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (188 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 14.41 // Query: QCB92335.1|CBM13|GH30_5 [L=1399] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-14 41.1 0.0 3.3e-14 39.7 0.0 1.7 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.7 0.0 3.3e-14 3.3e-14 5 139 .. 588 734 .. 584 748 .. 0.73 Alignments for each domain: == domain 1 score: 39.7 bits; conditional E-value: 3.3e-14 CBM13.hmm 5 gtyrlvnvnsgkcl.ggst.aagan.vqlwdcc.ngan.QqWtltsdg......tirlenhqs.gkcLdvaasstaagaevqqytc 78 +ty+l++v+sgk l + t aa+a+ ++++ + ++ + Q Wt + + t r++ + s g++L + t+ag+ ++ t QCB92335.1|CBM13|GH30_5 588 HTYQLTGVQSGKALtA-ATgAATATtITTAGTTpEAVApQLWTAHEVPagrldgTRRFVLAASdGRVLGA----TTAGTDLRSTTV 668 589***********53.4435555436666645345555******5433466667788778754899994....456666655554 PP CBM13.hmm 79 ...ngganQqWrlesvgsgyykirnras.gkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlk 139 g+++ +W ++s++++++ ++n + g++L+v g+ a + v ++ ngganQ+W+ +++++ QCB92335.1|CBM13|GH30_5 669 eaaAGDPATRWIVSSTEGRTFAFVN-EGiGQALEVGGQstAENAGVGVYGSNGGANQRWTPRDVAAT 734 11136789********999******.555*******888866788**************87666554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1399 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 199.64 // Query: AEE47740.1|CBM13|GH30_5 [L=716] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-14 38.6 0.0 1.4e-13 37.6 0.0 1.4 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.6 0.0 1.4e-13 1.4e-13 9 133 .. 574 711 .. 568 715 .. 0.71 Alignments for each domain: == domain 1 score: 37.6 bits; conditional E-value: 1.4e-13 CBM13.hmm 9 lvnvnsgkcl.ggst..aaga.n.vq.lwdcc.n.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 + ++ g+ l +g +g + v+ +++ + + + +Q+Wtl++ + ++l+ + g L +t+ g++ ++ ++ AEE47740.1|CBM13|GH30_5 574 VLSADGGLALtAGPVvaGDGGpAvVTtVES-TaDaAPGQRWTLRTLSgagtnrrVVTLTDGD-GTLLA----ATDEGGTARVRPDA 653 556667777762222343333333332333.3244566******776677754444444444.56777....56789999999987 PP CBM13.hmm 80 gg..anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsv 133 g +QqW l++++++++ + ++a+g+ Ldv+ ad gt+v + + +++++Q W++ AEE47740.1|CBM13|GH30_5 654 AGpgRAQQWVLSTTDGRTWSLLSVATGRQLDVSRRsADpGTRVGLAPSTTDPQQAWTF 711 666779*****9998899***************779888*****************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (716 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 156.60 // Query: QHC71603.1|CBM13|GH30_5 [L=1224] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-16 47.8 1.9 1.1e-16 47.8 1.9 2.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.7 0.3 0.3 118 136 .. 150 168 .. 112 186 .. 0.60 2 ! 47.8 1.9 1.1e-16 1.1e-16 5 135 .. 584 725 .. 581 741 .. 0.75 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.3 CBM13.hmm 118 vqqwdcngganQqWsvlks 136 +d++ + Q+W v++ QHC71603.1|CBM13|GH30_5 150 PASYDWTADETQRWWVERL 168 3445555555566644443 PP == domain 2 score: 47.8 bits; conditional E-value: 1.1e-16 CBM13.hmm 5 gtyrlvnvnsgkcl..ggstaagan.vqlwdccn..ganQqWtltsdg......tirlenhq.sgkcLdvaasstaagaevqqytc 78 ++y+lv+ +sgk l + s+aa+ + l++ ++ +a+Q+Wt++ + t r++ ++ +g++L +t+ag+ ++ t QHC71603.1|CBM13|GH30_5 584 HRYQLVGTQSGKALtgNPSGAAT-TiTGLAT-DSatAAKQTWTVREVAagereaTRRVVLVNgDGRVLG----ATTAGTDLRSLTV 663 589***********633333444.4366666.4333566******776678888556666664489**9....4567777777776 PP CBM13.hmm 79 ngg...anQqWrlesvgsgyykirnras.gkcLdvkgg..adgtpvqqwdcngganQqWsvlk 135 + + a+ +W ++++++ ++ ++n +s + Ldv+gg ad + v +++ ngganQ Ws+ + QHC71603.1|CBM13|GH30_5 664 DAAkttAATRWIVNTTDGVNVSLVN-ESiAQSLDVNGGssADNASVGVYTSNGGANQSWSLRD 725 433455899****8886557*****.8879******9999999****************9866 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1224 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 151.46 // Query: QFQ98921.1|CBM13|GH30_5 [L=695] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-18 53.0 4.0 2.8e-18 53.0 4.0 2.2 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -5.3 2.8 1 1 123 136 .. 153 166 .. 142 175 .. 0.60 2 ? -1.9 0.1 0.2 0.2 136 176 .. 428 468 .. 419 474 .. 0.83 3 ! 53.0 4.0 2.8e-18 2.8e-18 5 137 .. 550 689 .. 546 695 .] 0.79 Alignments for each domain: == domain 1 score: -5.3 bits; conditional E-value: 1 CBM13.hmm 123 cngganQqWsvlks 136 + +a Q+W v + QFQ98921.1|CBM13|GH30_5 153 KDADATQRWWVDRI 166 33344555544444 PP == domain 2 score: -1.9 bits; conditional E-value: 0.2 CBM13.hmm 136 sdlkikliaekvipdgnnnilntqlpnivvlskNlesaliv 176 + ++++ ++++i g++ ++ +++ sk + a iv QFQ98921.1|CBM13|GH30_5 428 TKFDTARNFTHYIKPGDYLVKTNDENSTAAVSKHGNRATIV 468 55677888999999999999999999999999998888776 PP == domain 3 score: 53.0 bits; conditional E-value: 2.8e-18 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn..ganQqWtltsdgtirlenhqsgkcLd..vaassta.agaevqqytcngg..an 83 + y+l++v+s+k l + +a+g+++++ + + g++Q+Wt+++ g + +n+ +L+ v+++ a ++++++ +++g+ ++ QFQ98921.1|CBM13|GH30_5 550 HAYTLTGVQSSKNL-AIAADGKSINIKTPSTttGSGQRWTVDRIGNSEPDNRAR-YALTekVSGKRLAiRNGSLVAEPDTGTrdTA 633 57999999999999.555888877777766444566******999666666663.3555322244445678889999998888767 PP CBM13.hmm 84 QqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 qW l+++g+ +++++n+a+g+ dv g+ +dg+ v +w+ n+g+nQ+W++++++ QFQ98921.1|CBM13|GH30_5 634 AQWILSTTGDTTWTLVNAATGQLPDVYGQstNDGAGVGVWTPNSGYNQRWKLTDVT 689 89*************************999777*****************999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (695 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 94.50 // Query: AKL70722.1|CBM13|GH30_5 [L=679] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-23 69.7 0.6 1.1e-22 67.4 0.0 2.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.2 0.1 0.06 0.06 121 143 .. 158 180 .. 148 198 .. 0.65 2 ! 67.4 0.0 1.1e-22 1.1e-22 9 133 .. 545 675 .. 539 678 .. 0.83 Alignments for each domain: == domain 1 score: -0.2 bits; conditional E-value: 0.06 CBM13.hmm 121 wdcngganQqWsvlksdlkikli 143 wd + nQ+W +++++++ +++ AKL70722.1|CBM13|GH30_5 158 WDPYADGNQRWWLKAAKARGADT 180 44444556666555555555544 PP == domain 2 score: 67.4 bits; conditional E-value: 1.1e-22 CBM13.hmm 9 lvnvnsgkcl.ggstaaganvqlwdccn.ganQqWtltsdg........tirlenhqsgkcLdvaasstaagaevqqytcngganQ 84 lvn +sg+ l + s+ ag ++++++ ++ +a+QqW+lt+ ++r++n+ sg++L v a +++++ + +a+Q AKL70722.1|CBM13|GH30_5 545 LVNDHSGLALtAPSAGAGGTLVQHPPNRlDAAQQWNLTRSVpgdwsstaAYRVTNAGSGRALAV------ADGALTLLPPGPSAQQ 624 89********6555566667778887877888******44344555667*************97......345577777656699* PP CBM13.hmm 85 qWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsv 133 qW l+ g+g y+++n a+g Ldv+g+ adg+pv ++ n+g nQ W++ AKL70722.1|CBM13|GH30_5 625 QWMLSASGDGHYTLINSADGTLLDVTGAstADGAPVGTYRPNTGRNQSWTL 675 *****99*********999*******99999******************76 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (679 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 144.31 // Query: CBG71431.1|CBM13|GH30_5 [L=684] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-19 56.7 3.2 2.1e-19 56.7 3.2 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -5.7 3.9 1 1 123 134 .. 146 157 .. 121 168 .. 0.60 2 ! 56.7 3.2 2.1e-19 2.1e-19 5 136 .. 543 680 .. 539 684 .] 0.81 Alignments for each domain: == domain 1 score: -5.7 bits; conditional E-value: 1 CBM13.hmm 123 cngganQqWsvl 134 + +a Q+W v CBG71431.1|CBM13|GH30_5 146 KDADATQRWWVD 157 222333444333 PP == domain 2 score: 56.7 bits; conditional E-value: 2.1e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdgtirlenhqsgkcLd.va.assta.agaevqqytcngg..anQ 84 +ty+l++v+sgk l + +a+g+++++ + + +a+Q+Wtl+++gt n+ +L+ +a + a g+++++ +++g+ ++ CBG71431.1|CBM13|GH30_5 543 HTYTLNGVQSGKNL-ALAADGKSLVIKNPNAaTAAQRWTLDRVGTGPTGNRTR-YVLTeAAsHKRLAvRGGSLVAEPDTGArdTAT 626 6899********99.67799999666665654566******999555555552.366633332222359*********99998788 PP CBM13.hmm 85 qWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 qW l+s+g+ +++++n a+g+ dv g+ +dg+ v +w n+g+nQ+W+++++ CBG71431.1|CBM13|GH30_5 627 QWILSSTGDSTWTLVNTATGQLADVGGQstNDGAGVGLWIPNSGTNQRWKLTDV 680 9*************************989777*****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (684 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.39 // Query: CAB76325.1|CBM13|GH30_5 [L=691] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-13 36.5 10.6 1e-12 34.9 0.5 2.7 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.1 0.7 0.44 0.44 124 136 .. 145 157 .. 140 171 .. 0.57 2 ! 8.2 0.1 0.00015 0.00015 47 93 .. 540 596 .. 531 624 .. 0.69 3 ! 34.9 0.5 1e-12 1e-12 83 136 .. 633 688 .. 587 690 .. 0.86 Alignments for each domain: == domain 1 score: -3.1 bits; conditional E-value: 0.44 CBM13.hmm 124 ngganQqWsvlks 136 + +a Q+W v++ CAB76325.1|CBM13|GH30_5 145 DADATQRWWVERI 157 2244455544444 PP == domain 2 score: 8.2 bits; conditional E-value: 0.00015 CBM13.hmm 47 g.tirlenhqsgkcLdvaasstaagaevqqytcngga............nQqWrlesvg.s 93 g t++l+ +qsgk+++va a+g+++++ t +g++ + qWrl+ v + CAB76325.1|CBM13|GH30_5 540 GhTYTLTGVQSGKAVTVA----ADGTNLVLGTGTGTGtgtgtgtgtdpsARQWRLSAVRhD 596 347899999999999973....678888888875442233444445555788888777543 PP == domain 3 score: 34.9 bits; conditional E-value: 1e-12 CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 + W +s+g+g+++++n +g+ L+v g+ dg+ v++w+ n+ganQ+W+++++ CAB76325.1|CBM13|GH30_5 633 AAEWLASSTGDGTWTLVNSGTGRLLEVGGQatHDGAAVTTWPPNSGANQRWTLTDV 688 457***************999*******989777*****************99875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (691 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 51.28 // Query: AOX46304.1|CBM13|GH30_5 [L=1188] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.7e-14 39.2 0.0 1.5e-13 37.6 0.0 1.8 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.6 0.0 1.5e-13 1.5e-13 5 146 .. 574 722 .. 570 736 .. 0.70 Alignments for each domain: == domain 1 score: 37.6 bits; conditional E-value: 1.5e-13 CBM13.hmm 5 gtyrlvnvnsgkcl.ggstaaganvqlwdcc.n..gan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytc 78 +++lv+v+sg+ l g g+++++ + + +a Q Wt+++++ +++len + g+ L s +ga+ + t+ AOX46304.1|CBM13|GH30_5 574 DRVQLVGVQSGLALqG-----GSALTIDEDAaTpeAARaQGWTVRTVDgagtnrhRFTLENGD-GLFLG----S-RDGATALVDTD 648 6899**********43.....333222221112233444******776688887777787876.79998....2.35555555554 PP CBM13.hmm 79 ..ngg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaek 146 + + ++ qW ++ ++ +y + n+a ++Ldv g + g+ v +w+ ng+ nQ W++ ++ +++ + AOX46304.1|CBM13|GH30_5 649 paTAAadPATQWMGSTLDGSTYSVLNVAAERVLDVGGEsrEPGAGVGLWTSNGAGNQTWRLVSTTAVASDPVSV 722 21333446789*7755545569**************8787669****************998887766665555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1188 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 189.13 // Query: ANZ41165.1|CBM13|GH30_5 [L=661] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-19 55.5 0.1 9.7e-19 54.5 0.1 1.5 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 54.5 0.1 9.7e-19 9.7e-19 5 134 .. 524 653 .. 520 660 .. 0.75 Alignments for each domain: == domain 1 score: 54.5 bits; conditional E-value: 9.7e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn..ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg 81 g rl++v+sgk l + ag+++++++ ++ +a+Q W+l++ + ++ + n +g+ aa++ v++ + +g ANZ41165.1|CBM13|GH30_5 524 GDHRLIGVQSGKSL---APAGTSLVQRT-TDpaAADQVWRLERRTggydhraQFSIINFATGQRIA------AANGGVVLGSA-DG 598 6678999*****99...67888877777.4444566******876544333333333333222222......45556666665.78 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvl 134 ++ +W l+s+g+g+++++n+++g Ldv+g +dg+++ +++ ++ganQ+Ws + ANZ41165.1|CBM13|GH30_5 599 PAARWVLSSTGDGTWTFVNVQTGALLDVTGEsrEDGARIGLYQATSGANQRWSAT 653 889**************************878999*****************876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (661 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 153.74 // Query: QOV33441.1|CBM13|GH30_5 [L=694] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-19 55.3 1.8 5.6e-19 55.3 1.8 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.3 0.7 0.51 0.51 123 136 .. 147 160 .. 139 169 .. 0.56 2 ! 55.3 1.8 5.6e-19 5.6e-19 5 139 .. 544 683 .. 540 688 .. 0.79 Alignments for each domain: == domain 1 score: -3.3 bits; conditional E-value: 0.51 CBM13.hmm 123 cngganQqWsvlks 136 + +a Q+W v + QOV33441.1|CBM13|GH30_5 147 DKADATQRWWVDRI 160 22344455544444 PP == domain 2 score: 55.3 bits; conditional E-value: 5.6e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.gan.QqWtltsdg......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +tyrl++v+sgk l + +++g+++++ + + + + QqW+l++ ++ ++ + gk L v ++++++ ++ g QOV33441.1|CBM13|GH30_5 544 HTYRLTGVQSGKDL-TIADNGTGLVIKSADAaDPSgQQWRLKQIRghdnrkRYVFTEATEGKRLAV------REGALVAEPDRGRr 622 689*********88.344888886666655444555******654455667777777777788876......66777777776667 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlksdlk 139 ++ qW +++g+g+++++n+a+g+ dv+g+ ++ g+ v +w+ n+ganQ+W+v++++++ QOV33441.1|CBM13|GH30_5 623 dNAAQWIMSTTGDGTWTLVNAATGQLPDVAGQsTNeGAAVGVWQPNSGANQRWKVTDVTAD 683 55569*************************9996669******************998865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (694 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 149.75 // Query: BCW39489.1|CBM13|GH30_5|GH43_24 [L=1433] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-16 45.9 3.2 4.4e-16 45.9 3.2 2.4 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 45.9 3.2 4.4e-16 4.4e-16 5 141 .. 576 717 .. 572 759 .. 0.69 2 ? -3.1 0.2 0.44 0.44 107 127 .. 1117 1138 .. 1038 1144 .. 0.65 3 ? -3.5 0.1 0.59 0.59 9 42 .. 1341 1371 .. 1338 1397 .. 0.57 Alignments for each domain: == domain 1 score: 45.9 bits; conditional E-value: 4.4e-16 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan.vqlwdccnganQqWtlt....sdg....tirlenhqsgkcLdvaasstaagaev 73 ++y +v+v+sg+ + +++g++ +l d g+nQ W+ t dg ++ l+ + +g++L ++a+g+++ BCW39489.1|CBM13|GH30_5|GH43_24 576 QSYSFVGVQSGRAV--TASEGSPkTVLSDSIAGGNQVWKATliadEDGttrdRFVLRLA-DGRALA----ADANGTAL 646 67999*******99..4466665477777334699******887744466444444333.478998....66899999 PP CBM13.hmm 74 qqytcngg...anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlksdlkik 141 + t+ + ++ qW ++++++ ++ + n+ +g++Ldv+++ ++ g+ + +w+ ngganQ +++ +++ BCW39489.1|CBM13|GH30_5|GH43_24 647 RTITDEEArtdSSAQWLFSTTDGTSFSLLNAGQGQVLDVSNQsTHeGAWIGLWTSNGGANQAFTLRNASE--G 717 999986556555679***9886667*****888*******8895559***************97655443..3 PP == domain 2 score: -3.1 bits; conditional E-value: 0.44 CBM13.hmm 107 Ldvkgg.adgtpvqqwdcngga 127 ++v+++ ++ t+ ++w+ +g++ BCW39489.1|CBM13|GH30_5|GH43_24 1117 VTVTQNgQSSTQPVTWQVSGNT 1138 3444443444555555555544 PP == domain 3 score: -3.5 bits; conditional E-value: 0.59 CBM13.hmm 9 lvnvnsgkclggstaaganvqlwdccn.ganQqWt 42 ++ v+s kc++g+ + + ql + n +++ q t BCW39489.1|CBM13|GH30_5|GH43_24 1341 VTAVASTKCVAGKVTVT--AQLTN--NdTKSVQAT 1371 56677888882222211..22222..213333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1433 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 179.28 // Query: QVI65946.1|CBM13|GH30_5 [L=712] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-12 34.8 0.0 2.4e-12 33.6 0.0 1.6 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 33.6 0.0 2.4e-12 2.4e-12 24 134 .. 594 709 .. 575 712 .] 0.72 Alignments for each domain: == domain 1 score: 33.6 bits; conditional E-value: 2.4e-12 CBM13.hmm 24 aganvqlwdccnganQqWtltsdg....tirlenhq.s.gkcLdvaasstaagaevqqytcngg....anQqWrlesvgsgyykir 99 + ++v + +++a+Q Wtl++ + r++ + g L st +g++++ + g+ ++QqW l+s ++++y + QVI65946.1|CBM13|GH30_5 594 DATTVETP--DGSAGQMWTLHTLSgegtNRRVVALTdGtGAFLA----STEDGTALVPSDL-GTartaPAQQWVLNSIDGRTYSLL 672 33335543..45577******88766553444444432355555....5569999977775.44355579*****9888889**** PP CBM13.hmm 100 nrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvl 134 n+a+ + Ldv+ a gtpv + + +++++Q W+++ QVI65946.1|CBM13|GH30_5 673 NVATTRQLDVTRRsAEpGTPVALAPATTDPQQAWRFE 709 ***********778666*****************986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (712 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 166.86 // Query: AKG46275.1|CBM13|GH30_5 [L=677] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-21 63.8 0.6 1.4e-21 63.8 0.6 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -5.3 3.3 1 1 121 135 .. 138 152 .. 127 161 .. 0.59 2 ! 63.8 0.6 1.4e-21 1.4e-21 5 135 .. 539 674 .. 535 677 .] 0.83 Alignments for each domain: == domain 1 score: -5.3 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlk 135 w + +a Q+W v++ AKG46275.1|CBM13|GH30_5 138 WNEDADATQRWWVER 152 333334445554444 PP == domain 2 score: 63.8 bits; conditional E-value: 1.4e-21 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan.vqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +ty+l++v+sg+ l + +++g++ v+ + ++++Q Wtl++ + +++l +++++ L v +ga+v +++ g AKG46275.1|CBM13|GH30_5 539 HTYQLTGVQSGRAL-TVADDGTGaVISTAVAGDRDQIWTLSPYTkghdnrqQYTLGTRSGNQRLAV-----RDGAAVLEKDR-GRp 617 589***********.45588887577777555677******6555566778999999986689987.....59999999998.665 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlk 135 +W l+++g+g+y+++n+a+g+ L+v g+ ++ g+pv++w+ n+ganQ+W++++ AKG46275.1|CBM13|GH30_5 618 dEGARWILSTTGDGTYTLVNAATGRLLEVGGQaTHeGAPVTVWTPNSGANQRWTITD 674 5567**************************9885569****************9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (677 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 134.94 // Query: BBE21293.1|CBM13|GH30_5 [L=1061] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-19 57.4 0.0 3.2e-19 56.1 0.0 1.6 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 56.1 0.0 3.2e-19 3.2e-19 6 153 .. 547 695 .. 543 723 .. 0.81 Alignments for each domain: == domain 1 score: 56.1 bits; conditional E-value: 3.2e-19 CBM13.hmm 6 tyrlvnvnsgkclggstaagan.vqlwdccn.ganQqWtltsdg..tirlenhq.sgkcLdvaasstaagaevqqytcngg.anQq 85 +yrl++v+sgk + + +g++ v+ ++ ++ +a+Q +++ts g ++ + s Ld a++ ++ g++ ++ + g+ + BBE21293.1|CBM13|GH30_5 547 VYRLQGVQSGKSI---EPTGTTaVISAS-DSaDASQLFRFTSLGedN--SNRERySITTLDGASQLADEGGAAVVAPA-GTdPRAA 625 699********88...444554366666.554577********9542..33333343588877666567777777776.5537779 PP CBM13.hmm 86 WrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgnn 153 W +++g+g+y+++n+++g+ L+v gg a g+pv+++ n+ganQ+W++ ++++ +++ a+++++ g++ BBE21293.1|CBM13|GH30_5 626 WIASTTGDGTYTFVNAETGLLLEVGGGktAEGAPVTLYLANSGANQRWTLIDETVLSVQDATAFTVPGTA 695 ***999*********999*******999888*************************99999999888776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1061 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 185.18 // Query: BBJ48654.1|CBM13|GH30_5|GH42 [L=1407] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-21 62.3 6.5 3.9e-21 62.3 6.5 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.9 1.4 1 1 123 135 .. 861 873 .. 856 881 .. 0.53 2 ! 62.3 6.5 3.9e-21 3.9e-21 5 141 .. 1258 1401 .. 1255 1406 .. 0.84 Alignments for each domain: == domain 1 score: -4.9 bits; conditional E-value: 1 CBM13.hmm 123 cngganQqWsvlk 135 n +a Q+W v + BBJ48654.1|CBM13|GH30_5|GH42 861 PNADATQRWWVDR 873 3444445554433 PP == domain 2 score: 62.3 bits; conditional E-value: 3.9e-21 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdcc.n..ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaev 73 +ty+l++v+sgk l + +++g+++++++ + g++QqW++++ + ++ ++n gk L v +ga+v BBJ48654.1|CBM13|GH30_5|GH42 1258 HTYQLTGVQSGKAL-TVADDGTQLVIRTAGtDaaGTGQQWQVRQISgdtgnrqRYVFTNPAAGKRLAV-----RDGAPV 1330 589***********.5559999855455343464566******665566788899999999899**98.....69**** PP CBM13.hmm 74 qqytcngg.anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkik 141 ++ + ++ qW +++g+g+++++n+a+g+ L+v g+ +dg+ v++w+ n+g+nQ+Wsv+++++++ BBJ48654.1|CBM13|GH30_5|GH42 1331 LEADRGHRdKATQWIMSTTGDGTWTLVNAATGRLLEVGGQatTDGAAVTTWTPNSGSNQRWSVTDVTDQNG 1401 9999855567789*************************889999********************9998765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1407 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 201.02 // Query: AZS48804.1|CBM13|GH30_5|GH43_24 [L=1460] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-16 46.7 1.7 6.8e-11 28.9 0.1 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 28.9 0.1 6.8e-11 6.8e-11 5 140 .. 548 691 .. 544 697 .. 0.63 2 ! 26.8 0.1 2.9e-10 2.9e-10 25 93 .. 616 689 .. 594 728 .. 0.65 Alignments for each domain: == domain 1 score: 28.9 bits; conditional E-value: 6.8e-11 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdcc.n.ganQqWtlt..sdg......tirlenhqsgkcLdvaasstaagae 72 +ty++++v+sg l + ++ga + ++ + + Q+Wt + +d+ ++ l+ ++ g++L ++++ ++ AZS48804.1|CBM13|GH30_5|GH43_24 548 ETYTITGVQSGHAL-TASDDGALLGSAR-DpElIPVQTWTASliDDQpgtsrdRFALRAAD-GRALV----ADGDSTA 618 57888888888888.2223333233222.21222336666664422233333356666665.46775....3356677 PP CBM13.hmm 73 vqqytcngg...anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlksdlki 140 +++ ++ ++ ++ W +s+++ + + n+ g +Ldv g+ ++ g+ v +w+ n ganQ W+++ ++++i AZS48804.1|CBM13|GH30_5|GH43_24 619 LRVLDDASAatdPSALWMMTSTDGAEFSLLNAGRGAVLDVGGSsTSvGASVGVWQSNWGANQLWRLESARDDI 691 8888876555545778999888656699999777999999988855589999999877999999888777665 PP == domain 2 score: 26.8 bits; conditional E-value: 2.9e-10 CBM13.hmm 25 gan.vqlwdccn..ganQqWtltsdg..tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgs 93 +++ +l d + + W +ts++ ++ l n+ g +Ldv +sst+ ga+v +++ n ganQ Wrles + AZS48804.1|CBM13|GH30_5|GH43_24 616 STAlRVLDDASAatDPSALWMMTSTDgaEFSLLNAGRGAVLDVGGSSTSVGASVGVWQSNWGANQLWRLESARD 689 33323344433232344899999887688888888878999999888899999999999999999999988753 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1460 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 92.72 // Query: CED92153.1|CBM13|GH30_5 [L=1204] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-14 40.7 0.9 1.7e-14 40.7 0.9 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.2 0.41 0.41 69 89 .. 143 163 .. 129 171 .. 0.69 2 ! 40.7 0.9 1.7e-14 1.7e-14 5 137 .. 570 705 .. 567 763 .. 0.82 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.41 CBM13.hmm 69 agaevqqytcngganQqWrle 89 +g + y+ + +a Q+W+++ CED92153.1|CBM13|GH30_5 143 NGDDMNSYNLSADATQRWWID 163 666666666655677888774 PP == domain 2 score: 40.7 bits; conditional E-value: 1.7e-14 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdcc.n.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg 81 +ty++++v+sg+ l ta++ +v++ d + +anQ Wt+++ + +++l+n+ g++L + +g++v + +++ + CED92153.1|CBM13|GH30_5 570 HTYEVTGVQSGRSL---TAKNGGVVIDDFTpAdSANQLWTVHTLSgagtnqqRVTLTNRA-GQVLA-----DVDGTAVAAAPDTVS 646 5799999*****99...4444458989987645788******665566665677777777.56886.....34999******9877 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 ++ +W +++++++ + +++ +++v+g+ + g+++ +++ ngg+nQ+W+ + + CED92153.1|CBM13|GH30_5 647 eDSSTWIVTTTNGEDFSLVSTTRPVVVEVNGQaqSAGSRIGTYKSNGGSNQRWTARDIT 705 7999****9998888*****6669******9886669****************765544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1204 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 171.32 // Query: QTU55214.1|CBM13|GH30_5 [L=684] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-19 56.7 3.2 2.1e-19 56.7 3.2 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -5.7 3.9 1 1 123 134 .. 146 157 .. 121 168 .. 0.60 2 ! 56.7 3.2 2.1e-19 2.1e-19 5 136 .. 543 680 .. 539 684 .] 0.81 Alignments for each domain: == domain 1 score: -5.7 bits; conditional E-value: 1 CBM13.hmm 123 cngganQqWsvl 134 + +a Q+W v QTU55214.1|CBM13|GH30_5 146 KDADATQRWWVD 157 222333444333 PP == domain 2 score: 56.7 bits; conditional E-value: 2.1e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdgtirlenhqsgkcLd.va.assta.agaevqqytcngg..anQ 84 +ty+l++v+sgk l + +a+g+++++ + + +a+Q+Wtl+++gt n+ +L+ +a + a g+++++ +++g+ ++ QTU55214.1|CBM13|GH30_5 543 HTYTLNGVQSGKNL-ALAADGKSLVIKNPNAaTAAQRWTLDRVGTGPTGNRTR-YVLTeAAsHKRLAvRGGSLVAEPDTGArdTAT 626 6899********99.67799999666665654566******999555555552.366633332222359*********99998788 PP CBM13.hmm 85 qWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 qW l+s+g+ +++++n a+g+ dv g+ +dg+ v +w n+g+nQ+W+++++ QTU55214.1|CBM13|GH30_5 627 QWILSSTGDSTWTLVNTATGQLADVGGQstNDGAGVGLWIPNSGTNQRWKLTDV 680 9*************************989777*****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (684 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 132.23 // Query: QWI08562.1|CBM13|GH30_5 [L=978] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.4e-33 101.0 24.5 6e-24 71.5 10.4 3.7 4 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.1 1.8 0.023 0.023 121 150 .. 159 188 .. 147 201 .. 0.73 2 ? -0.2 0.8 0.059 0.059 144 172 .. 421 448 .. 353 471 .. 0.61 3 ! 44.5 6.1 1.1e-15 1.1e-15 38 133 .. 536 629 .. 509 631 .. 0.81 4 ! 71.5 10.4 6e-24 6e-24 4 152 .. 543 695 .. 540 710 .. 0.86 Alignments for each domain: == domain 1 score: 1.1 bits; conditional E-value: 0.023 CBM13.hmm 121 wdcngganQqWsvlksdlkikliaekvipd 150 w ++ +anQ+W +++++++ ++++e++ + QWI08562.1|CBM13|GH30_5 159 WNWSADANQRWWLQAAKARGVDTFEAFSNS 188 777778888887777777777777766555 PP == domain 2 score: -0.2 bits; conditional E-value: 0.059 CBM13.hmm 144 aekvipdgnnnilntqlpnivvlskNles 172 ++k+ + gn++++ + ++++v+ s+N++ QWI08562.1|CBM13|GH30_5 421 NKKYYTMGNYSKFIR-PGDQVINSNNQNT 448 333444444444432.3333444444432 PP == domain 3 score: 44.5 bits; conditional E-value: 1.1e-15 CBM13.hmm 38 nQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngg.anQqWrlesvgsg.....yykirnrasgkcLdvkggadgtp 117 n + t ++ +++ +++sgk+Ld + ++g +++q++++ + +QqW +++v +g yyki+ asg +L+v+ +g+ QWI08562.1|CBM13|GH30_5 536 NNIFLNT-HNKYKISSVNSGKVLD----KGQDGKSIVQKNYDRDkESQQWSIQKVTNGystkeYYKIVDTASGNVLGVE---NGSA 613 3444444.446*************....568*********8766699******9986666666****************...7999 PP CBM13.hmm 118 vqqwdcngganQqWsv 133 v q d+++++nQ+W++ QWI08562.1|CBM13|GH30_5 614 VEQKDDESTTNQKWML 629 **************86 PP == domain 4 score: 71.5 bits; conditional E-value: 6e-24 CBM13.hmm 4 egtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg 81 +++y++ +vnsgk+l ++++g+++++ ++++ + +QqW++++++ +++++ sg +L v +g++v q+++ ++ QWI08562.1|CBM13|GH30_5 543 HNKYKISSVNSGKVL-DKGQDGKSIVQKNYDRdKESQQWSIQKVTngystkeYYKIVDTASGNVLGV-----ENGSAVEQKDDEST 622 5789***********.45688999888887764566******77667888899***9999999**98.....6999******9899 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgn 152 +nQ+W l+++g++ y+++n++sg Ldv+gg + +pv +w+ n g+nQ W+v k+ +++ ++ ++++++ QWI08562.1|CBM13|GH30_5 623 TNQKWMLSTYGNQEYTLINAQSGNLLDVSGGstQEDAPVGVWKPNAGSNQVWKVVKAGIVEVEPVNVIVTKKK 695 *****************************9985558******************9999888888887777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (978 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 58.29 // Query: ANP71414.1|CBM13|GH30_5 [L=1431] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-17 48.5 0.2 2.8e-16 46.5 0.2 2.1 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.5 0.2 2.8e-16 2.8e-16 5 137 .. 575 720 .. 567 740 .. 0.78 Alignments for each domain: == domain 1 score: 46.5 bits; conditional E-value: 2.8e-16 CBM13.hmm 5 gtyrlvnvnsgkcl..ggst.aaga.n.vqlwdccn.ganQqWtltsdg.....tirlenhq.sgkcLdvaasstaagaevqqytc 78 +tyr+v+++sgk l ++ t ++ a + +l++ ++ ++Q Wt ++++ t r++ ++ sg +L ++++g+ ++ t+ ANP71414.1|CBM13|GH30_5 575 HTYRVVGAQSGKALtaKATTgSNPAaAiTTLATSTGtVGAQLWTAEKVTggdsnTERFVLRSaSGTALA----ANGSGTLLVESTR 656 689***********86333344444454667775564566******88668889666666665788999....4568999999998 PP CBM13.hmm 79 ngg...anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 + ++QqW +++++ ++ ++n a +L+v g+ + g+ v +++ ngganQ Ws+++ + ANP71414.1|CBM13|GH30_5 657 EAAaadPAQQWIPTTTDGSNWSLVNGALPVALEVPGQstTEGAAVNVYASNGGANQTWSFQDTA 720 65555569***999886667*****6669******989777*****************998766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1431 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 167.53 // Query: QHC64339.1|CBM13|GH30_5 [L=1227] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-19 57.0 0.8 1.6e-19 57.0 0.8 2.8 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.3 0.8 0.04 0.04 96 140 .. 136 178 .. 103 196 .. 0.65 2 ! 57.0 0.8 1.6e-19 1.6e-19 5 142 .. 587 735 .. 584 747 .. 0.75 3 ? -2.8 0.7 0.35 0.35 69 90 .. 954 976 .. 919 1005 .. 0.53 Alignments for each domain: == domain 1 score: 0.3 bits; conditional E-value: 0.04 CBM13.hmm 96 ykirnras.gkcLdvkggadgtpvqqwdcngganQqWsvlksdlki 140 ++ +n+a+ + L + + + +d++++ Q+W v+k + ++ QHC64339.1|CBM13|GH30_5 136 GTSTNYADrDALLAKW---NAGDASSYDWTSDETQRWWVEKLAEEK 178 4556666644555555...334566788888888888666655444 PP == domain 2 score: 57.0 bits; conditional E-value: 1.6e-19 CBM13.hmm 5 gtyrlvnvnsgkcl.ggstaagan.vqlwdccn.ganQqWtltsdg.....tirlenhq.s.gkcLdvaasstaagaevqqytcng 80 ++y+lv+ +sgk l g+ t a ++ +l++ + +a+Q Wt++ + + r + q s g++L +t+ag+ ++ + + QHC64339.1|CBM13|GH30_5 587 HRYQLVGTQSGKALtGNPTGAATTiTTLATDSTaAAKQSWTVREVApgereATRRVVLQsSdGRVLG----ATSAGTDLRTLSVDA 668 589***********76666666664667773454555******887778884444444435589**9....568888888888744 PP CBM13.hmm 81 g...anQqWrlesvgsgy.ykirnras.gkcLdvkgg.ad.gtpvqqwdcngganQqWsvlksdlkikl 142 + a+ +W ++++ +g+ y+++n +s g+ Ldv+g+ ++ t v ++ ngganQ W++ + + ++++ QHC64339.1|CBM13|GH30_5 669 AkadAATRWIVSTT-DGTaYTLVN-ESiGLSLDVNGQsSSeNTAVGVYGSNGGANQSWTLRDLAPSAAQ 735 4556789***9877.5555*****.888*******9885537****************99877666554 PP == domain 3 score: -2.8 bits; conditional E-value: 0.35 CBM13.hmm 69 agaevqqytcnggan.QqWrles 90 ++a+vq + + g+++ Q ++l+ QHC64339.1|CBM13|GH30_5 954 QQASVQFQRDGGTSWaQSYQLQY 976 33333333332222213333333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1227 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 134.75 // Query: QTU63319.1|CBM13|GH30_5 [L=684] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-19 56.7 3.2 2.1e-19 56.7 3.2 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -5.7 3.9 1 1 123 134 .. 146 157 .. 121 168 .. 0.60 2 ! 56.7 3.2 2.1e-19 2.1e-19 5 136 .. 543 680 .. 539 684 .] 0.81 Alignments for each domain: == domain 1 score: -5.7 bits; conditional E-value: 1 CBM13.hmm 123 cngganQqWsvl 134 + +a Q+W v QTU63319.1|CBM13|GH30_5 146 KDADATQRWWVD 157 222333444333 PP == domain 2 score: 56.7 bits; conditional E-value: 2.1e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdgtirlenhqsgkcLd.va.assta.agaevqqytcngg..anQ 84 +ty+l++v+sgk l + +a+g+++++ + + +a+Q+Wtl+++gt n+ +L+ +a + a g+++++ +++g+ ++ QTU63319.1|CBM13|GH30_5 543 HTYTLNGVQSGKNL-ALAADGKSLVIKNPNAaTAAQRWTLDRVGTGPTGNRTR-YVLTeAAsHKRLAvRGGSLVAEPDTGArdTAT 626 6899********99.67799999666665654566******999555555552.366633332222359*********99998788 PP CBM13.hmm 85 qWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 qW l+s+g+ +++++n a+g+ dv g+ +dg+ v +w n+g+nQ+W+++++ QTU63319.1|CBM13|GH30_5 627 QWILSSTGDSTWTLVNTATGQLADVGGQstNDGAGVGLWIPNSGTNQRWKLTDV 680 9*************************989777*****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (684 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 119.15 // Query: QNF28725.1|CBM13|CBM71|GH30_5 [L=1065] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-21 64.2 2.3 1e-21 64.2 2.3 3.8 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.4 0.9 0.067 0.067 121 148 .. 156 183 .. 142 206 .. 0.73 2 ! 2.4 1.0 0.009 0.009 94 175 .. 433 513 .. 375 517 .. 0.76 3 ! 64.2 2.3 1e-21 1e-21 4 152 .. 539 690 .. 536 713 .. 0.83 Alignments for each domain: == domain 1 score: -0.4 bits; conditional E-value: 0.067 CBM13.hmm 121 wdcngganQqWsvlksdlkikliaekvi 148 w + +anQ+W v++++++ ++++e++ QNF28725.1|CBM13|CBM71|GH30_5 156 WNLEADANQRWWVSAAKARGADTFEAFS 183 4445567788877777777776666655 PP == domain 2 score: 2.4 bits; conditional E-value: 0.009 CBM13.hmm 94 gyykirnrasgkcLdvkggadgtpvqqwdcngganQqWsvlksdlkikliaekvipdgnnnilntqlpnivvlskNlesa 173 g y+++n +s L + +++d + v++++++++ ++ s ++++ + k++p + + n ++v+ s N sa QNF28725.1|CBM13|CBM71|GH30_5 433 G-YQVINSNSSDTLAAINKDDNSVVVVYTNSTTEEKAINFDLSGFDTVEANAKATPYVTSTTENLAQKSDVMISGNELSA 511 3.566676776666666456677899999888888888888899999999999999999999999999999999998888 PP CBM13.hmm 174 li 175 ++ QNF28725.1|CBM13|CBM71|GH30_5 512 VV 513 76 PP == domain 3 score: 64.2 bits; conditional E-value: 1e-21 CBM13.hmm 4 egtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqq 75 ++ty+++n+nsgk+l +++g+++++ + + +Q++++++ + +++ n +sg +L+ + ++++++ QNF28725.1|CBM13|CBM71|GH30_5 539 NETYKFINKNSGKVL-DIGQDGKSIVQKTNIRdEEKQNFSIQKITdgnstkeIYKIANSDSGSVLS------DENGSITL 611 579************.34488888666773353566******444447778889999999999**9......67777888 PP CBM13.hmm 76 ytcngganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgn 152 +++ +++nQ+W l+++g+g y+++n++sg ++v g + g++v +w+ ++g+ Q W++ k+ +++ + v+++++ QNF28725.1|CBM13|CBM71|GH30_5 612 QANENKSNQKWMLSTYGNGEYTFINVQSGNLIEVGGEskEEGAKVGLWKPTTGNHQIWRLVKAGIAKVEPVDVVVTKKK 690 887799*****************************878777********************999999988888777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1065 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 78.94 // Query: AXL92543.1|CBM13|GH30_5 [L=679] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-17 48.7 6.9 3.7e-13 36.3 0.3 2.8 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 0.3 0.31 0.31 124 136 .. 145 157 .. 136 172 .. 0.62 2 ! 15.5 0.0 9e-07 9e-07 47 94 .. 540 585 .. 516 613 .. 0.79 3 ! 36.3 0.3 3.7e-13 3.7e-13 84 135 .. 622 675 .. 606 678 .. 0.88 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.31 CBM13.hmm 124 ngganQqWsvlks 136 + +a Q+W v++ AXL92543.1|CBM13|GH30_5 145 DADATQRWWVERI 157 2244455544444 PP == domain 2 score: 15.5 bits; conditional E-value: 9e-07 CBM13.hmm 47 g.tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvg.sg 94 g t++l+ +qsgk+++v +a+g+++++ t ++++ qWrl+ v +g AXL92543.1|CBM13|GH30_5 540 GhTYTLTGVQSGKAVTV----AADGTNLVLGTGADASARQWRLSAVRhDG 585 34899999999999997....38999999999888888999998875544 PP == domain 3 score: 36.3 bits; conditional E-value: 3.7e-13 CBM13.hmm 84 QqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlk 135 W +s+g+g+++++n+a+g+ L+v g+ dg+ v++w+ n+ganQ+W++++ AXL92543.1|CBM13|GH30_5 622 AEWLASSTGDGTWTLVNAATGRLLEVGGQatHDGAAVTTWPPNSGANQRWTLTD 675 57*************************989777*****************9886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (679 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 51.61 // Query: AIV38162.1|CBM13|GH30_5 [L=679] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-16 46.4 8.6 4.6e-16 45.8 2.3 2.7 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.5 0.38 0.38 124 136 .. 145 157 .. 140 172 .. 0.58 2 ! 45.8 2.3 4.6e-16 4.6e-16 6 136 .. 542 676 .. 541 678 .. 0.76 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.38 CBM13.hmm 124 ngganQqWsvlks 136 + +a Q+W v++ AIV38162.1|CBM13|GH30_5 145 DADATQRWWVERI 157 2244455544444 PP == domain 2 score: 45.8 bits; conditional E-value: 4.6e-16 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg..a 82 ty+l++v+sgk + + + +g+n++l + ++++ qW+l+++ ++ ++++ +g L v + +v + +++g AIV38162.1|CBM13|GH30_5 542 TYTLTGVQSGKAV-TVAGNGTNLVLGTGADASAEQWRLSAVRqdggvrdRYVFTRAGDGTRLAV-----RDDVPV-AEPDTGRrdR 620 699********99.4558899999999445555******5554457777777777776677776.....233333.3333444544 PP CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlks 136 + W +s+g+g+++++n+a+g+ L+v g+ ++ g+ v++w+ n+ganQ+W+++++ AIV38162.1|CBM13|GH30_5 621 AAEWIASSTGDGTWTLVNAATGRLLEVGGQaTHaGAAVTTWPPNSGANQRWTLTDV 676 568*************************9885559****************99875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (679 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 52.89 // Query: QDO54886.1|CBM13|GH30_5 [L=688] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-19 56.3 5.6 2.7e-19 56.3 5.6 2.9 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 2.3 0.79 0.79 121 139 .. 144 162 .. 128 170 .. 0.69 2 ? -2.5 0.0 0.29 0.29 137 177 .. 422 462 .. 417 470 .. 0.76 3 ! 56.3 5.6 2.7e-19 2.7e-19 5 137 .. 543 683 .. 539 687 .. 0.78 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 0.79 CBM13.hmm 121 wdcngganQqWsvlksdlk 139 w n +a Q+W v + +++ QDO54886.1|CBM13|GH30_5 144 WNPNADATQRWWVDRIKKD 162 5555566677755555544 PP == domain 2 score: -2.5 bits; conditional E-value: 0.29 CBM13.hmm 137 dlkikliaekvipdgnnnilntqlpnivvlskNlesalivg 177 + ++++ ++++i g++ i ++ + sk ++a +v QDO54886.1|CBM13|GH30_5 422 KFDTARNFTHYIKPGDRLIKTDDTSSAAAVSKSGNGATVVH 462 55677888899999999999999999988888888887665 PP == domain 3 score: 56.3 bits; conditional E-value: 2.7e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan..vqlwdccn..ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 +ty l++v+sgk l +++g + +++++ + ++Q+W+l++ + ++ ++n gk L v +ga+v + + QDO54886.1|CBM13|GH30_5 543 HTYSLTGVQSGKALT-VADDGGKlvIKTASTDAatVTGQRWQLRQISgqtgnrqRYVFTNPVEGKRLAV-----RDGAPVLEAD-T 621 6899**********3.3345554224444433343467******6655666878888888888899997.....5888885555.4 PP CBM13.hmm 80 gg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 g ++ qW +++g+g+++++n+a+g+ L+v g+ adg+ v++w+ n+g+nQ+W+v++++ QDO54886.1|CBM13|GH30_5 622 GPrdTATQWIMSTTGDGTWTLVNAATGRLLEVGGQatADGSAVTIWTPNSGSNQRWTVSDVT 683 55667789*************************889999*****************998876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (688 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 49.25 // Query: QGQ18080.1|CBM13|GH30_5 [L=1390] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-13 35.8 0.0 1.6e-12 34.2 0.0 1.8 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 34.2 0.0 1.6e-12 1.6e-12 5 134 .. 581 722 .. 577 738 .. 0.70 Alignments for each domain: == domain 1 score: 34.2 bits; conditional E-value: 1.6e-12 CBM13.hmm 5 gtyrlvnvnsgkclggst.aagan.vqlwdccn.gan.QqWtltsdg........tirlenhqsgkcLdvaasstaagaevqqytc 78 +ty+l++v+sgk l + t a +a+ +++ + +a Q Wt +++ ++ l+ + +g++L + t ag+ ++ + QGQ18080.1|CBM13|GH30_5 581 HTYQLTGVQSGKALTAATgAPTATtITTPGATAeAARpQLWTAHAVApgrldgtkRFVLQAA-DGRVLGA----TRAGTDLRSVAV 661 589***********444424444435544434356677******776556666444444444.4678884....345666655554 PP CBM13.hmm 79 ngg...anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvl 134 + ++ +W ++s++ +++ ++n g++L+v g+ a + v ++ ngganQ+W QGQ18080.1|CBM13|GH30_5 662 EAAaaePQTRWIVSSTDARSFAFVNEGVGQALEVGGQstAENAGVGVYGSNGGANQRWYPR 722 3332325669******9********555*******888866788**************544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1390 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 207.10 // Query: ANN18019.1|CBM13|GH30_5 [L=665] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-20 59.9 1.1 2.1e-20 59.9 1.1 1.7 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.8 0.0 0.36 0.36 82 88 .. 141 147 .. 133 156 .. 0.63 2 ! 59.9 1.1 2.1e-20 2.1e-20 9 134 .. 536 663 .. 529 665 .] 0.84 Alignments for each domain: == domain 1 score: -2.8 bits; conditional E-value: 0.36 CBM13.hmm 82 anQqWrl 88 +nQ+W++ ANN18019.1|CBM13|GH30_5 141 PNQRWWV 147 4566655 PP == domain 2 score: 59.9 bits; conditional E-value: 2.1e-20 CBM13.hmm 9 lvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqyt.cngganQq 85 + +v+sgk l s+++ga vq ++ + +a+Q+Wtl + + ++++ n+ +g++L+ +ag++v++ + ++g++ + ANN18019.1|CBM13|GH30_5 536 FSGVQSGKSL--SAENGALVQ-RTTDAsAAAQRWTLADRTgrygnrdQFTISNAGTGQVLS------TAGGAVTLAPaGTDGPASR 612 5678899999..677777555.553543666******77668889999******9999**9......58999999994566699** PP CBM13.hmm 86 WrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvl 134 W +++g+g++ ++n+ +g+ Ldv+g +dg+++ +++ ++ganQ+W+ l ANN18019.1|CBM13|GH30_5 613 WMMSTTGDGTWAFVNVGTGQLLDVTGEsrEDGARIGLYQPTNGANQRWQAL 663 *************************878999*****************865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (665 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 146.58 // Query: ASO22033.1|CBM13|GH30_5 [L=683] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-17 48.2 0.3 2.3e-16 46.7 0.3 1.8 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.7 0.3 2.3e-16 2.3e-16 6 137 .. 540 678 .. 533 682 .. 0.72 Alignments for each domain: == domain 1 score: 46.7 bits; conditional E-value: 2.3e-16 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg..tirlenhqsgkcLdva..assta.agaevqqytcngg..anQ 84 yrl++++sg+ l + +a+g + ++ ++a+Q+W+lt++ + +++n+ +++ a a + ++ + +g ++ ASO22033.1|CBM13|GH30_5 540 DYRLIGAGSGRSL-TAAADGGGAEIRGSSDDAAQTWRLTRVAegAREFDNRTR-YVVTTAdgDRRLAlRADRAVLEDVDGPadPAA 623 699**********.3334444444444234478******87666556666652.36663222222235556667777755566578 PP CBM13.hmm 85 qWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 qW +++g+g+++++n+ g+ L+v+g dg+ v +w+ n+ga Q+W+v +++ ASO22033.1|CBM13|GH30_5 624 QWIGSTTGDGTWTLVNADAGLLLEVSGEatHDGAEVSVWTPNSGAHQRWQVVDES 678 9*999999********777*******888777*****************998776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (683 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 58.44 // Query: AXG76485.1|CBM13|GH30_5 [L=676] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-22 66.2 1.4 2.5e-22 66.2 1.4 2.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.3 4.3 1 1 121 136 .. 140 155 .. 117 168 .. 0.64 2 ! 66.2 1.4 2.5e-22 2.5e-22 6 135 .. 540 674 .. 536 676 .] 0.81 Alignments for each domain: == domain 1 score: -4.3 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlks 136 w n +a Q+W v ++ AXG76485.1|CBM13|GH30_5 140 WNANADATQRWWVNRV 155 4444444455533333 PP == domain 2 score: 66.2 bits; conditional E-value: 2.5e-22 CBM13.hmm 6 tyrlvnvnsgkclggst.aaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 t++l++v+sgk lg s+ a+g+ +++ d + +a+Q+W++++++ ++ l+n+ +g ++ +a+ga+v ++ +g AXG76485.1|CBM13|GH30_5 540 TFALTGVGSGKSLGVSDdATGTVIRTTD--TaDAGQRWQIEKVTkgtgnreRYVLRNAADGSRVT-----SANGAAVLEKD-TGRp 617 7899*********888744444466666..32488******776678888899999998665666.....37888886666.4666 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlk 135 ++ qW l+++g+g+y+++++a+g L+v+g+ a+g++v +w+ n+g+nQ+W+v++ AXG76485.1|CBM13|GH30_5 618 gTAAQWILSTTGDGTYTFVSAATGELLEVAGQstANGARVSVWKPNSGTNQRWTVTD 674 67789*************************989********************9985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (676 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 136.10 // Query: AGT88032.1|CBM13|GH30_5 [L=661] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-21 63.0 1.3 2.4e-21 63.0 1.3 2.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.2 0.12 0.12 81 101 .. 136 149 .. 123 156 .. 0.69 2 ! 63.0 1.3 2.4e-21 2.4e-21 7 132 .. 530 657 .. 526 660 .. 0.83 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.12 CBM13.hmm 81 ganQqWrlesvgsgyykirnr 101 ++nQ+W+l + ki+nr AGT88032.1|CBM13|GH30_5 136 DPNQRWWL--D-----KIKNR 149 36788877..3.....45554 PP == domain 2 score: 63.0 bits; conditional E-value: 2.4e-21 CBM13.hmm 7 yrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg..a 82 +++++v+sgk l s+++g+ vq ++ + +++Q+Wtlt+ + +++++n +g++L +ag++v++ + g + AGT88032.1|CBM13|GH30_5 530 VTFTGVQSGKSL--SAENGSLVQ-RTTDAsATAQRWTLTDRTgrygnrdRFTITNTGTGQVLA------TAGGAVTLAAA-GPcdP 605 6788999***99..667776455.553543666******776688888999999999899998......58999988885.55666 PP CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWs 132 + qW+l+++g+g+++++n+a+g+ Ldv+g adg+++ +++ ++g+nQ+W+ AGT88032.1|CBM13|GH30_5 606 AAQWTLSTTGDGTWTFVNAATGQLLDVTGEsrADGARIGLYKPTNGPNQRWQ 657 678*************************878********************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (661 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 143.67 // Query: QKW65065.1|CBM13|GH30_5 [L=680] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.7e-18 51.4 1.8 6.9e-16 45.2 2.0 2.5 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 14.5 0.1 1.7e-06 1.7e-06 46 92 .. 541 583 .. 518 609 .. 0.74 2 ! 45.2 2.0 6.9e-16 6.9e-16 5 136 .. 542 677 .. 539 679 .. 0.77 Alignments for each domain: == domain 1 score: 14.5 bits; conditional E-value: 1.7e-06 CBM13.hmm 46 dgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvg 92 +t++l+ +qsgk+++va ++g+++++ t ++++ qWrl+ v QKW65065.1|CBM13|GH30_5 541 GHTYTLTGVQSGKAVTVA----GDGTNLVLGTGADASAEQWRLSAVR 583 337778888877888862....5788888888777777778887664 PP == domain 2 score: 45.2 bits; conditional E-value: 6.9e-16 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 +ty+l++v+sgk + + + +g+n++l + ++++ qW+l+++ ++ +++ +g L v + +v + +++g QKW65065.1|CBM13|GH30_5 542 HTYTLTGVQSGKAV-TVAGDGTNLVLGTGADASAEQWRLSAVRqdggardRYVFTRPGDGTRLAV-----RDDVPV-AEPDTGRrd 620 589*********99.4558999999999445555******5544457777777777776677776.....233333.333445454 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlks 136 + W +s+g+g+++++n+a+g+ L+v g+ ++ g+ v++w+ n+ganQ+W+++++ QKW65065.1|CBM13|GH30_5 621 RAAEWMASSTGDGTWTLVNAATGRLLEVGGQaTHaGAAVTTWPPNSGANQRWTLTDV 677 4568*************************9885559****************99875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (680 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 50.51 // Query: QCB20971.1|CBM13|GH30_5 [L=681] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-17 49.0 2.2 4.9e-17 49.0 2.2 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.6 0.38 0.38 124 136 .. 147 159 .. 142 180 .. 0.62 2 ! 49.0 2.2 4.9e-17 4.9e-17 5 136 .. 543 678 .. 539 680 .. 0.78 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.38 CBM13.hmm 124 ngganQqWsvlks 136 + +a Q+W v++ QCB20971.1|CBM13|GH30_5 147 DADATQRWWVERI 159 2244455544443 PP == domain 2 score: 49.0 bits; conditional E-value: 4.9e-17 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +ty+l++++sgk + + +++g +++l d ++ ++ Q+W+l+++ ++ ++ sg L v + +v + +++g QCB20971.1|CBM13|GH30_5 543 HTYTLTGAQSGKAV-TVADDGRGLVLGDGTG-TSaQRWRLSAVRqdggvrdRYVFTDPGSGTRLAV-----RDDVPV-AEPDTGRr 620 689*********99.4447777899999445.555******6554557888788888777788876.....233343.44444555 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlks 136 + W +++g+g+++++n+a+g+ L+v g+ ++ g+ v++w+ n+ganQ+W+v+++ QCB20971.1|CBM13|GH30_5 621 dRATEWIMSTTGDGTWTLVNAATGRLLEVGGQaTHeGAAVTTWTPNSGANQRWTVTDV 678 45678*************************9885569****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (681 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 55.58 // Query: ADI05318.1|CBM13|GH30_5 [L=674] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-19 54.6 5.5 8.9e-19 54.6 5.5 2.6 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.1 0.41 0.41 27 54 .. 26 49 .. 7 65 .. 0.55 2 ? -1.3 0.5 0.13 0.13 81 89 .. 141 150 .. 133 165 .. 0.63 3 ! 54.6 5.5 8.9e-19 8.9e-19 5 135 .. 536 672 .. 532 674 .] 0.79 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.41 CBM13.hmm 27 nvqlwdccnganQqWtltsdgtirlenh 54 + q ++ ++Q t+++d +++ + ADI05318.1|CBM13|GH30_5 26 QAQAET----QAQAVTVRPDPSYQQQKF 49 222222....447777777776665544 PP == domain 2 score: -1.3 bits; conditional E-value: 0.13 CBM13.hmm 81 g.anQqWrle 89 + anQ+W+++ ADI05318.1|CBM13|GH30_5 141 AdANQRWWVD 150 2355555553 PP == domain 3 score: 54.6 bits; conditional E-value: 8.9e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdcc.n.gan.QqWtltsdg......tirlenhqsgkcLdvaasstaagaevqqytcngg 81 +ty+l++++sgk l + ++ g+++++ + + ++ Q+W+l++ + ++ ++n +gk L v + a+ ++ +++g+ ADI05318.1|CBM13|GH30_5 536 HTYQLTGAQSGKQL-TVAEGGTGLVIKTASaDpADTsQRWQLRQISgegnrqRYVFTNPTDGKRLAVRN------AAAVLEPDQGD 614 689*********99.3446666644444443675555******7766778889999**9999***9843......22334444344 PP CBM13.hmm 82 ..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlk 135 ++ qW +++g+ +++++n+a+g L+v+g+ +dg++v +w+ n+ganQ+W+v++ ADI05318.1|CBM13|GH30_5 615 rdKATQWIMSTTGDSTWTLVNAATGTLLEVSGQatQDGATVSTWQPNSGANQRWKVTD 672 446679****9********************989889*****************9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (674 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 130.90 // Query: ARU52154.1|CBM13|GH30_5 [L=1199] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.8e-17 48.7 1.3 9.4e-17 48.0 0.0 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.9 2.3 1 1 121 135 .. 178 192 .. 168 205 .. 0.64 2 ! 48.0 0.0 9.4e-17 9.4e-17 6 152 .. 583 740 .. 578 750 .. 0.82 Alignments for each domain: == domain 1 score: -4.9 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlk 135 wd + +a Q+W v + ARU52154.1|CBM13|GH30_5 178 WDADADATQRWWVDR 192 555555566664443 PP == domain 2 score: 48.0 bits; conditional E-value: 9.4e-17 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg..........tirlenhqsgkcLdvaasstaagaevqqytcng 80 yrl +v+ ++ l + a+g++v++++ + a+Q W lt+ g ++ ++n+ +g+ L va a+ ++v q + + ARU52154.1|CBM13|GH30_5 583 AYRLDGVQANRSL-APSASGTGVVIRT-DApVAEQAWHLTALGapegsgthreRYAVTNAATGRQLAVA----ADTSAVLQDAPAD 662 6899999999999.5558888988888.655788******77777778888999999999988999985....4555566666443 PP CBM13.hmm 81 g....anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgn 152 + qW l+++g+g+++++n++s+ L+v g+ adg+pv ++ n+g nQ+W++ ++++ ++ +e++++ g+ ARU52154.1|CBM13|GH30_5 663 VadtpLAAQWILSTTGDGTFTLVNASSKTLLEVGGQatADGSPVGTYLANSGVNQRWRIVDETVLGTEPVEAFTTPGT 740 322244778***************999*******889999***********************999999999888776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1199 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 181.50 // Query: QDO45002.1|CBM13|GH30_5 [L=688] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-19 57.7 5.8 1e-19 57.7 5.8 2.9 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.6 2.2 0.63 0.63 121 138 .. 144 161 .. 113 171 .. 0.73 2 ? -2.5 0.0 0.29 0.29 137 177 .. 422 462 .. 417 470 .. 0.76 3 ! 57.7 5.8 1e-19 1e-19 5 137 .. 543 683 .. 539 687 .. 0.78 Alignments for each domain: == domain 1 score: -3.6 bits; conditional E-value: 0.63 CBM13.hmm 121 wdcngganQqWsvlksdl 138 w n +a Q+W v + ++ QDO45002.1|CBM13|GH30_5 144 WNPNADATQRWWVDRIKK 161 455556666765555554 PP == domain 2 score: -2.5 bits; conditional E-value: 0.29 CBM13.hmm 137 dlkikliaekvipdgnnnilntqlpnivvlskNlesalivg 177 + ++++ ++++i g++ i ++ + sk ++a +v QDO45002.1|CBM13|GH30_5 422 KFDTARNFTHYIKPGDRLIKTDDTSSAAAVSKSGNGATVVH 462 55677888899999999999999999988888888887665 PP == domain 3 score: 57.7 bits; conditional E-value: 1e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan..vqlwdccn..ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 +ty l++v+sgk l +++g + +++++ + ++Q+W+l++ + ++ ++n gk L v +ga+v + + QDO45002.1|CBM13|GH30_5 543 HTYSLTGVQSGKALT-VADDGGKlvIKTASTDAatVTGQRWQLRQISgqtgnrqRYVFTNPVEGKRLAV-----RDGAPVLEAD-T 621 6899**********3.3345554224444433343467******6655666878888888888899997.....5888885555.4 PP CBM13.hmm 80 gg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 g ++ qW +++g+g+++++n+a+gk L+v g+ adg+ v++w+ n+g+nQ+W+v++++ QDO45002.1|CBM13|GH30_5 622 GPrdTATQWIMSTTGDGTWTLVNAATGKLLEVGGQatADGSAVTIWTPNSGSNQRWTVSDVT 683 55667789*************************889999*****************998876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (688 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 50.84 // Query: AZH84650.1|CBM13|GH30_5 [L=1302] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-14 41.0 3.8 4.1e-14 39.4 3.8 1.8 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 39.4 3.8 4.1e-14 4.1e-14 6 142 .. 579 728 .. 575 742 .. 0.75 Alignments for each domain: == domain 1 score: 39.4 bits; conditional E-value: 4.1e-14 CBM13.hmm 6 tyrlvnvnsgkcl....ggst...aaga.nvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqq 75 y+lv+++s k t ag+ + + d + ga+Q Wt ++ + ++ +++ + g L+ +++ag+++++ AZH84650.1|CBM13|GH30_5 579 AYQLVGKQSAKAFtaaaT--TgtvPAGTiTPRASDA-TtGAAQVWTAERLSgggtntdRYAVRSSS-GALLS----ANSAGTSLVA 656 699********9964321..2223333322334443.33677******665567776677877775.67888....5579****** PP CBM13.hmm 76 ytcngg...anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikl 142 t+ + ++ qW +++++ + ++n+ + ++L+v g+ + g+ v +++ n+ganQ W++ + +l+ ++ AZH84650.1|CBM13|GH30_5 657 ATREQAaadPSLQWIPTTTNGSEWSLVNVGTSQALEVGGQstTTGAAVGVYQSNNGANQTWNFVDTALTGVQ 728 **97776555779*999887667******99*******989666******************9988876665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1302 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 203.61 // Query: QEV29682.1|CBM13|GH30_5 [L=1053] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-18 52.5 0.0 4e-18 52.5 0.0 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -5.1 3.1 1 1 121 140 .. 141 160 .. 132 166 .. 0.65 2 ! 52.5 0.0 4e-18 4e-18 5 152 .. 535 684 .. 531 692 .. 0.82 Alignments for each domain: == domain 1 score: -5.1 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlksdlki 140 wd++ ++ Q+W v ++++ki QEV29682.1|CBM13|GH30_5 141 WDWSADPGQRWWVDRVKKKI 160 66666666666665555554 PP == domain 2 score: 52.5 bits; conditional E-value: 4e-18 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngga 82 ++yrl++++sgk l + a+g++v++++ + +a+ Q W++++ + ++ l n+ +g L v + ++ + +++ QEV29682.1|CBM13|GH30_5 535 HVYRLQGAQSGKSL-APSADGDGVVVRTPDPAAKsQLWSVKRLTrgdgnrdRYALLNAETGERLAVR------NDDAVLEDA-DTP 612 5799**********.55688888888886644555******55444557778888888877888873......333455554.787 PP CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgn 152 + qW +++g+g+++++n+a+g+ Ldv g+ adg++v +++anQ+W+v+++++ ++ ae++++ g+ QEV29682.1|CBM13|GH30_5 613 AAQWIMSTTGDGTWTFVNAATGRLLDVVGQstADGARVSAFLPTSNANQRWAVTDETVLRTQPAEAFTVPGR 684 788*************************9899*******999999*************99999999988876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1053 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 171.26 // Query: ACU36497.1|CBM13|GH30_5 [L=656] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-18 54.0 0.2 3.1e-18 52.9 0.2 1.6 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 52.9 0.2 3.1e-18 3.1e-18 5 134 .. 526 654 .. 522 656 .] 0.81 Alignments for each domain: == domain 1 score: 52.9 bits; conditional E-value: 3.1e-18 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcnggan 83 yrl++v+sgk l + +g+++++++ + a+Q W+l++ + ++ ++n+ +g+ L a ++e ++ + +g+ ACU36497.1|CBM13|GH30_5 526 DAYRLTGVQSGKSL---APSGNSLVQRNSAEVADQYWRLERLDngfgnrvRFAVVNAGTGQRLA------AVNGEAVLRSA-DGPE 601 679*********99...45556666666345788******665568887777777777788887......44445556664.7999 PP CBM13.hmm 84 QqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvl 134 +W +s+g+g+++++n+a+g Ldv g+ adg++v +++ ++g+nQ+W+ + ACU36497.1|CBM13|GH30_5 602 ARWITSSTGDGTWTLVNAATGAMLDVVGQstADGAKVGLYTPTSGPNQRWTAT 654 9**************************9899*******************865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (656 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 157.50 // Query: VEH36909.1|CBM13|GH30_5 [L=716] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-14 38.6 0.0 1.4e-13 37.6 0.0 1.4 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 37.6 0.0 1.4e-13 1.4e-13 9 133 .. 574 711 .. 568 715 .. 0.71 Alignments for each domain: == domain 1 score: 37.6 bits; conditional E-value: 1.4e-13 CBM13.hmm 9 lvnvnsgkcl.ggst..aaga.n.vq.lwdcc.n.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 + ++ g+ l +g +g + v+ +++ + + + +Q+Wtl++ + ++l+ + g L +t+ g++ ++ ++ VEH36909.1|CBM13|GH30_5 574 VLSADGGLALtAGPVvaGDGGpAvVTtVES-TaDaAPGQRWTLRTLSgagtnrrVVTLTDGD-GTLLA----ATDEGGTARVRPDA 653 556667777762222343333333332333.3244566******776677754444444444.56777....56789999999987 PP CBM13.hmm 80 gg..anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsv 133 g +QqW l++++++++ + ++a+g+ Ldv+ ad gt+v + + +++++Q W++ VEH36909.1|CBM13|GH30_5 654 AGpgRAQQWVLSTTDGRTWSLLSVATGRQLDVSRRsADpGTRVGLAPSTTDPQQAWTF 711 666779*****9998899***************779888*****************98 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (716 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 155.81 // Query: AMW14875.1|CBM13|GH30_5 [L=1059] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-18 53.9 0.4 3.7e-18 52.6 0.0 1.8 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.3 0.7 0.51 0.51 121 136 .. 144 159 .. 137 170 .. 0.58 2 ! 52.6 0.0 3.7e-18 3.7e-18 6 152 .. 539 687 .. 534 696 .. 0.80 Alignments for each domain: == domain 1 score: -3.3 bits; conditional E-value: 0.51 CBM13.hmm 121 wdcngganQqWsvlks 136 wd++ ++ Q+W v ++ AMW14875.1|CBM13|GH30_5 144 WDWSADPGQRWWVDRV 159 4444445555533333 PP == domain 2 score: 52.6 bits; conditional E-value: 3.7e-18 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccn.gan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +yrl++ +sgk l + +g++v++++ + +a+ Q W++++ + ++ l+n+ +g+ L v e ++ + g+ AMW14875.1|CBM13|GH30_5 539 VYRLQGTQSGKSL-APSPDGDGVVVRTA-DpAAEsQLWRVKRLTrgegnreRYALVNAANGRRLAV------RDDEAVLED--GAt 614 799**********.34456666777774.335555******6655566777888888888888886......233445555..444 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgn 152 ++ qW +++g+g+++++n+a+g+ Ldv g+ adg++v + ++ganQ+W+v+++++ ++ a+++++ g+ AMW14875.1|CBM13|GH30_5 615 PAAQWITSTTGDGTWTFVNAATGRLLDVVGQstADGARVSAHLPTSGANQRWAVTDETVLRTRPATAFTVPGR 687 6788*999999******************9899**********999************999999999888776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1059 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 165.99 // Query: QHC68160.1|CBM13|GH30_5 [L=1218] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-16 47.1 3.5 1.9e-16 47.1 3.5 2.7 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.8 0.07 0.07 86 140 .. 115 168 .. 93 186 .. 0.67 2 ! 47.1 3.5 1.9e-16 1.9e-16 6 139 .. 578 722 .. 574 736 .. 0.74 3 ? -3.5 0.2 0.61 0.61 69 95 .. 944 973 .. 924 994 .. 0.58 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.07 CBM13.hmm 86 Wrlesvg.sgyykirnras.gkcLdvkggadgtpvqqwdcngganQqWsvlksdlki 140 W+ +++g + +++ +n a+ + L + +ad +d++ + Q+W v+k + ++ QHC68160.1|CBM13|GH30_5 115 WKPDTTGaQYSGTTTNLADrDALLAKW-NADD--PASYDWTADETQRWWVEKLAEEQ 168 666666633347778888845666666.3444..56788888888999766655444 PP == domain 2 score: 47.1 bits; conditional E-value: 1.9e-16 CBM13.hmm 6 tyrlvnvnsgkcl.ggstaagan.vqlwdccn..ganQqWtltsdg.....tirlenhq.s.gkcLdvaasstaagaevqqytcng 80 +y+lv+ +sgk l ++ t a ++ +l++ ++ +a+Q+Wt++ + + r + q s g++L +++s ++ +v++ + g QHC68160.1|CBM13|GH30_5 578 HYQLVGTQSGKALtATTTGAATTiTTLAT-DStaAAKQNWTVHEVPagereATRRVVLQtSdGRVLGATTSG-TDLRSVSVDSAKG 661 79***********4433344445466666.5344555******554458884555555556699**954322.4777778888878 PP CBM13.hmm 81 ganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlk 139 +a+ +W ++s+++ +++++n a + Ldv+++ a t+v ++ ngganQ W++ + + QHC68160.1|CBM13|GH30_5 662 AAATRWIVNSTDGVNFTLVNEALAQSLDVNQAssAENTTVGVYGSNGGANQSWTLRDLAPA 722 89******9996668*****6669******8886668****************98776554 PP == domain 3 score: -3.5 bits; conditional E-value: 0.61 CBM13.hmm 69 agaevqqytcnggan.QqWrlesvg..sgy 95 ++a+vq + g+++ Q+++l+ +g +g+ QHC68160.1|CBM13|GH30_5 944 QQATVQFLRDGGTSWaQTYQLQYQGaeGGT 973 344444444433333255666555443444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1218 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 148.11 // Query: QCR45891.1|CBM13|GH30_5 [L=681] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-17 48.6 1.0 6.1e-17 48.6 1.0 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.5 0.39 0.39 80 89 .. 148 157 .. 142 181 .. 0.60 2 ! 48.6 1.0 6.1e-17 6.1e-17 5 136 .. 543 678 .. 539 680 .. 0.78 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.39 CBM13.hmm 80 gganQqWrle 89 +a Q+W++e QCR45891.1|CBM13|GH30_5 148 ADATQRWWVE 157 2244555443 PP == domain 2 score: 48.6 bits; conditional E-value: 6.1e-17 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +ty+l++ +sgk + + +++g +++l d ++ ++ Q+W+l+++ ++ ++ sg L v + +v + +++g QCR45891.1|CBM13|GH30_5 543 HTYTLTGTQSGKAV-TVADDGRGLVLGDGTG-TSaQRWRLSAVRldggvrdRYVFTDPGSGTRLAV-----RDDVPV-AEPDTGRr 620 6899********99.4447777899999445.555******7666667777777777777777776.....233333.44444555 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlks 136 + W +++g+g+++++n+a+g+ L+v g+ ++ g+ v++w+ n+ganQ+W+v+++ QCR45891.1|CBM13|GH30_5 621 dRATEWIMSTTGDGTWTLVNAATGRLLEVGGQaTHeGAAVTTWPPNSGANQRWTVTDV 678 45678*************************9885569****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (681 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 51.79 // Query: QYF73698.1|CBM13|GH30_5 [L=915] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-17 48.1 0.1 3.9e-16 46.0 0.1 2.1 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 46.0 0.1 3.9e-16 3.9e-16 5 137 .. 575 720 .. 569 741 .. 0.76 Alignments for each domain: == domain 1 score: 46.0 bits; conditional E-value: 3.9e-16 CBM13.hmm 5 gtyrlvnvnsgkcl..ggst.aaga.n.vqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqyt 77 +tyr+v+++sgk l ++ t ++ a + +l++ + ++Q Wt ++++ ++ l+++ g +L ++++g+ ++ t QYF73698.1|CBM13|GH30_5 575 HTYRVVGAQSGKALtaKATTgSNPAaAiTTLATSAGtVGAQLWTAEKVTagdsnteRFVLRSAA-GTALA----ANGSGTLLVEST 655 689***********86333344444454567775564566******776667784555555555.66998....446899999999 PP CBM13.hmm 78 cngg...anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 + + ++QqW +++++ ++ ++n a +L+v g+ + g+ v +++ ngganQ Ws+++ + QYF73698.1|CBM13|GH30_5 656 REAAaadPAQQWIPTTTDGSTWSLVNGALPVALEVPGQstTEGAAVNVYASNGGANQTWSFQDTA 720 865555569***999887777*****6669******989777*****************998766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (915 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 142.24 // Query: QKV98692.1|CBM13|GH30_5 [L=679] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-17 50.3 0.8 1.9e-17 50.3 0.8 3.2 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.8 2.4 0.38 0.38 121 138 .. 143 160 .. 131 177 .. 0.67 2 ! 50.3 0.8 1.9e-17 1.9e-17 6 136 .. 543 677 .. 542 679 .] 0.80 Alignments for each domain: == domain 1 score: -2.8 bits; conditional E-value: 0.38 CBM13.hmm 121 wdcngganQqWsvlksdl 138 w n +a Q+W v + ++ QKV98692.1|CBM13|GH30_5 143 WNENADATQRWWVDRIKK 160 555556666665555444 PP == domain 2 score: 50.3 bits; conditional E-value: 1.9e-17 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg..a 82 ty+l++v+sgk + + + g+n+++++ +++a+QqW+l+++ ++++++ +g+ L v + +v + + +g + QKV98692.1|CBM13|GH30_5 543 TYTLTGVQSGKAV-TVPSGGSNLVIASGDGSASQQWRLSAVRpgdgvreRYEFTSPADGRRLAVR-----DDVPV-AEPGTGRrdP 621 699********99.4448888966666355677******77667779999999999999999972.....33333.3333344446 PP CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlks 136 + W +++g+g+++++n+a+g+ L+v g+ ++ g+ v++w+ n+g+nQ+W+++++ QKV98692.1|CBM13|GH30_5 622 AAEWIMSTTGDGTWTLVNAATGRLLEVGGQaTHeGAAVTTWEPNSGSNQRWTITDV 677 789*************************9885569****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (679 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 52.49 // Query: SDT57818.1|CBM13|GH30_5 [L=1012] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-21 63.5 0.0 1.7e-21 63.5 0.0 2.2 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.8 4.3 0.73 0.73 121 134 .. 131 144 .. 121 158 .. 0.64 2 ! 63.5 0.0 1.7e-21 1.7e-21 5 144 .. 515 651 .. 511 667 .. 0.85 Alignments for each domain: == domain 1 score: -3.8 bits; conditional E-value: 0.73 CBM13.hmm 121 wdcngganQqWsvl 134 w ++ +anQ+W v SDT57818.1|CBM13|GH30_5 131 WNWDADANQRWWVD 144 44444555555333 PP == domain 2 score: 63.5 bits; conditional E-value: 1.7e-21 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg..tirlenhqsgkcLdvaasstaagaevqqytcngganQqWr 87 +tyrl +v+sg+ l t ag++v +++ + +a+Q Wt++++g ++++ n+ sg+ L v +g +v+ + ++ +W SDT57818.1|CBM13|GH30_5 515 HTYRLEGVASGRSL---TPAGTGVAIRTNSTtAADQLWTVQPAGsdRYQVINAASGQRLAV-----RDGEAVTETAGAVDDGARWV 592 689*********99...788888999995554666*********9*********999**98.....47777766664444778*** PP CBM13.hmm 88 lesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkiklia 144 ++++g+g+y+++n + Ldv+g adg+pv ++ +++anQ+W+++++++ +++a SDT57818.1|CBM13|GH30_5 593 FSTTGDGTYTLVNLGGRRLLDVNGEatADGSPVGTYLPTSAANQRWTLKDETVGRTETA 651 *************7778******878999*****************9999988776655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1012 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 170.53 // Query: ASN21710.1|CBM13|GH30_5 [L=1176] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-11 28.7 2.8 8e-11 28.7 2.8 3.3 4 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.0 0.4 0.21 0.21 81 135 .. 175 184 .. 156 199 .. 0.64 2 ? -0.6 0.1 0.078 0.078 114 158 .. 458 495 .. 448 519 .. 0.44 3 ! 28.7 2.8 8e-11 8e-11 6 137 .. 605 762 .. 600 776 .. 0.66 4 ? -2.6 0.2 0.32 0.32 76 135 .. 951 965 .. 936 1011 .. 0.55 Alignments for each domain: == domain 1 score: -2.0 bits; conditional E-value: 0.21 CBM13.hmm 81 ganQqWrlesvgsgyykirnrasgkcLdvkggadgtpvqqwdcngganQqWsvlk 135 ++nQ+W++e + ASN21710.1|CBM13|GH30_5 175 DKNQRWWVE---------------------------------------------R 184 245555543.............................................3 PP == domain 2 score: -0.6 bits; conditional E-value: 0.078 CBM13.hmm 114 dgtpvqqwdcngganQqWsvlksdlkikliaekvipdgnnnilnt 158 dg+ q +c +nQ+++ ++ + ++++i g+ i n+ ASN21710.1|CBM13|GH30_5 458 DGASQEQAKCKVLTNQKYN-TTRN------FTHYIRPGDFLIQND 495 4444444455444445542.2222......222222222222222 PP == domain 3 score: 28.7 bits; conditional E-value: 8e-11 CBM13.hmm 6 tyrlvnvnsgkcl.ggstaaga...n.vqlwdccnganQqWtltsdg.........tirlenhqsgkcLdv.......aasstaag 70 +y+l + +sgk+l g ++g+ + + + + + a Q Wt+++++ ++ l+n++ g++L+ ++s +a+ ASN21710.1|CBM13|GH30_5 605 SYHLSGEASGKYLtGR--SNGSasiEeMGTDA-AGVAPQMWTFNAVStedefandrRWVLTNKD-GRVLTGnggvlngSQSGAASL 686 68999999*****522..33331112233333.2334488888855445555555566666766.467775344331133333477 PP CBM13.hmm 71 aevqqytcngganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngga.......nQqWsvlksd 137 +++++ + +++ qW +++++++++ ++n+ +L+v+g+ a gt v + + +g++ Q W++++ + ASN21710.1|CBM13|GH30_5 687 STLTLEQAKANPSAQWIVTTENGKQWSLVNAGAAIALQVSGNqtAAGTSVALASSTGTTatalanpHQAWAFTDIA 762 777777776668889***9998999*****7779******999888********9886635555555667776655 PP == domain 4 score: -2.6 bits; conditional E-value: 0.32 CBM13.hmm 76 ytcngganQqWrlesvgsgyykirnrasgkcLdvkggadgtpvqqwdcngganQqWsvlk 135 t c+ +a+ +Ws++ ASN21710.1|CBM13|GH30_5 951 NT---------------------------------------------CDANASTRWSNWV 965 33.............................................4444444444332 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1176 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 127.18 // Query: AYL34326.1|CBM13|GH30_5 [L=679] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-17 49.7 1.4 3e-17 49.7 1.4 3.2 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.6 2.1 0.31 0.31 121 138 .. 143 160 .. 131 178 .. 0.68 2 ! 49.7 1.4 3e-17 3e-17 6 136 .. 543 677 .. 542 679 .] 0.80 Alignments for each domain: == domain 1 score: -2.6 bits; conditional E-value: 0.31 CBM13.hmm 121 wdcngganQqWsvlksdl 138 w n +a Q+W v + ++ AYL34326.1|CBM13|GH30_5 143 WNENADATQRWWVDRIKK 160 555556666665555444 PP == domain 2 score: 49.7 bits; conditional E-value: 3e-17 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg..a 82 ty+l++v+sgk + + + g+n+++++ +++a+QqW+l+++ ++++++ +g+ L v + +v + + +g + AYL34326.1|CBM13|GH30_5 543 TYTLTGVQSGKAV-TVPSGGSNLVIASGDGSASQQWRLSAVRpgdgvreRYEFTSPADGRRLAVR-----DDVPV-AEPGTGRrdP 621 699********99.4448888966666355677******77667779999999999999999972.....33333.3333344446 PP CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlks 136 + W +++g+g+++++n+a+g+ L+v g+ ++ g+ v++w+ n+g+nQ+W+++++ AYL34326.1|CBM13|GH30_5 622 AAEWIMSTTGDGTWTLVNAATGRLLEVGGQaTHeGAAVTTWQPNSGSNQRWTITDV 677 789*************************9885569****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (679 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 48.43 // Query: QDN82732.1|CBM13|GH30_5 [L=688] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-19 56.3 5.6 2.7e-19 56.3 5.6 2.9 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.6 2.2 0.63 0.63 121 138 .. 144 161 .. 113 171 .. 0.73 2 ? -2.5 0.0 0.29 0.29 137 177 .. 422 462 .. 417 470 .. 0.76 3 ! 56.3 5.6 2.7e-19 2.7e-19 5 137 .. 543 683 .. 539 687 .. 0.78 Alignments for each domain: == domain 1 score: -3.6 bits; conditional E-value: 0.63 CBM13.hmm 121 wdcngganQqWsvlksdl 138 w n +a Q+W v + ++ QDN82732.1|CBM13|GH30_5 144 WNPNADATQRWWVDRIKK 161 455556666765555554 PP == domain 2 score: -2.5 bits; conditional E-value: 0.29 CBM13.hmm 137 dlkikliaekvipdgnnnilntqlpnivvlskNlesalivg 177 + ++++ ++++i g++ i ++ + sk ++a +v QDN82732.1|CBM13|GH30_5 422 KFDTARNFTHYIKPGDRLIKTDDTSSAAAVSKSGNGATVVH 462 55677888899999999999999999988888888887665 PP == domain 3 score: 56.3 bits; conditional E-value: 2.7e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan..vqlwdccn..ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 +ty l++v+sgk l +++g + +++++ + ++Q+W+l++ + ++ ++n gk L v +ga+v + + QDN82732.1|CBM13|GH30_5 543 HTYSLTGVQSGKALT-VADDGGKlvIKTASTDAatVTGQRWQLRQISgqtgnrqRYVFTNPVEGKRLAV-----RDGAPVLEAD-T 621 6899**********3.3345554224444433343467******6655666878888888888899997.....5888885555.4 PP CBM13.hmm 80 gg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 g ++ qW +++g+g+++++n+a+g+ L+v g+ adg+ v++w+ n+g+nQ+W+v++++ QDN82732.1|CBM13|GH30_5 622 GPrdTATQWIMSTTGDGTWTLVNAATGRLLEVGGQatADGSAVTIWTPNSGSNQRWTVSDVT 683 55667789*************************889999*****************998876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (688 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 49.41 // Query: AXX29951.1|CBM13|GH30_5 [L=656] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-18 54.0 0.2 3.1e-18 52.9 0.2 1.6 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 52.9 0.2 3.1e-18 3.1e-18 5 134 .. 526 654 .. 522 656 .] 0.81 Alignments for each domain: == domain 1 score: 52.9 bits; conditional E-value: 3.1e-18 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcnggan 83 yrl++v+sgk l + +g+++++++ + a+Q W+l++ + ++ ++n+ +g+ L a ++e ++ + +g+ AXX29951.1|CBM13|GH30_5 526 DAYRLTGVQSGKSL---APSGNSLVQRNSAEVADQYWRLERLDngfgnrvRFAVVNAGTGQRLA------AVNGEAVLRSA-DGPE 601 679*********99...45556666666345788******665568887777777777788887......44445556664.7999 PP CBM13.hmm 84 QqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvl 134 +W +s+g+g+++++n+a+g Ldv g+ adg++v +++ ++g+nQ+W+ + AXX29951.1|CBM13|GH30_5 602 ARWITSSTGDGTWTLVNAATGAMLDVVGQstADGAKVGLYTPTSGPNQRWTAT 654 9**************************9899*******************865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (656 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 154.82 // Query: AXE87359.1|CBM13|GH30_5 [L=682] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-16 47.1 1.7 1.8e-16 47.1 1.7 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.3 1.0 0.51 0.51 121 137 .. 145 161 .. 139 169 .. 0.61 2 ! 47.1 1.7 1.8e-16 1.8e-16 5 136 .. 544 679 .. 540 681 .. 0.79 Alignments for each domain: == domain 1 score: -3.3 bits; conditional E-value: 0.51 CBM13.hmm 121 wdcngganQqWsvlksd 137 w n + Q+W v + + AXE87359.1|CBM13|GH30_5 145 WNKNADKTQRWWVDRIK 161 44444555666555444 PP == domain 2 score: 47.1 bits; conditional E-value: 1.8e-16 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg......tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 +tyrl++v+sgk l + +++g++++++ a+ qW++++ ++ l+ +s+k L v ++++++ ++ g AXE87359.1|CBM13|GH30_5 544 HTYRLTGVQSGKDL-TIADNGTGLVIRGASAdPAGRQWQVEQIRggdnrkRYVLTETSSDKRLAV------RNGALVAEPDEGRrd 622 689*********88.34488898555554543677******654456667777777777788876......555677777767676 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlks 136 ++ W +++g+g+++++n+a+g+ dv+g+ ++ g+ v +w+ n+ganQ+W+v+++ AXE87359.1|CBM13|GH30_5 623 KATEWIMSTTGDGTWTLVNAATGQLPDVSGQsTNeGASVGLWQPNSGANQRWKVTEV 679 6779*************************9996669****************99976 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (682 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 150.32 // Query: QQN76518.1|CBM13|GH30_5 [L=677] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-20 58.9 0.9 4.3e-20 58.9 0.9 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -5.3 3.3 1 1 121 135 .. 138 152 .. 127 161 .. 0.59 2 ! 58.9 0.9 4.3e-20 4.3e-20 5 135 .. 539 674 .. 535 677 .] 0.83 Alignments for each domain: == domain 1 score: -5.3 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlk 135 w + +a Q+W v++ QQN76518.1|CBM13|GH30_5 138 WNEDADATQRWWVER 152 333334445554444 PP == domain 2 score: 58.9 bits; conditional E-value: 4.3e-20 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan.vqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +ty+l++v+sg+ l + +++g++ v+ + ++++Q Wtl++ + +++l +++++ L v +ga+v +++ g QQN76518.1|CBM13|GH30_5 539 HTYQLTGVQSGRAL-TVADDGTGaVISTAVAGDRDQVWTLSPYTkghdnrqQYTLGTRSGNQRLAV-----RDGAAVLEKDR-GRp 617 589***********.45588887577777555677******6555566778999999986689987.....59999999998.665 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlk 135 + +W l+++g+g+y+++n+a+ + L+v g+ ++ g+pv++w+ n+ganQ+W++++ QQN76518.1|CBM13|GH30_5 618 dEAARWILSTTGDGTYTLVNAATCRLLEVGGQaTHeGAPVTVWTPNSGANQRWTITD 674 6567****************9999******9885569****************9987 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (677 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 144.61 // Query: QKV78778.1|CBM13|GH30_5 [L=661] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-22 65.0 0.9 1.4e-21 63.7 0.9 1.7 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 63.7 0.9 1.4e-21 1.4e-21 7 133 .. 530 658 .. 525 661 .] 0.84 Alignments for each domain: == domain 1 score: 63.7 bits; conditional E-value: 1.4e-21 CBM13.hmm 7 yrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytc.nggan 83 + l++v+sgk l s+++g+ vq ++ + +a+Q+Wtlt+ + +++++n+ +g++L+ ++g++v++ + +++++ QKV78778.1|CBM13|GH30_5 530 VSLTGVQSGKSL--SAENGSLVQ-RTTDAsAAAQRWTLTDRTgchgnrdRFTITNAGTGQVLS------TSGGAVTLAAAgTDDPA 606 678999****99..667776455.553543666******77668889999*******999**9......58999999995144478 PP CBM13.hmm 84 QqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsv 133 W+l+++g+g+++++n+ +g+ Ldv g adg+p+ +++ ++g+nQ+W+ QKV78778.1|CBM13|GH30_5 607 AEWTLSTTGDGTWTFVNAGTGQLLDVIGEsrADGAPIGLYKPTNGPNQRWQA 658 99***************999*******878********************75 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (661 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 161.00 // Query: ANC32950.1|CBM13|CBM5|GH30_5 [L=1094] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-18 52.4 0.6 1.4e-17 50.7 0.0 2.2 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.0 1.8 0.82 0.82 120 136 .. 151 167 .. 140 180 .. 0.64 2 ! 50.7 0.0 1.4e-17 1.4e-17 6 145 .. 557 705 .. 552 721 .. 0.83 Alignments for each domain: == domain 1 score: -4.0 bits; conditional E-value: 0.82 CBM13.hmm 120 qwdcngganQqWsvlks 136 wd + +a Q+W v + ANC32950.1|CBM13|CBM5|GH30_5 151 HWDPDADATQRWWVDRI 167 57766677777755444 PP == domain 2 score: 50.7 bits; conditional E-value: 1.4e-17 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg..........tirlenhqsgkcLdvaasstaagaevqq 75 +yr+ +v+sg+ l + ag++v++++ + +a+Q Wtlt+ g ++ l n+ +g L v++ ++a+ + + ANC32950.1|CBM13|CBM5|GH30_5 557 VYRVDGVQSGRSL---APAGSGVRIET-DAaDADQLWTLTDLGapegsgthrsRYALANVGTGALLAVTGDTSATTVPAPA 633 688899999**99...56677799999.543677******87788888889999999999988899998777667777777 PP CBM13.hmm 76 ytcngg.anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliae 145 + ++ a+ +W l+++g+g+ +++n++s L+v g+ adg+pv ++ n+g+nQ+W++l++++ ++ + ANC32950.1|CBM13|CBM5|GH30_5 634 DPA-DTpAAARWILSTTGDGTSTLVNASSRTLLEVGGQatADGSPVGTYLANSGDNQRWRLLDETVLGTEPVD 705 776.555999****************8889******889999*******************999887666555 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1094 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 178.45 // Query: AQS71285.1|CBM13|GH30_5 [L=682] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-17 51.1 7.2 1.7e-17 50.4 1.2 2.7 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.6 0.4 0.4 124 136 .. 145 157 .. 140 177 .. 0.62 2 ! 50.4 1.2 1.7e-17 1.7e-17 6 137 .. 542 677 .. 540 681 .. 0.75 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.4 CBM13.hmm 124 ngganQqWsvlks 136 + +a Q+W v++ AQS71285.1|CBM13|GH30_5 145 DADATQRWWVERI 157 2244455544443 PP == domain 2 score: 50.4 bits; conditional E-value: 1.7e-17 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 ty+l++v+sgk + + + +g+n++l + + ++ Q+W+l+++ ++ +++ +g L v + +v + +++g AQS71285.1|CBM13|GH30_5 542 TYTLTGVQSGKAV-TVAGDGTNLVLGTGAG-TSaQRWRLSAVRhdsgvrdRYVFTRPEDGTRLAV-----RDDVPV-AEPDTGRrd 619 799********99.4558999999999444.555******6654455666566666555556665.....223333.333344454 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlksd 137 + W ++++g+g+++++n+a+g+ L+v g+ ++ g+ v++w+ n+ganQ+W+v++++ AQS71285.1|CBM13|GH30_5 620 RAAEWIVSTTGDGTWTLINAATGRLLEVGGQaTHeGAAVTTWPPNSGANQRWTVTDVS 677 4568*************************9885569*****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (682 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 50.64 // Query: BAC68736.1|CBM13|GH30_5 [L=699] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-21 64.2 6.2 1e-21 64.2 6.2 2.2 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.9 3.0 1 1 121 136 .. 151 166 .. 142 178 .. 0.62 2 ! 64.2 6.2 1e-21 1e-21 5 141 .. 550 693 .. 546 698 .. 0.84 Alignments for each domain: == domain 1 score: -4.9 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlks 136 w n +a Q+W v + BAC68736.1|CBM13|GH30_5 151 WNPNADATQRWWVDRI 166 3444445555544443 PP == domain 2 score: 64.2 bits; conditional E-value: 1e-21 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdcc.n..ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcng 80 +ty+l++v+sgk l + +++g+++++++ + g++QqW++++ + ++ ++n gk L v +ga+v ++ + BAC68736.1|CBM13|GH30_5 550 HTYQLTGVQSGKAL-TVADDGTQLVIRTAGtDaaGTGQQWQVRQISgdtgnrqRYVFTNPAAGKRLAV-----RDGAPVLEADRGH 629 689***********.5559999855455343464566******665566788899999999899**98.....69****9999855 PP CBM13.hmm 81 g.anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkik 141 ++ qW +++g+g+++++n+a+g+ L+v g+ +dg+ v++w+ n+g+nQ+Wsv+++++++ BAC68736.1|CBM13|GH30_5 630 RdKATQWIMSTTGDGTWTLVNAATGRLLEVGGQatTDGAAVTTWTPNSGSNQRWSVTDVTDQNG 693 567789*************************889999********************9998765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (699 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 147.95 // Query: QTU58870.1|CBM13|GH30_5 [L=1049] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-21 64.2 0.0 1.1e-21 64.2 0.0 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.6 4.8 1 1 121 140 .. 130 149 .. 120 158 .. 0.66 2 ! 64.2 0.0 1.1e-21 1.1e-21 6 156 .. 525 681 .. 520 693 .. 0.85 Alignments for each domain: == domain 1 score: -4.6 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlksdlki 140 wd+n ++ Q+W v ++++ki QTU58870.1|CBM13|GH30_5 130 WDWNADQGQRWWVDQVKDKI 149 66666666666555555544 PP == domain 2 score: 64.2 bits; conditional E-value: 1.1e-21 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 +yrl++ +sgk + +g++v+l++ + +++ Q W++++ + +++l+n+++g L v ++ +v +++g QTU58870.1|CBM13|GH30_5 525 VYRLQGTQSGKSF-APSPDGTGVVLRTTDAASArQLWSVEQLTsgtgnreRYTLTNADTGGRLAV-----RDNQAVLEEARTGEvp 604 699999*****99.45578999**9995555555******76666778899*******7568887.....3566677778888899 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgnnnil 156 a+ qW +++g+g+++++n+a+g+ Ldv+g+ adg++v +++ +++anQ W+v+++++ ++++ae++++ g + +l QTU58870.1|CBM13|GH30_5 605 AAAQWLMSTTGDGSWTLVNAATGRLLDVTGQssADGAKVSTYTPTSAANQLWAVSDETVLSTERAEAFTVPGLRPKL 681 8899*************************989999*******************************99998877666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1049 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 168.77 // Query: QKW09836.1|CBM13|GH30_5 [L=670] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-22 65.2 1.3 5.1e-22 65.2 1.3 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.7 0.2 0.015 0.015 121 147 .. 144 170 .. 132 185 .. 0.68 2 ! 65.2 1.3 5.1e-22 5.1e-22 7 133 .. 530 662 .. 525 669 .. 0.83 Alignments for each domain: == domain 1 score: 1.7 bits; conditional E-value: 0.015 CBM13.hmm 121 wdcngganQqWsvlksdlkikliaekv 147 w + +anQ+W +++++ + ++++e++ QKW09836.1|CBM13|GH30_5 144 WNPEADANQRWWLKAAKERGAKTFEAF 170 666667788886666666666666655 PP == domain 2 score: 65.2 bits; conditional E-value: 5.1e-22 CBM13.hmm 7 yrlvnvnsgkclggstaaga.nvqlwdccn..ganQqWtltsdg........tirlenhqsgkcLdvaasstaagaevqqytcngg 81 ++v+ +sg+ l +s+a+g+ + ++++ n + +QqWt+t+ + t+r++n+++gk+L+v ++g +++ ++ QKW09836.1|CBM13|GH30_5 530 RQIVSDHSGMALTASEADGTvTPTQRNA-NpdDPSQQWTFTKLSaddwgntaTYRVTNKKTGKALSV-----SSG-ALTFAEPGSS 608 589*********99999**955777774.443566******66666677888********99****8.....344.5666665466 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsv 133 a QqW +++g+g +++n+a+g Ldv + dg+ v ++ ++g+nQ Ws+ QKW09836.1|CBM13|GH30_5 609 AEQQWLRSTTGNGHQTLVNKATGELLDVINEatHDGAAVGVYRPTTGNNQSWSL 662 9****999999******************778777*****************86 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (670 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 137.02 // Query: AUZ88629.1|CBM13|GH30_5 [L=1061] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-19 56.8 0.0 4.8e-19 55.5 0.0 1.6 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 55.5 0.0 4.8e-19 4.8e-19 6 153 .. 547 695 .. 543 708 .. 0.80 Alignments for each domain: == domain 1 score: 55.5 bits; conditional E-value: 4.8e-19 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg..tirlenhq.sgkcLdvaasstaagaevqqytcngganQqWr 87 +yrl++v+sgk + + + g++v+ ++ + +anQ +++ts g ++ + s Ld a++ ++ g++ ++ + ++ W AUZ88629.1|CBM13|GH30_5 547 VYRLQGVQSGKSI--EPTGGTAVISAS-DPaDANQLFRFTSLGedD--SNRERySITTLDGASQLADEGGAAVVAPAGTNPRAAWI 627 799********88..567888866555.323599******999653..333333434788776665677777777763446778** PP CBM13.hmm 88 lesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgnn 153 +++g+g+y+++n+++g+ L+v gg + g+pv+++ n+ganQ+W++ ++++ +++ ++++++ g++ AUZ88629.1|CBM13|GH30_5 628 ASTTGDGTYTFVNAETGLLLEVGGGktTEGAPVTLYLANSGANQRWTLIDETVLSVQGTTAFTVPGTA 695 *999*********999*******999777************************999999999888776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1061 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 178.88 // Query: SDT23523.1|CBM13|GH30_5 [L=1171] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-11 30.1 0.3 2.9e-11 30.1 0.3 2.7 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.4 0.7 0.14 0.14 124 136 .. 168 180 .. 137 195 .. 0.62 2 ! 30.1 0.3 2.9e-11 2.9e-11 6 140 .. 600 760 .. 595 918 .. 0.75 Alignments for each domain: == domain 1 score: -1.4 bits; conditional E-value: 0.14 CBM13.hmm 124 ngganQqWsvlks 136 + ++nQ+W v++ SDT23523.1|CBM13|GH30_5 168 DADQNQRWWVERL 180 2244455543333 PP == domain 2 score: 30.1 bits; conditional E-value: 2.9e-11 CBM13.hmm 6 tyrlvnvnsgkcl.ggstaaganvq.lwdccn.gan.QqWtltsdg.........tirlenhq.sgkcLdv.......aasstaag 70 +y+l + +sg++l + +ga++q l + + g + Q Wt+++++ + + +g++L+ ++s +a+ SDT23523.1|CBM13|GH30_5 600 SYHLSGEASGRYLtA-GSGTGASIQdLGT-DAaGVApQIWTFKAVNsgdefandrR--WVVTGeDGRVLSGnggvvngSQSGAASL 681 688999999999952.3344444332333.22233448888884444455555321..2222223555554233321133344588 PP CBM13.hmm 71 aevqqytcngganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngga.......nQqWsvlksdlki 140 a++++ + +++ qW l+++++++++++n+a +L+v+g+ a gt v + + +g++ Q W++++ ++ + SDT23523.1|CBM13|GH30_5 682 ASLTLDQAKATPSAQWILTTENGKQWTLVNAAAAIALQVSGNqtAAGTSVALASSTGTTatalaspHQAWAFTDIADLK 760 899999987778999***9999999*****999*******999888********9995536666666777777665544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1171 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 119.19 // Query: AYV32724.1|CBM13|GH30_5 [L=668] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.6e-22 65.3 0.1 2.8e-21 62.8 0.0 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -0.5 0.0 0.072 0.072 125 141 .. 151 167 .. 141 185 .. 0.63 2 ! 62.8 0.0 2.8e-21 2.8e-21 6 133 .. 531 664 .. 527 667 .. 0.82 Alignments for each domain: == domain 1 score: -0.5 bits; conditional E-value: 0.072 CBM13.hmm 125 gganQqWsvlksdlkik 141 + nQ+W +++++++ + AYV32724.1|CBM13|GH30_5 151 ADGNQRWWLKAAKARGA 167 34556665555555444 PP == domain 2 score: 62.8 bits; conditional E-value: 2.8e-21 CBM13.hmm 6 tyrlvnvnsgkcl.ggstaagan.vqlwdccn.ganQqWtltsdg........tirlenhqsgkcLdvaasstaagaevqqytcng 80 + lvn +sg+ l + s+ ag++ vq + ++ + +QqW lt+ ++r++n+ sg++L v a +++++ + AYV32724.1|CBM13|GH30_5 531 RRLLVNDHSGLALtAPSAGAGSTpVQHLP-DRlDPAQQWHLTRSVpgdwsstaAYRVTNAGSGRALAV------ADGALTLLPPGP 609 55699********7666677775599777.666788******44344555667*************97......345577777656 PP CBM13.hmm 81 ganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsv 133 +a+QqW l++ g+g y+++n a+g Ldv+g+ adg+pv ++ ++g nQ W++ AYV32724.1|CBM13|GH30_5 610 SAQQQWMLSTSGDGHYTLINSADGTLLDVTGAstADGAPVGTYRPTTGRNQSWTL 664 699*****9999********999*******99999******************76 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (668 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 150.51 // Query: BCY07070.1|CBM13|GH30_5 [L=985] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-16 47.5 0.0 1.4e-16 47.5 0.0 3.5 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.5 4.2 0.59 0.59 121 140 .. 125 143 .. 115 159 .. 0.66 2 ! 47.5 0.0 1.4e-16 1.4e-16 6 153 .. 510 633 .. 504 642 .. 0.86 3 ? -3.7 0.0 0.7 0.7 125 143 .. 789 808 .. 787 830 .. 0.68 Alignments for each domain: == domain 1 score: -3.5 bits; conditional E-value: 0.59 CBM13.hmm 121 wdcngganQqWsvlksdlki 140 w ++ ++nQ+W v + +++ BCY07070.1|CBM13|GH30_5 125 WNWDADPNQRWWVDQ-IKDK 143 555567778884433.3333 PP == domain 2 score: 47.5 bits; conditional E-value: 1.4e-16 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg.tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrles 90 yrl++v+sgk l a g ++++ + ++++Q Wt++++g ++r++n+ +g+ Ld Wr+++ BCY07070.1|CBM13|GH30_5 510 PYRLQGVASGKSL----APGLTIRTSS-ATATDQLWTFEPVGdAYRITNAGTGQTLD----------------------SLWRVST 568 589999*****99....6666666555.34577*********9****9998666666......................47***** PP CBM13.hmm 91 vgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgnn 153 +g+g+y+++n+ + Ldv+gg adg++v +++ ++g nQ+W+ +++ + ++ae++++ g+ BCY07070.1|CBM13|GH30_5 569 TGDGTYTLINVDARRLLDVNGGstADGATVGLYQPTSGGNQRWTAIDESIGALRTAETYTVPGRT 633 **********999*******999***********************9999999999999888775 PP == domain 3 score: -3.7 bits; conditional E-value: 0.7 CBM13.hmm 125 g.ganQqWsvlksdlkikli 143 g ++ Ws++ks++++++ BCY07070.1|CBM13|GH30_5 789 GdTTDKAWSNWKSADRNATD 808 43677889888887766543 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (985 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 73.69 // Query: QDO65129.1|CBM13|GH30_5 [L=688] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-19 56.3 5.6 2.7e-19 56.3 5.6 2.9 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 2.3 0.79 0.79 121 139 .. 144 162 .. 128 170 .. 0.69 2 ? -2.5 0.0 0.29 0.29 137 177 .. 422 462 .. 417 470 .. 0.76 3 ! 56.3 5.6 2.7e-19 2.7e-19 5 137 .. 543 683 .. 539 687 .. 0.78 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 0.79 CBM13.hmm 121 wdcngganQqWsvlksdlk 139 w n +a Q+W v + +++ QDO65129.1|CBM13|GH30_5 144 WNPNADATQRWWVDRIKKD 162 5555566677755555544 PP == domain 2 score: -2.5 bits; conditional E-value: 0.29 CBM13.hmm 137 dlkikliaekvipdgnnnilntqlpnivvlskNlesalivg 177 + ++++ ++++i g++ i ++ + sk ++a +v QDO65129.1|CBM13|GH30_5 422 KFDTARNFTHYIKPGDRLIKTDDTSSAAAVSKSGNGATVVH 462 55677888899999999999999999988888888887665 PP == domain 3 score: 56.3 bits; conditional E-value: 2.7e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan..vqlwdccn..ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 +ty l++v+sgk l +++g + +++++ + ++Q+W+l++ + ++ ++n gk L v +ga+v + + QDO65129.1|CBM13|GH30_5 543 HTYSLTGVQSGKALT-VADDGGKlvIKTASTDAatVTGQRWQLRQISgqtgnrqRYVFTNPVEGKRLAV-----RDGAPVLEAD-T 621 6899**********3.3345554224444433343467******6655666878888888888899997.....5888885555.4 PP CBM13.hmm 80 gg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 g ++ qW +++g+g+++++n+a+g+ L+v g+ adg+ v++w+ n+g+nQ+W+v++++ QDO65129.1|CBM13|GH30_5 622 GPrdTATQWIMSTTGDGTWTLVNAATGRLLEVGGQatADGSAVTIWTPNSGSNQRWTVSDVT 683 55667789*************************889999*****************998876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (688 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 51.25 // Query: QRY40063.1|CBM13|GH30_5 [L=1363] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-18 52.1 1.7 5.3e-18 52.1 1.7 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 0.7 0.79 0.79 124 136 .. 153 165 .. 148 174 .. 0.54 2 ! 52.1 1.7 5.3e-18 5.3e-18 5 145 .. 572 720 .. 568 731 .. 0.73 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 0.79 CBM13.hmm 124 ngganQqWsvlks 136 n +a Q+W +++ QRY40063.1|CBM13|GH30_5 153 NADATQRWWIEAL 165 3344455544444 PP == domain 2 score: 52.1 bits; conditional E-value: 5.3e-18 CBM13.hmm 5 gtyrlvnvnsgkclggst.aaga.nvqlwdcc.ngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 ty+l + +sgk l t ++ a +++ + + ++a Q+Wt +s + ++ l++ + g+ L ++g+++++ t + QRY40063.1|CBM13|GH30_5 572 ATYQLLGTQSGKAL---TvQNAAlTIRSSATTaDAATaQTWTAVSLSgagtdrqRVLLRSGD-GRYLA------SSGTSLTLATES 647 57999999******...313333334444433234555******876677665444444444.67887......699999999986 PP CBM13.hmm 80 gg.....anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliae 145 ++ qW ++ ++++y + n+as ++Ldv+gg +dgt v +w+ n+ganQ W++ + +++ ++ QRY40063.1|CBM13|GH30_5 648 AEqaaadPAAQWVPNTLDGRSYSFLNVASTRVLDVNGGgtSDGTSVGLWTSNNGANQSWTLAPTAIDTVADVT 720 33444444788**98777889***************888999*****************88777766665554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1363 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 197.25 // Query: AXL13272.1|CBM13|GH30_5 [L=1190] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-17 51.1 0.2 1.1e-17 51.1 0.2 2.4 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 0.3 0.8 0.8 80 89 .. 144 153 .. 127 162 .. 0.54 2 ! 51.1 0.2 1.1e-17 1.1e-17 6 142 .. 560 704 .. 556 720 .. 0.69 3 ? -1.2 0.2 0.12 0.12 52 86 .. 905 937 .. 872 972 .. 0.57 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 0.8 CBM13.hmm 80 gganQqWrle 89 +a Q+W+++ AXL13272.1|CBM13|GH30_5 144 ADATQRWWID 153 3344555553 PP == domain 2 score: 51.1 bits; conditional E-value: 1.1e-17 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdcc.ngan.QqWtltsdg.....tirlenhq.sgkcLdvaasstaagaevqqytcngg.. 81 +y+l +v+sgk l++s aga +++ + + ++a+ Q+Wt++s ++r+ + +g+ L s +a a v++ + ++ AXL13272.1|CBM13|GH30_5 560 SYQLFGVQSGKALAAS-GAGAVIRTSATTaDAAAaQTWTVQSLAgegtdRHRFALRAgDGRYLAE---SGGAVAVVSASAE-DAas 640 69999********433.344434444434244555******876566774454444434677762...2234444444444.3334 PP CBM13.hmm 82 .anQqWrlesvgsgy.ykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikl 142 ++ qW +++ +g+ + + ++++ ++Ldv+g+ adg+ v +w+ n+g+nQ+W++ + ++ +++ AXL13272.1|CBM13|GH30_5 641 dPALQWISSTT-DGTtFSLLSVSNERVLDVNGQssADGASVGLWTSNDGSNQRWTLADTEMLSVK 704 46789*66555.5644*****999*******989999*****************99888776655 PP == domain 3 score: -1.2 bits; conditional E-value: 0.12 CBM13.hmm 52 enhqsgkcLdva..asstaagaevqqytcngganQqW 86 +n+q L+ a asst ++a++ y++ g++ +W AXL13272.1|CBM13|GH30_5 905 KNAQ--DTLTYAlaASSTMQNAKLFFYKD--GSSNTW 937 2333..24553333445457777777774..333456 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1190 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 172.30 // Query: SDS89210.1|CBM13|GH30_5 [L=1008] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-18 51.9 6.6 5e-15 42.4 0.1 2.9 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.3 1.7 1 1 80 89 .. 139 148 .. 121 158 .. 0.66 2 ! 12.4 0.0 8.2e-06 8.2e-06 5 65 .. 528 594 .. 524 602 .. 0.69 3 ! 42.4 0.1 5e-15 5e-15 69 142 .. 635 713 .. 621 725 .. 0.79 Alignments for each domain: == domain 1 score: -4.3 bits; conditional E-value: 1 CBM13.hmm 80 gganQqWrle 89 +a+Q+W+++ SDS89210.1|CBM13|GH30_5 139 ADADQRWWID 148 2355666664 PP == domain 2 score: 12.4 bits; conditional E-value: 8.2e-06 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaas 65 ++yrl +v+sgk l +ta++ + +l++ + +a+Q W++t+ + ++++++ +gk L+v ++ SDS89210.1|CBM13|GH30_5 528 HVYRLDGVASGKSLTPDTAKT-TTVLRTPTAAADQLWSFTKLTgghtnqeRYEVTSPATGKRLTVRNN 594 568899999999994334433.4555664445779999996544666667888888888899998654 PP == domain 3 score: 42.4 bits; conditional E-value: 5e-15 CBM13.hmm 69 agaevqqyt.cngg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikl 142 aga v+ + g+ ++ qW l+++g+g++++ n+ sg+ +dv+g+ adg+pv +++ ++ganQ+W+v+++++ ++ SDS89210.1|CBM13|GH30_5 635 AGAVVRNSAaVAGDadPAAQWVLSTTGDGTWTLLNVGSGRLIDVTGQatADGSPVGTYTPTSGANQRWTVTDETVLRTD 713 55555444412333445678*************************989999********************99876655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1008 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 174.41 // Query: ADJ49196.1|CBM13|GH30_5 [L=661] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-21 63.0 1.3 2.4e-21 63.0 1.3 2.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.2 0.12 0.12 81 101 .. 136 149 .. 123 156 .. 0.69 2 ! 63.0 1.3 2.4e-21 2.4e-21 7 132 .. 530 657 .. 526 660 .. 0.83 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.12 CBM13.hmm 81 ganQqWrlesvgsgyykirnr 101 ++nQ+W+l + ki+nr ADJ49196.1|CBM13|GH30_5 136 DPNQRWWL--D-----KIKNR 149 36788877..3.....45554 PP == domain 2 score: 63.0 bits; conditional E-value: 2.4e-21 CBM13.hmm 7 yrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg..a 82 +++++v+sgk l s+++g+ vq ++ + +++Q+Wtlt+ + +++++n +g++L +ag++v++ + g + ADJ49196.1|CBM13|GH30_5 530 VTFTGVQSGKSL--SAENGSLVQ-RTTDAsATAQRWTLTDRTgrygnrdRFTITNTGTGQVLA------TAGGAVTLAAA-GPcdP 605 6788999***99..667776455.553543666******776688888999999999899998......58999988885.55666 PP CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWs 132 + qW+l+++g+g+++++n+a+g+ Ldv+g adg+++ +++ ++g+nQ+W+ ADJ49196.1|CBM13|GH30_5 606 AAQWTLSTTGDGTWTFVNAATGQLLDVTGEsrADGARIGLYKPTNGPNQRWQ 657 678*************************878********************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (661 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 155.50 // Query: QIJ60663.1|CBM13 [L=172] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-39 121.6 7.8 2.1e-38 118.6 7.8 1.9 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 118.6 7.8 2.1e-38 2.1e-38 7 133 .. 37 171 .. 33 172 .] 0.89 Alignments for each domain: == domain 1 score: 118.6 bits; conditional E-value: 2.1e-38 CBM13.hmm 7 yrlvnvnsgkclggst...aaganvqlwdccnganQqWtltsdg..tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvgsg 94 ++l +sg+cl+ t a+ga vq+w+c ++anQ+Wt+ts g ++++ +sgkcLdva s+a+g++v+q++c ++ nQ W+l + ++g QIJ60663.1|CBM13 37 TKLEAHHSGRCLDVATasqADGAFVQQWECYSTANQNWTFTSLGngYYKVSADHSGKCLDVAEASQADGGTVHQWHCYNTLNQEWKLVQRPNG 129 5788889*****555532255555*****888899******99999***99999********55669********************9999** PP CBM13.hmm 95 yykirnrasgkcLdvkgg..adgtpvqqwdcng.ganQqWsv 133 y++++ r+sgkcL+v+gg +g+ +q +c+ +++Q W++ QIJ60663.1|CBM13 130 YFTLVARHSGKCLEVAGGsiYNGAGAVQRTCSAdRPYQEWRL 171 ****************999999*********999******75 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (172 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 16.82 // Query: QFR02391.1|CBM13|GH30_5 [L=1049] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-21 64.2 0.0 1e-21 64.2 0.0 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.1 1.3 0.93 0.93 123 131 .. 135 143 .. 126 158 .. 0.54 2 ! 64.2 0.0 1e-21 1e-21 7 150 .. 529 678 .. 524 686 .. 0.85 Alignments for each domain: == domain 1 score: -4.1 bits; conditional E-value: 0.93 CBM13.hmm 123 cngganQqW 131 ++ ++ Q+W QFR02391.1|CBM13|GH30_5 135 WDADSGQRW 143 222222333 PP == domain 2 score: 64.2 bits; conditional E-value: 1e-21 CBM13.hmm 7 yrlvnvnsgkclggstaaganvqlwdccngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg..a 82 rl++++sgk l + ++g++v+l++ + +++ Q W++++ + +++l+n+++g L v ++ +v + +g+ + QFR02391.1|CBM13|GH30_5 529 HRLQGAQSGKSL-APSEDGTGVVLRTTDAAQArQLWSVERLTpgsgnraRYTLTNADTGGRLAV-----RDNQAVLEDPADGAvpD 608 5789999*****.56699999*****5555555******66666778889*******7568887.....35556777777677998 PP CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipd 150 + qW +++g+g+++++n+a+g+ Ldv+g+ adg++v +++ +++anQ+W+v+++++ ++++ae++++ QFR02391.1|CBM13|GH30_5 609 AAQWVMSTTGDGSWTFVNAATGRLLDVTGQssADGAKVSTYTPTSAANQRWAVSDETVLSTEQAEAFTVP 678 899*************************989999************************999999988765 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1049 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 177.89 // Query: APF34155.1|CBM13|GH30_5 [L=1287] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-16 46.7 0.3 2.4e-16 46.7 0.3 2.4 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.4 0.3 1 1 81 89 .. 147 155 .. 141 167 .. 0.52 2 ? -1.1 0.0 0.11 0.11 132 176 .. 428 472 .. 394 477 .. 0.78 3 ! 46.7 0.3 2.4e-16 2.4e-16 5 141 .. 563 706 .. 560 717 .. 0.71 Alignments for each domain: == domain 1 score: -4.4 bits; conditional E-value: 1 CBM13.hmm 81 ganQqWrle 89 +++Q+W+l+ APF34155.1|CBM13|GH30_5 147 DSAQRWWLD 155 334444442 PP == domain 2 score: -1.1 bits; conditional E-value: 0.11 CBM13.hmm 132 svlksdlkikliaekvipdgnnnilntqlpnivvlskNlesaliv 176 +++++ ++++ ++++i+ g++ i++++ +++ e+a iv APF34155.1|CBM13|GH30_5 428 VLTNEKFNTVRNFTHYITPGDRLIATDNAESTAAIDADGEGATIV 472 5677888899999***************99999888888887776 PP == domain 3 score: 46.7 bits; conditional E-value: 2.4e-16 CBM13.hmm 5 gtyrlvnvnsgkclggstaaga.nvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg 81 +t++l++ +sg+ l+gs + ++ + + + +++Q Wt+++ +++l+n sg+ L ++ +a a v + + + APF34155.1|CBM13|GH30_5 563 ETVQLTGLQSGLALDGSSTLAVrSLATTP--DaARGQAWTVRTIAgagtnrhRFTLQNG-SGQFLASSG---TATALVDADPAAAA 642 57899999******544433331355444..43577******66446678455566555.578998322...24444444443322 PP CBM13.hmm 82 ..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkik 141 ++ qW +++++ yy + n+a ++Ldv gg + g+ v +w+ ngg nQqW++ ++ + APF34155.1|CBM13|GH30_5 643 tdPALQWMASTTDGAYYSVLNVAAERVLDVGGGstTPGASVGLWTSNGGGNQQWRIASTTVAGT 706 336789*999887789***************999666*****************9988776655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1287 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 166.18 // Query: CAJ89702.1|CBM13|GH30_5 [L=682] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-18 54.5 0.9 1e-18 54.5 0.9 2.4 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.6 0.4 0.4 124 136 .. 145 157 .. 140 177 .. 0.62 2 ! 54.5 0.9 1e-18 1e-18 5 138 .. 541 678 .. 537 681 .. 0.76 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.4 CBM13.hmm 124 ngganQqWsvlks 136 + +a Q+W v++ CAJ89702.1|CBM13|GH30_5 145 DADATQRWWVERI 157 2244455544443 PP == domain 2 score: 54.5 bits; conditional E-value: 1e-18 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccngan.QqWtltsdgtirlenhqsgkcLdvaassta.agaevqqytc.......ngg 81 +ty+l++v+sgk + + +++g+ ++l + + a+ Q+W+l+++ ++sg +Ld +++ +g+++ + ++ +g+ CAJ89702.1|CBM13|GH30_5 541 HTYTLTGVQSGKAV-TVGENGTDLVLGTEAG-AGaQRWRLSAVR------QDSG-VLDRHVFTNPqDGTRLAVRDDvpvtepdTGK 617 689*********99.5559999999999445.555******554......2233.6665445444567777666664444443455 PP CBM13.hmm 82 ..anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlksdl 138 + W +++g+g+++++n+ +g+ L+v g+ ++ g+ v++w+ n+ganQ+W+v+++++ CAJ89702.1|CBM13|GH30_5 618 rdRAAEWIMSTTGDGTWTLVNAGTGRLLEVGGQaTHeGAAVTTWPPNSGANQRWTVTDVTT 678 544678***************999*******9885569******************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (682 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 55.89 // Query: QUW89222.1|CBM13|GH30_5 [L=679] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.3e-16 45.9 7.9 6.8e-16 45.2 1.9 2.7 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.5 0.38 0.38 124 136 .. 145 157 .. 140 172 .. 0.58 2 ! 45.2 1.9 6.8e-16 6.8e-16 5 136 .. 541 676 .. 538 678 .. 0.77 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.38 CBM13.hmm 124 ngganQqWsvlks 136 + +a Q+W v++ QUW89222.1|CBM13|GH30_5 145 DADATQRWWVERI 157 2244455544444 PP == domain 2 score: 45.2 bits; conditional E-value: 6.8e-16 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 +ty+l++v+sgk + + + +g+n++l + ++++ qW+l+++ ++ +++ +g L v + +v + +++g QUW89222.1|CBM13|GH30_5 541 HTYTLTGVQSGKAV-TVAGDGTNLVLGTGADASAEQWRLSAVRqdggvrdRYVFTRPGDGTRLAV-----RDDVPV-AEPDTGRrd 619 589*********99.4558999999999445555******5554557888777777776778876.....233333.333445554 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlks 136 + W +s+g+g+++++n+a+g+ L+v g+ ++ g+ v++w+ n+ganQ+W+++++ QUW89222.1|CBM13|GH30_5 620 RAAEWMASSTGDGTWTLVNAATGRLLEVGGQaTHaGAAVTTWPPNSGANQRWTLTDV 676 4568*************************9885559****************99875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (679 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 52.79 // Query: QEV26696.1|CBM13|GH30_5 [L=683] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-17 48.9 1.9 5.1e-17 48.9 1.9 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.7 0.9 0.68 0.68 121 137 .. 145 161 .. 142 169 .. 0.58 2 ! 48.9 1.9 5.1e-17 5.1e-17 5 137 .. 544 681 .. 539 683 .] 0.80 Alignments for each domain: == domain 1 score: -3.7 bits; conditional E-value: 0.68 CBM13.hmm 121 wdcngganQqWsvlksd 137 w ++ + Q+W v + + QEV26696.1|CBM13|GH30_5 145 WNRHADKTQRWWVDRIK 161 44455555666554444 PP == domain 2 score: 48.9 bits; conditional E-value: 5.1e-17 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.gan.QqWtltsdg......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +tyrl++v+sgk l + +++g+++++ + + + + QqW++++ ++ ++ s+k L v +++++ ++ g QEV26696.1|CBM13|GH30_5 544 HTYRLTGVQSGKDL-TLADNGTGLVIKSANAaDPSgQQWRVEQIRgtdnrkRYVFTETASDKRLAV------RDGALVAEPDEGRr 622 689*********88.455899996666656455556******664466677788888887788886......44556677765667 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlksd 137 ++ W +++g+g+++++n+a+g+ dv g+ ++ g+ v +w+ n+g+nQ+W+v++++ QEV26696.1|CBM13|GH30_5 623 dKATEWIMSTTGDGTWTLVNAATGQLPDVGGQsTNeGASVGLWQPNSGSNQRWKVTDVT 681 66779*************************9996669*****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (683 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 161.78 // Query: QUB98532.1|CBM13|GH30_5 [L=1199] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-17 48.8 1.8 6.2e-17 48.6 0.0 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.7 2.2 1 1 121 135 .. 178 192 .. 168 206 .. 0.64 2 ! 48.6 0.0 6.2e-17 6.2e-17 6 152 .. 583 740 .. 578 750 .. 0.82 Alignments for each domain: == domain 1 score: -4.7 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlk 135 wd + +a Q+W v + QUB98532.1|CBM13|GH30_5 178 WDEDADATQRWWVDR 192 554445556664433 PP == domain 2 score: 48.6 bits; conditional E-value: 6.2e-17 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg..........tirlenhqsgkcLdvaasstaagaevqqytcng 80 yrl +v+ ++ l + a+g++v++++ + a+Q W+lt+ g ++ ++n+ +g+ L va a+ ++v q + + QUB98532.1|CBM13|GH30_5 583 AYRLDGVQADRSL-APSASGTGVVIRT-DApVAEQAWELTALGapegsgthrtRYAVTNAATGRQLAVA----ADTSAVLQDAPAD 662 6889999999999.5558888988888.655788******77777778888889999999988999985....4555566666443 PP CBM13.hmm 81 g....anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgn 152 + qW l+++g+g+++++n++s+ L+v g+ adg+pv ++ n+g nQ+W+v ++++ ++ ++++++ g+ QUB98532.1|CBM13|GH30_5 663 VadtpLAAQWILSTTGDGTFTLVNASSKTLLEVGGQatADGSPVGTYLANSGVNQRWRVVDETVLGTEPVQAFTTPGT 740 322244778***************999*******889999***********************999999998888776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1199 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 178.58 // Query: QGQ44778.1|CBM13|CBM71|GH30_5 [L=1078] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-21 61.1 6.6 9e-21 61.1 6.6 4.3 4 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.0 0.9 0.026 0.026 121 147 .. 168 194 .. 157 205 .. 0.74 2 ? -2.7 1.2 0.34 0.34 86 134 .. 271 314 .. 202 338 .. 0.52 3 ! 2.4 2.0 0.0095 0.0095 41 171 .. 392 522 .. 366 530 .. 0.57 4 ! 61.1 6.6 9e-21 9e-21 5 152 .. 553 703 .. 549 718 .. 0.81 Alignments for each domain: == domain 1 score: 1.0 bits; conditional E-value: 0.026 CBM13.hmm 121 wdcngganQqWsvlksdlkikliaekv 147 w ++ +anQ+W v++++++ ++++e++ QGQ44778.1|CBM13|CBM71|GH30_5 168 WNWEADANQRWWVSAAKARGADTFEAF 194 777778888888888887777777665 PP == domain 2 score: -2.7 bits; conditional E-value: 0.34 CBM13.hmm 86 WrlesvgsgyykirnrasgkcLdvkggadgtpvq.qwdcng.ganQqWsvl 134 W s+ ki+n + +k Ld kg + t v + + n + Q+W + QGQ44778.1|CBM13|CBM71|GH30_5 271 WSPASQ----AKIIN-EVKKQLDEKG-LN-TAVSaMDETNPqKFRQNWEQY 314 333222....34444.2234444332.11.222201111221112333322 PP == domain 3 score: 2.4 bits; conditional E-value: 0.0095 CBM13.hmm 41 Wtltsdg...tirlenhqsgkcLdva.asstaagaevqqytcngg.anQqW.rlesvgsgyykirnrasgkcLdvkggad 114 W+ d+ + + en + g +v+ ++ a+ ++v +y++ a + +++ g y+++n ++ L + +++ QGQ44778.1|CBM13|CBM71|GH30_5 392 WQAIEDEvnmSPEHENSNWG-LIQVDfNP--ANFGNVEIYKNKKYyAMGNYsKFIRP--G-YQVINSNNSSTLAAVNKDK 465 55555544332233444423.56666554..57788888886333422222234333..4.4555555555555553344 PP CBM13.hmm 115 gtpvqqwdcngganQqWsvlksdlkikliaekvipdgnnnilntqlpnivvlskNle 171 + v++++++++ ++ s ++++++ k++p + + n ++v s + QGQ44778.1|CBM13|CBM71|GH30_5 466 DSVVVVYTNSTTEEKAINFDLSGFETVKTSAKATPYVTSKTDNLVQKSDVTISDKKL 522 567888888777777777777777777777777777666666666666666666555 PP == domain 4 score: 61.1 bits; conditional E-value: 9e-21 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqy 76 ++y+++n+nsgk+l+ +++g+++++ + + +Q++++++ + ++++n+ +g +L v +g+ v+++ QGQ44778.1|CBM13|CBM71|GH30_5 553 EEYKFINKNSGKVLD-IGQDGKAIVQKTNIRdEESQNFSIQKMTdgnstkeIYKIVNNANGSVLGV-----ENGS-VILQ 625 689***********3.4478888666663353566******444447778889999999989**97.....3555.5555 PP CBM13.hmm 77 tcngganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgn 152 ++ +++nQ+W l+++g+g y+++n+++g L+v g + g++v +w + g+ QqW+v +s ++++ + v+++++ QGQ44778.1|CBM13|CBM71|GH30_5 626 NNEDSPNQKWMLSTYGNGEYTFINVQDGNLLEVGGEskEEGAKVGVWNPTAGNHQQWKVVNSGITKVEPVDVVVTKKK 703 5569******************************878777********999*********999999988888877665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1078 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 29.66 // Query: QUF05859.1|CBM13|GH30_5 [L=656] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-18 54.0 0.2 3.1e-18 52.9 0.2 1.6 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 52.9 0.2 3.1e-18 3.1e-18 5 134 .. 526 654 .. 522 656 .] 0.81 Alignments for each domain: == domain 1 score: 52.9 bits; conditional E-value: 3.1e-18 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcnggan 83 yrl++v+sgk l + +g+++++++ + a+Q W+l++ + ++ ++n+ +g+ L a ++e ++ + +g+ QUF05859.1|CBM13|GH30_5 526 DAYRLTGVQSGKSL---APSGNSLVQRNSAEVADQYWRLERLDngfgnrvRFAVVNAGTGQRLA------AVNGEAVLRSA-DGPE 601 679*********99...45556666666345788******665568887777777777788887......44445556664.7999 PP CBM13.hmm 84 QqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvl 134 +W +s+g+g+++++n+a+g Ldv g+ adg++v +++ ++g+nQ+W+ + QUF05859.1|CBM13|GH30_5 602 ARWITSSTGDGTWTLVNAATGAMLDVVGQstADGAKVGLYTPTSGPNQRWTAT 654 9**************************9899*******************865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (656 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 153.37 // Query: QMV12159.1|CBM13|GH30_5 [L=1052] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-22 65.4 0.0 4.4e-22 65.4 0.0 2.2 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.7 3.5 1 1 77 92 .. 134 149 .. 124 161 .. 0.56 2 ! 65.4 0.0 4.4e-22 4.4e-22 5 155 .. 527 683 .. 523 694 .. 0.79 Alignments for each domain: == domain 1 score: -4.7 bits; conditional E-value: 1 CBM13.hmm 77 tcngg.anQqWrlesvg 92 + g+ a Q+W++++v+ QMV12159.1|CBM13|GH30_5 134 DW-GAdAGQRWWVDQVK 149 32.22244555544443 PP == domain 2 score: 65.4 bits; conditional E-value: 4.4e-22 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 ++yrl++++sgk l + ++g++v++++ ++ +a+Q W++++ + ++ l+++ gk L v + +v + + + + QMV12159.1|CBM13|GH30_5 527 HVYRLQGAHSGKSL-TPSEDGSGVVIRTTDQaSAEQLWSVRQLTpgndhseRYALTSATHGKRLAV-----RDDQAVLLDPADTAp 606 5799**********.44588888888885554566******5544444455666666665566665.....366677777765556 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgnnni 155 ++ qW l+++g+g+++++n+a+g+ Ldv+g+ adg++v +++ +++anQ+W+ +++++ +++ae +++ g + + QMV12159.1|CBM13|GH30_5 607 dPAAQWILSTTGDGTWTFVNAATGRLLDVAGQstADGARVSTYTPTSAANQRWAATDETVLRTKQAEVFTVPGLAPK 683 66789*************************9899*************************999999998888776655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1052 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 163.87 // Query: BCW57733.1|CBM13|GH30_5|GH43_24 [L=1430] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-15 42.7 3.5 4e-15 42.7 3.5 2.6 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 42.7 3.5 4e-15 4e-15 5 137 .. 571 710 .. 567 753 .. 0.73 2 ? -2.6 0.2 0.32 0.32 107 127 .. 1112 1133 .. 1042 1146 .. 0.63 3 ? -2.1 0.1 0.23 0.23 8 46 .. 1337 1372 .. 1332 1420 .. 0.57 Alignments for each domain: == domain 1 score: 42.7 bits; conditional E-value: 4e-15 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan.vqlwdccnganQqWtlt....sdg....tirlenhqsgkcLdvaasstaagaev 73 ++y +v+v+sg+ + s+++g++ +l d g+nQ W+ t dg ++ l+ + +g++L ++++g+++ BCW57733.1|CBM13|GH30_5|GH43_24 571 QSYSFVGVQSGRAV--SASDGSPkTVLSDSVAGGNQVWKATliadEDGttrdRFVLRLA-DGRALA----ADSNGTTL 641 67999*******88..7888886688888455799******887744466444444333.478998....56899999 PP CBM13.hmm 74 qqytcngg...anQqWrlesvgsgyykirnras.gkcLdvkgg.ad.gtpvqqwdcngganQqWsvlksd 137 + t+ + ++ qW ++++++ ++ + n a ++Ldv+++ ++ g+ + +w+ ngganQ +++ +++ BCW57733.1|CBM13|GH30_5|GH43_24 642 RSITDEEArtdSSAQWLFSTTDGSSFSLLN-AGlHQVLDVSNNsTHeGAWIGLWTSNGGANQTFTLRNAS 710 888876555555679***9886667*****.5549******9995559**************99765544 PP == domain 2 score: -2.6 bits; conditional E-value: 0.32 CBM13.hmm 107 Ldvkgg.adgtpvqqwdcngga 127 ++v+++ ++ t+ ++w+ +g++ BCW57733.1|CBM13|GH30_5|GH43_24 1112 VTVTQNgQSSTQPVTWQVSGNT 1133 2333332333444444444433 PP == domain 3 score: -2.1 bits; conditional E-value: 0.23 CBM13.hmm 8 rlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsd 46 +++ v+s kc++g+ + + ql + n +++ q t+ts+ BCW57733.1|CBM13|GH30_5|GH43_24 1337 KVTAVASTKCVAGKVTVT--AQLTN--NdTKSVQATFTSV 1372 667788999992222222..23333..3234455555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1430 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 171.48 // Query: AQX81122.1|CBM13|GH30_5 [L=1302] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7e-15 41.9 3.1 2.3e-14 40.3 3.1 1.8 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 40.3 3.1 2.3e-14 2.3e-14 6 143 .. 579 729 .. 575 746 .. 0.75 Alignments for each domain: == domain 1 score: 40.3 bits; conditional E-value: 2.3e-14 CBM13.hmm 6 tyrlvnvnsgkclggstaaga...n.vqlwdcc.n.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytc 78 y+lv+++s k + t++g+ + ++ ++ + + ga+Q Wt ++ + ++ +++ + g L+ +++ag+++++ t+ AQX81122.1|CBM13|GH30_5 579 AYQLVGKQSAKAFTAATTTGTvpaGtITPRASDaTtGAAQVWTAERLSgggtntdRYAVRSSS-GALLS----ANSAGTSLVAATR 659 699********9955555554444324433323233677******665567776677877775.67888....5579********9 PP CBM13.hmm 79 ngg...anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikli 143 + ++ qW +++++ ++ ++n+ + ++L+v g+ + g+ v +++ n+ganQ W++ + +l+ ++ AQX81122.1|CBM13|GH30_5 660 EQAaadPSLQWIPTTTDGSAWSLVNVGTSQALEVGGQstTTGAAVGVYQSNNGANQTWNFVDTALTGVQP 729 7776545779*998885556******99*******989666******************99988776655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1302 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 195.55 // Query: AKZ53845.1|CBM13|GH30_5 [L=682] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-18 54.5 0.9 1e-18 54.5 0.9 2.4 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.6 0.4 0.4 124 136 .. 145 157 .. 140 177 .. 0.62 2 ! 54.5 0.9 1e-18 1e-18 5 138 .. 541 678 .. 537 681 .. 0.76 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.4 CBM13.hmm 124 ngganQqWsvlks 136 + +a Q+W v++ AKZ53845.1|CBM13|GH30_5 145 DADATQRWWVERI 157 2244455544443 PP == domain 2 score: 54.5 bits; conditional E-value: 1e-18 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccngan.QqWtltsdgtirlenhqsgkcLdvaassta.agaevqqytc.......ngg 81 +ty+l++v+sgk + + +++g+ ++l + + a+ Q+W+l+++ ++sg +Ld +++ +g+++ + ++ +g+ AKZ53845.1|CBM13|GH30_5 541 HTYTLTGVQSGKAV-TVGENGTDLVLGTEAG-AGaQRWRLSAVR------QDSG-VLDRHVFTNPqDGTRLAVRDDvpvtepdTGK 617 689*********99.5559999999999445.555******554......2233.6665445444567777666664444443455 PP CBM13.hmm 82 ..anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlksdl 138 + W +++g+g+++++n+ +g+ L+v g+ ++ g+ v++w+ n+ganQ+W+v+++++ AKZ53845.1|CBM13|GH30_5 618 rdRAAEWIMSTTGDGTWTLVNAGTGRLLEVGGQaTHeGAAVTTWPPNSGANQRWTVTDVTT 678 544678***************999*******9885569******************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (682 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 53.29 // Query: AVV46333.1|CBM13|GH30_5 [L=1082] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-20 60.4 0.0 1.5e-20 60.4 0.0 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -5.0 2.7 1 1 79 89 .. 165 175 .. 151 188 .. 0.55 2 ! 60.4 0.0 1.5e-20 1.5e-20 6 150 .. 557 707 .. 552 717 .. 0.83 Alignments for each domain: == domain 1 score: -5.0 bits; conditional E-value: 1 CBM13.hmm 79 ngganQqWrle 89 + +a Q+W+++ AVV46333.1|CBM13|GH30_5 165 DADAGQRWWVD 175 11233333332 PP == domain 2 score: 60.4 bits; conditional E-value: 1.5e-20 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 +yrl++ +sgk l + ++g++v+l++ + +a+Q W++++ + ++ l + +g L v g +v ++ gg AVV46333.1|CBM13|GH30_5 557 VYRLQGTQSGKSL-APSDTGSGVVLRTDDAgSAQQLWSVRKLTrgtgnreRYALARTGTGELLAV-----REGQAVLEKPEKGGva 636 799**********.44467777999994443566******6655566777777777777888887.....5899999999999997 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipd 150 + qW +++g+g+++++n+a+g+ Ldv+g+ adg++v +++ +++anQ+Wsv ++++ ++ a ++++ AVV46333.1|CBM13|GH30_5 637 EAAQWIMSTTGDGTWTFVNAATGRLLDVAGQstADGAKVSTYTPTSAANQRWSVIDETVLRTEAADAFTVP 707 6679*************************9899***********************999988888777665 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1082 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 176.81 // Query: QFI47144.1|CBM13|GH30_5 [L=691] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-13 36.5 10.6 1e-12 34.9 0.5 2.7 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.1 0.7 0.44 0.44 124 136 .. 145 157 .. 140 171 .. 0.57 2 ! 8.2 0.1 0.00015 0.00015 47 93 .. 540 596 .. 531 624 .. 0.69 3 ! 34.9 0.5 1e-12 1e-12 83 136 .. 633 688 .. 587 690 .. 0.86 Alignments for each domain: == domain 1 score: -3.1 bits; conditional E-value: 0.44 CBM13.hmm 124 ngganQqWsvlks 136 + +a Q+W v++ QFI47144.1|CBM13|GH30_5 145 DADATQRWWVERI 157 2244455544444 PP == domain 2 score: 8.2 bits; conditional E-value: 0.00015 CBM13.hmm 47 g.tirlenhqsgkcLdvaasstaagaevqqytcngga............nQqWrlesvg.s 93 g t++l+ +qsgk+++va a+g+++++ t +g++ + qWrl+ v + QFI47144.1|CBM13|GH30_5 540 GhTYTLTGVQSGKAVTVA----ADGTNLVLGTGTGTGtgtgtgtgtdpsARQWRLSAVRhD 596 347899999999999973....678888888875442233444445555788888777543 PP == domain 3 score: 34.9 bits; conditional E-value: 1e-12 CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 + W +s+g+g+++++n +g+ L+v g+ dg+ v++w+ n+ganQ+W+++++ QFI47144.1|CBM13|GH30_5 633 AAEWLASSTGDGTWTLVNSGTGRLLEVGGQatHDGAAVTTWPPNSGANQRWTLTDV 688 457***************999*******989777*****************99875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (691 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 51.79 // Query: QCD60107.1|CBM13|GH30_5 [L=1058] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-18 52.5 0.0 3.9e-18 52.5 0.0 2.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.7 3.8 1 1 121 136 .. 143 158 .. 128 171 .. 0.56 2 ! 52.5 0.0 3.9e-18 3.9e-18 5 152 .. 537 686 .. 533 695 .. 0.82 Alignments for each domain: == domain 1 score: -4.7 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlks 136 wd++ +a Q+W v ++ QCD60107.1|CBM13|GH30_5 143 WDWSADAGQRWWVDRV 158 4433344444433222 PP == domain 2 score: 52.5 bits; conditional E-value: 3.9e-18 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.gan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg 81 ++yrl++++sgk l + a+g++v++++ + +a+ Q W++++ + ++ l+n+ +g+ + v e ++ + ++ QCD60107.1|CBM13|GH30_5 537 HVYRLQGAQSGKSL-APSAEGSGVVVRTA-DpAAKsQLWSVKQLTrgdgnreRYALVNAADGRRMAV------RDDEAVLEDG-DT 613 5799**********.45577777888884.445555******6655566777888888887777776......3445566664.67 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgn 152 ++ qW +++g+g+++++n+a+g+ Ldv g+ adg++v + +++anQ+W v+++++ ++ a+++++ g+ QCD60107.1|CBM13|GH30_5 614 PAAQWIMSTTGDGTWTFVNAATGRLLDVVGQstADGARVSAHLPTSNANQRWGVSDETVLRTQPAKAFTVPGR 686 7889*************************9899**********999************999999998888776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1058 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 171.18 // Query: QDO54955.1|CBM13|GH30_5 [L=688] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-19 56.3 5.6 2.7e-19 56.3 5.6 2.9 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 2.3 0.79 0.79 121 139 .. 144 162 .. 128 170 .. 0.69 2 ? -2.5 0.0 0.29 0.29 137 177 .. 422 462 .. 417 470 .. 0.76 3 ! 56.3 5.6 2.7e-19 2.7e-19 5 137 .. 543 683 .. 539 687 .. 0.78 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 0.79 CBM13.hmm 121 wdcngganQqWsvlksdlk 139 w n +a Q+W v + +++ QDO54955.1|CBM13|GH30_5 144 WNPNADATQRWWVDRIKKD 162 5555566677755555544 PP == domain 2 score: -2.5 bits; conditional E-value: 0.29 CBM13.hmm 137 dlkikliaekvipdgnnnilntqlpnivvlskNlesalivg 177 + ++++ ++++i g++ i ++ + sk ++a +v QDO54955.1|CBM13|GH30_5 422 KFDTARNFTHYIKPGDRLIKTDDTSSAAAVSKSGNGATVVH 462 55677888899999999999999999988888888887665 PP == domain 3 score: 56.3 bits; conditional E-value: 2.7e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan..vqlwdccn..ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 +ty l++v+sgk l +++g + +++++ + ++Q+W+l++ + ++ ++n gk L v +ga+v + + QDO54955.1|CBM13|GH30_5 543 HTYSLTGVQSGKALT-VADDGGKlvIKTASTDAatVTGQRWQLRQISgqtgnrqRYVFTNPVEGKRLAV-----RDGAPVLEAD-T 621 6899**********3.3345554224444433343467******6655666878888888888899997.....5888885555.4 PP CBM13.hmm 80 gg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 g ++ qW +++g+g+++++n+a+g+ L+v g+ adg+ v++w+ n+g+nQ+W+v++++ QDO54955.1|CBM13|GH30_5 622 GPrdTATQWIMSTTGDGTWTLVNAATGRLLEVGGQatADGSAVTIWTPNSGSNQRWTVSDVT 683 55667789*************************889999*****************998876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (688 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 52.02 // Query: QOV33864.1|CBM13|GH30_5 [L=676] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-21 62.0 0.3 5e-21 62.0 0.3 2.2 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 4.0 0.4 0.4 78 89 .. 142 153 .. 130 167 .. 0.64 2 ! 62.0 0.3 5e-21 5e-21 5 137 .. 534 672 .. 530 676 .] 0.82 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.4 CBM13.hmm 78 cngganQqWrle 89 +anQ+W+++ QOV33864.1|CBM13|GH30_5 142 WAADANQRWWID 153 323355555553 PP == domain 2 score: 62.0 bits; conditional E-value: 5e-21 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +tyrl++v+sg+ l + +++g+++++++ +++a+ Q W++++ + ++ l+n +gk L +g +v + + QOV33864.1|CBM13|GH30_5 534 HTYRLQGVESGRSL-APNDDGTGLVIRTTDTAADaQLWSVRKLShgdsnreRYALVNSATGKRLAM-----RDGQAVLEDPG--Sa 611 589***********.66689999777774566666******6655677888999999998999983.....47777766664..33 PP CBM13.hmm 82 ...anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 + qW +++g+g+++++n+a+g+ Ldv+g adg++v++w+ ++ganQ+W+v++++ QOV33864.1|CBM13|GH30_5 612 padRAAQWIMSTTGDGTWTFVNAATGRLLDVAGHatADGSRVTTWTPTSGANQRWAVTDET 672 4443568*************************889999******************99886 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (676 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 146.86 // Query: QIZ00311.1|CBM13|GH30_5 [L=685] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-20 57.9 4.5 8.8e-20 57.9 4.5 2.5 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 2.4 0.81 0.81 121 139 .. 144 162 .. 129 170 .. 0.68 2 ! 57.9 4.5 8.8e-20 8.8e-20 5 136 .. 543 682 .. 537 685 .] 0.79 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 0.81 CBM13.hmm 121 wdcngganQqWsvlksdlk 139 w n +a Q+W v + +++ QIZ00311.1|CBM13|GH30_5 144 WNPNADATQRWWVDRIKKD 162 5555566677765555544 PP == domain 2 score: 57.9 bits; conditional E-value: 8.8e-20 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan.vqlwdcc.n...ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytc 78 +ty l++v+sgk l + +++g++ v+ ++ + ++Q+W+l++ + ++ ++n gk L v +ga+v + t+ QIZ00311.1|CBM13|GH30_5 543 HTYSLTGVQSGKAL-TVADDGSKlVI-RTTGtDaatVTGQRWQLRQISgrtgnrqRYVFTNPVEGKRLAV-----RDGAPV-LETD 620 6899**********.44477776333.332222333467******7655666777888888888899987.....578887.6666 PP CBM13.hmm 79 ngg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 +g a+ qW +++g+g+++++n+a+g+ L+v g+ adg+ v++w+ n+g+nQ+W+v+++ QIZ00311.1|CBM13|GH30_5 621 TGPrdAATQWIMSTTGDGTWTLVNAATGRLLEVGGQatADGSAVTIWTPNSGSNQRWTVSDV 682 676778899*************************889999*****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (685 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 56.96 // Query: AZZ53709.1|CBM13|GH30_5 [L=1227] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-19 56.5 1.1 2.3e-19 56.5 1.1 2.7 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 0.3 0.8 0.04 0.04 96 140 .. 136 178 .. 103 196 .. 0.65 2 ! 56.5 1.1 2.3e-19 2.3e-19 5 142 .. 587 735 .. 584 747 .. 0.75 3 ? -3.3 0.8 0.5 0.5 69 78 .. 954 963 .. 919 1003 .. 0.51 Alignments for each domain: == domain 1 score: 0.3 bits; conditional E-value: 0.04 CBM13.hmm 96 ykirnras.gkcLdvkggadgtpvqqwdcngganQqWsvlksdlki 140 ++ +n+a+ + L + + + +d++++ Q+W v+k + ++ AZZ53709.1|CBM13|GH30_5 136 GTSTNYADrDALLAKW---NAGDASSYDWTSDETQRWWVEKLAEEK 178 4556666644555555...334566788888888888666655444 PP == domain 2 score: 56.5 bits; conditional E-value: 2.3e-19 CBM13.hmm 5 gtyrlvnvnsgkcl.ggstaagan.vqlwdccn.ganQqWtltsdg........tirlenhqsgkcLdvaasstaagaevqqytcn 79 ++y+lv+ +sgk l g+ t a ++ +l++ + +a+Q Wt++ + ++ l+n++ g++L +t+ag+ ++ + + AZZ53709.1|CBM13|GH30_5 587 HRYQLVGTQSGKALtGNPTGAATTiTTLATDSTaAAKQSWTVREVApgereatrRVVLQNAD-GRVLG----ATSAGTDLRTLSVD 667 589***********76666666664667773454555******7767788864444444444.79**9....56888888888874 PP CBM13.hmm 80 gg...anQqWrlesvgsgy.ykirnras.gkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikl 142 + a+ +W ++++ +g+ y+++n +s g+ Ldv+g+ + t+v ++ ngganQ W++ + + ++++ AZZ53709.1|CBM13|GH30_5 668 AAkadAATRWIVSTT-DGTaYTLVN-ESiGLSLDVNGQssTENTTVGVYGSNGGANQSWTLRDLAPSAAQ 735 44556789***9877.5555*****.888*******8875447****************99877666554 PP == domain 3 score: -3.3 bits; conditional E-value: 0.5 CBM13.hmm 69 agaevqqytc 78 ++ +vq + + AZZ53709.1|CBM13|GH30_5 954 QQVSVQFQRD 963 2222322222 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1227 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 154.28 // Query: QVI62156.1|CBM13|GH30_5 [L=1263] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-14 40.4 0.0 6.7e-14 38.7 0.0 1.8 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 38.7 0.0 6.7e-14 6.7e-14 5 134 .. 581 721 .. 578 736 .. 0.73 Alignments for each domain: == domain 1 score: 38.7 bits; conditional E-value: 6.7e-14 CBM13.hmm 5 gtyrlvnvnsgkclggstaaga.nvqlwdccn.gan.QqWtltsdg......tirlenhq.sgkcLdvaasstaagaevqqytcng 80 +ty+lv+v+sgk l + +aa+a ++++ + + + Q Wt +++ t r++ +g++L +t ag+ ++ + + QVI62156.1|CBM13|GH30_5 581 RTYQLVGVQSGKALTAADAATAtTITTPGDTAqAVGpQLWTARAVApgrldgTRRVVLEAaDGRVLG----ATPAGTDLRSVPVAD 662 589***********44444444144443323345667******877556665444444443467777....557999998888877 PP CBM13.hmm 81 g..anQ.qWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvl 134 + + Q +W l+s++ +y ++n g++L+v g+ + g+ v ++ ngganQ+W QVI62156.1|CBM13|GH30_5 663 AaqDPQtRWILSSTDTLTYALVNEGVGQALEVGGQstTEGAGVGVYGSNGGANQRWYPR 721 76644549******9999*****555*******9897779****************544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1263 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 203.97 // Query: QYX81680.1|CBM13|GH30_5 [L=1075] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.2e-20 59.9 1.0 4.5e-20 58.8 0.0 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.7 1.5 0.67 0.67 121 135 .. 159 173 .. 152 186 .. 0.58 2 ! 58.8 0.0 4.5e-20 4.5e-20 6 151 .. 554 705 .. 549 716 .. 0.81 Alignments for each domain: == domain 1 score: -3.7 bits; conditional E-value: 0.67 CBM13.hmm 121 wdcngganQqWsvlk 135 wd++ ++ Q+W v++ QYX81680.1|CBM13|GH30_5 159 WDWDADSGQRWWVEQ 173 444444445553333 PP == domain 2 score: 58.8 bits; conditional E-value: 4.5e-20 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 +yrl++ +sgk l + ++g++v +++ + +++ Q W++++ + ++ l+ + +g+ L v ++ +v + g QYX81680.1|CBM13|GH30_5 554 VYRLQGTQSGKSL-TPSEDGTGVAIRTTDAASArQLWSVEKLTpgrdnreRYALTDAGTGRRLAV-----RDNQAVLEEPVAGEvp 633 799**********.45588998998885545555******6664455556677777766677776.....3566677777777787 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdg 151 + qW +++g+g+++++n+a+g+ Ldv+g+ adg++v +++ ++++nQ+W+v+++++ +++ae++++ g QYX81680.1|CBM13|GH30_5 634 EAAQWIMSTTGDGSWTFVNAATGRLLDVTGQssADGAKVSTYTPTSAPNQRWAVTDETVLRTERAEAFTVPG 705 6778*************************989999*************************999999988776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1075 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 170.41 // Query: AIJ11484.1|CBM13|GH30_5 [L=683] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-15 42.7 9.1 5.2e-15 42.3 2.6 2.8 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.5 0.38 0.38 124 136 .. 145 157 .. 140 172 .. 0.58 2 ! 42.3 2.6 5.2e-15 5.2e-15 5 136 .. 541 680 .. 538 682 .. 0.75 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.38 CBM13.hmm 124 ngganQqWsvlks 136 + +a Q+W v++ AIJ11484.1|CBM13|GH30_5 145 DADATQRWWVERI 157 2244455544444 PP == domain 2 score: 42.3 bits; conditional E-value: 5.2e-15 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn...gan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 +ty+l++v+sgk + + +a+g+n++l + ++ + + qW+l+++ ++ +++ +g L v + +v + +++ AIJ11484.1|CBM13|GH30_5 541 HTYTLTGVQSGKAV-TVAADGTNLVLGTGTGtgtDPSaRQWRLSAVRhdggvrdRYVFTRPEDGTRLAV-----RDDVPV-AEPDT 619 5899********99.455899987777655333445568****95555557888777777776777876.....233333.33344 PP CBM13.hmm 80 gg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 g + W +s+g+g+++++n+ +g+ L+v g+ dg+ v++w+ n+ganQ+W+++++ AIJ11484.1|CBM13|GH30_5 620 GRrdRAAEWLASSTGDGTWTLVNAGTGRLLEVGGQatHDGAAVTTWPPNSGANQRWTLTDV 680 54544568***************999*******989777*****************99875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (683 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 52.93 // Query: QHC74932.1|CBM13|GH30_5 [L=1222] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-16 47.0 1.6 1.9e-16 47.0 1.6 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.1 0.5 0.94 0.94 124 132 .. 154 162 .. 139 178 .. 0.60 2 ! 47.0 1.6 1.9e-16 1.9e-16 5 135 .. 582 723 .. 579 739 .. 0.74 Alignments for each domain: == domain 1 score: -4.1 bits; conditional E-value: 0.94 CBM13.hmm 124 ngganQqWs 132 + + Q+W QHC74932.1|CBM13|GH30_5 154 TADETQRWW 162 223334442 PP == domain 2 score: 47.0 bits; conditional E-value: 1.9e-16 CBM13.hmm 5 gtyrlvnvnsgkcl..ggstaagan.vqlwdccn..ganQqWtltsdg......tirlenhq.sgkcLdvaasstaagaevqqytc 78 ++y+lv+ +sgk l + s+aa+ + l++ ++ +a+Q+Wt++ + t r++ ++ +g++L + t+ag+ ++ + QHC74932.1|CBM13|GH30_5 582 HRYQLVGTQSGKALtgNPSGAAT-TiTGLAT-DSatAAKQTWTVREVAagereaTRRVVLVNgDGRVLGA----TTAGTDLRSLSV 661 589***********633333444.4366666.4333566******776678888556666664489**94....456666655554 PP CBM13.hmm 79 ngg...anQqWrlesvgsgyykirnras.gkcLdvkgg..adgtpvqqwdcngganQqWsvlk 135 + + a+ +W ++++++ ++ ++n +s + Ldv+gg ad + v +++ ngganQ Ws+ + QHC74932.1|CBM13|GH30_5 662 DAAkttAATRWIVNTTDGVNFSLVN-ESiAQSLDVNGGssADNASVGVYTSNGGANQSWSLRD 723 322344899****8886558*****.8879******9999999****************9866 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1222 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 188.17 // Query: ATE54094.1|CBM13|GH30_5 [L=656] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-19 55.6 0.1 1e-18 54.4 0.1 1.6 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 54.4 0.1 1e-18 1e-18 5 134 .. 526 654 .. 523 656 .] 0.85 Alignments for each domain: == domain 1 score: 54.4 bits; conditional E-value: 1e-18 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcnggan 83 + yrl++v+sgk l + +g+++++++ + a+Q W+l++ + ++ ++n+ +g+ L a g+e ++ + +g+ ATE54094.1|CBM13|GH30_5 526 EAYRLTGVQSGKSL---APNGTALVQRNSAEVADQYWELERLDdgfgnrvRFAVVNAGTGQRLA------AVGGEAVLRSA-DGPE 601 689*********99...67888866666345789******655558897777777777788997......78999999997.9999 PP CBM13.hmm 84 QqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvl 134 +W +s+g+g+++++n+a+g Ldv g+ adg++v +++ ++g+nQ+W+ + ATE54094.1|CBM13|GH30_5 602 ARWIASSTGDGTWTLVNAATGAMLDVVGQstADGAKVGLYTPTSGPNQRWTAT 654 9**************************9899*******************865 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (656 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 153.79 // Query: QJW38600.1|CBM13|GH30_5 [L=1197] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-17 48.8 1.8 6.6e-17 48.5 0.0 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.4 1.8 1 1 121 135 .. 176 190 .. 166 205 .. 0.65 2 ! 48.5 0.0 6.6e-17 6.6e-17 6 152 .. 581 738 .. 576 747 .. 0.82 Alignments for each domain: == domain 1 score: -4.4 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlk 135 wd + +a Q+W v + QJW38600.1|CBM13|GH30_5 176 WDADADATQRWWVDR 190 555555566664443 PP == domain 2 score: 48.5 bits; conditional E-value: 6.6e-17 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg..........tirlenhqsgkcLdvaasstaagaevqqytcng 80 yrl +v+ ++ l + a+g++v++++ + a+Q W+lt+ g ++ ++n+ +g+ L va a+ ++v q + + QJW38600.1|CBM13|GH30_5 581 AYRLDGVQADRSL-APSASGTGVVIRT-DApVAEQAWELTALGasegsgthrtRYAVTNAATGRQLAVA----ADTSAVLQDAPAD 660 6889999999999.5558888988888.655788******77777778888889999999988899985....4555566666443 PP CBM13.hmm 81 g....anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgn 152 + qW l+++g+g+++++n++s+ L+v g+ adg+pv ++ n+g nQ+W++ ++++ ++ +e++++ g+ QJW38600.1|CBM13|GH30_5 661 VadtpLAAQWILSTTGDGTFTLVNASSKTLLEVGGQatADGSPVGTYLANSGVNQRWRIVDETVLGTEPVEAFTTPGT 738 322244778***************999*******889999***********************999999999888776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1197 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 186.01 // Query: QCQ17871.1|CBM13|GH30_5 [L=1358] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-18 53.2 0.1 2.5e-18 53.2 0.1 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.6 0.7 0.65 0.65 74 89 .. 149 164 .. 133 176 .. 0.58 2 ! 53.2 0.1 2.5e-18 2.5e-18 5 148 .. 572 723 .. 569 735 .. 0.71 Alignments for each domain: == domain 1 score: -3.6 bits; conditional E-value: 0.65 CBM13.hmm 74 qqytcngganQqWrle 89 y+ + ++ Q+W+l+ QCQ17871.1|CBM13|GH30_5 149 DHYNWDADQGQRWWLD 164 4444433345555553 PP == domain 2 score: 53.2 bits; conditional E-value: 2.5e-18 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdcc.ngan.QqWtltsdg.......tirlenhqsgkcLdva.asstaagaevqqytcng 80 +ty+l +v+sgk l+ + +g ++++ + + ++a Q Wt++s + +i le +g+ L v+ +s+ + + + + + QCQ17871.1|CBM13|GH30_5 572 ETYQLFGVQSGKALA-ADPNGLAIRTGATTaDAAPaQAWTVHSISgegtnrhRIALEAG-DGRFLAVNgTST--TLVSADAAAAAS 653 6899**********3.22333344444433234445******88667777434444444.367888762222..222222222223 PP CBM13.hmm 81 ganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvi 148 +++ qW +++++++y + ++a ++Ldv+g+ adgt+v +w+ n+g nQ+W++ +++++ +++++ QCQ17871.1|CBM13|GH30_5 654 DPSLQWIPSTTDGRTYSLLSAAAERVLDVNGQgtADGTTVGTWTSNNGGNQRWTIASTRVTSVAPVTAAT 723 47889*999888889*****999*******8899********************9999988887776655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1358 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 185.91 // Query: AVV44392.1|CBM13|GH30_5 [L=675] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-20 58.0 6.6 1.6e-16 47.3 3.5 2.9 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.5 0.9 0.29 0.29 121 137 .. 139 155 .. 133 164 .. 0.63 2 ! 20.3 0.0 3e-08 3e-08 45 111 .. 535 603 .. 493 616 .. 0.78 3 ! 47.3 3.5 1.6e-16 1.6e-16 5 136 .. 538 673 .. 535 675 .] 0.82 Alignments for each domain: == domain 1 score: -2.5 bits; conditional E-value: 0.29 CBM13.hmm 121 wdcngganQqWsvlksd 137 w n +a Q+W v + + AVV44392.1|CBM13|GH30_5 139 WNKNADATQRWWVDRIK 155 44455556666555544 PP == domain 2 score: 20.3 bits; conditional E-value: 3e-08 CBM13.hmm 45 sdg.tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvg.....sgyykirnrasgkcLdvkg 111 s+g +++l+ +qsgk+++v +a+g ++++ + ng+++Q+W+l+ + y++ n a gk L v AVV44392.1|CBM13|GH30_5 535 SKGhSYTLTGVQSGKAVTV----AADGRSLVIGSANGSTAQRWQLDARHgekgaRQRYVFANPAEGKRLAVRD 603 4456899*****99****8....389*********99999*****8774444434469999999999999884 PP == domain 3 score: 47.3 bits; conditional E-value: 1.6e-16 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 ++y+l++v+sgk + + +a+g ++++ + +++++Q+W+l++ + ++ + n gk L v ++ +v + +++g AVV44392.1|CBM13|GH30_5 538 HSYTLTGVQSGKAV-TVAADGRSLVIGSANGSTAQRWQLDARHgekgarqRYVFANPAEGKRLAV-----RDNVPV-VEPDTGErd 616 5799********99.4558888877777455677******77557889889999999989***98.....355555.444445556 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlks 136 ++ W +++g+ +++++n+a+g+ L+v g+ ++ g+ v++w n+g+nQ+W+v+++ AVV44392.1|CBM13|GH30_5 617 PATEWIMSTTGDSTWTLVNVATGRLLEVGGQaTNeGAAVTTWLANSGSNQRWRVTDV 673 8899****9********************9996669****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (675 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 48.39 // Query: ARK06487.1|CBM13|GH30_5 [L=1199] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-16 47.2 1.5 2.4e-16 46.7 0.0 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.7 2.2 1 1 121 135 .. 178 192 .. 168 206 .. 0.64 2 ! 46.7 0.0 2.4e-16 2.4e-16 6 152 .. 583 740 .. 578 750 .. 0.82 Alignments for each domain: == domain 1 score: -4.7 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlk 135 wd + +a Q+W v + ARK06487.1|CBM13|GH30_5 178 WDEDADATQRWWVDR 192 554445556664433 PP == domain 2 score: 46.7 bits; conditional E-value: 2.4e-16 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg..........tirlenhqsgkcLdvaassta..agaevqqytc 78 yrl +v+ ++ l + a+g++v++++ + a+Q W+lt+ g ++ ++n+ +g+ L vaa ++a a+ + + ARK06487.1|CBM13|GH30_5 583 AYRLDGVQADRSL-APSASGTGVVIRT-DApVAEQAWELTALGapegsgthrtRYAVTNAATGRQLAVAADTSAvlRDAPADVAD- 665 6889999999999.5558888988888.655788******777777788888889999999888898875554555555555555. PP CBM13.hmm 79 ngg.anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgn 152 + + qW l+++g+g+++++n++s+ L+v g+ adg+pv ++ n+g nQ+W+v ++++ ++ ++++++ g+ ARK06487.1|CBM13|GH30_5 666 --TpLAAQWILSTTGDGTFTLVNASSKTLLEVGGQatADGSPVGTYLANSGVNQRWRVVDETVLGTEPVQAFTTPGT 740 ..235678***************999*******889999***********************999999998888776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1199 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 184.62 // Query: QDN72427.1|CBM13|GH30_5 [L=688] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-19 56.3 5.6 2.7e-19 56.3 5.6 2.9 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 2.3 0.79 0.79 121 139 .. 144 162 .. 128 170 .. 0.69 2 ? -2.5 0.0 0.29 0.29 137 177 .. 422 462 .. 417 470 .. 0.76 3 ! 56.3 5.6 2.7e-19 2.7e-19 5 137 .. 543 683 .. 539 687 .. 0.78 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 0.79 CBM13.hmm 121 wdcngganQqWsvlksdlk 139 w n +a Q+W v + +++ QDN72427.1|CBM13|GH30_5 144 WNPNADATQRWWVDRIKKD 162 5555566677755555544 PP == domain 2 score: -2.5 bits; conditional E-value: 0.29 CBM13.hmm 137 dlkikliaekvipdgnnnilntqlpnivvlskNlesalivg 177 + ++++ ++++i g++ i ++ + sk ++a +v QDN72427.1|CBM13|GH30_5 422 KFDTARNFTHYIKPGDRLIKTDDTSSAAAVSKSGNGATVVH 462 55677888899999999999999999988888888887665 PP == domain 3 score: 56.3 bits; conditional E-value: 2.7e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan..vqlwdccn..ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 +ty l++v+sgk l +++g + +++++ + ++Q+W+l++ + ++ ++n gk L v +ga+v + + QDN72427.1|CBM13|GH30_5 543 HTYSLTGVQSGKALT-VADDGGKlvIKTASTDAatVTGQRWQLRQISgqtgnrqRYVFTNPVEGKRLAV-----RDGAPVLEAD-T 621 6899**********3.3345554224444433343467******6655666878888888888899997.....5888885555.4 PP CBM13.hmm 80 gg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 g ++ qW +++g+g+++++n+a+g+ L+v g+ adg+ v++w+ n+g+nQ+W+v++++ QDN72427.1|CBM13|GH30_5 622 GPrdTATQWIMSTTGDGTWTLVNAATGRLLEVGGQatADGSAVTIWTPNSGSNQRWTVSDVT 683 55667789*************************889999*****************998876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (688 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 51.17 // Query: CTQ97110.1|CBM13|GH30_5 [L=661] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-18 52.2 3.2 5e-18 52.2 3.2 1.8 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.0 0.2 0.41 0.41 82 88 .. 137 143 .. 129 153 .. 0.65 2 ! 52.2 3.2 5e-18 5e-18 6 134 .. 529 659 .. 525 661 .] 0.83 Alignments for each domain: == domain 1 score: -3.0 bits; conditional E-value: 0.41 CBM13.hmm 82 anQqWrl 88 +nQ+W++ CTQ97110.1|CBM13|GH30_5 137 PNQRWWV 143 4666655 PP == domain 2 score: 52.2 bits; conditional E-value: 5e-18 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqyt.cngga 82 t+ l++v+sgk s++ g +++++ + + +Q+Wtlt+ + +++++n + ++L+ a+g++v++ + +++a CTQ97110.1|CBM13|GH30_5 529 TFSLTGVQSGKSW--SAEHGG-LVQRTTNAsAPAQRWTLTNRTgqhgnrdQFTITNTATRQVLS------ASGGAVTLAApGTDDA 605 6788999999955..555555.555663543566******776688899999999999778998......7999999999456669 PP CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvl 134 + +W l+++g+ ++ ++n+ +g+ Ldv g +dg+++ ++ ++ganQ+W+v CTQ97110.1|CBM13|GH30_5 606 ASRWILSTTGDTTWAFVNVGTGQMLDVIGEsrEDGARIGLYRPTNGANQRWTVV 659 99**************************878999*****************875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (661 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 149.02 // Query: AEK46158.1|CBM13|GH30_5 [L=661] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.4e-21 63.0 1.3 2.4e-21 63.0 1.3 2.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.2 0.2 0.12 0.12 81 101 .. 136 149 .. 123 156 .. 0.69 2 ! 63.0 1.3 2.4e-21 2.4e-21 7 132 .. 530 657 .. 526 660 .. 0.83 Alignments for each domain: == domain 1 score: -1.2 bits; conditional E-value: 0.12 CBM13.hmm 81 ganQqWrlesvgsgyykirnr 101 ++nQ+W+l + ki+nr AEK46158.1|CBM13|GH30_5 136 DPNQRWWL--D-----KIKNR 149 36788877..3.....45554 PP == domain 2 score: 63.0 bits; conditional E-value: 2.4e-21 CBM13.hmm 7 yrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg..a 82 +++++v+sgk l s+++g+ vq ++ + +++Q+Wtlt+ + +++++n +g++L +ag++v++ + g + AEK46158.1|CBM13|GH30_5 530 VTFTGVQSGKSL--SAENGSLVQ-RTTDAsATAQRWTLTDRTgrygnrdRFTITNTGTGQVLA------TAGGAVTLAAA-GPcdP 605 6788999***99..667776455.553543666******776688888999999999899998......58999988885.55666 PP CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWs 132 + qW+l+++g+g+++++n+a+g+ Ldv+g adg+++ +++ ++g+nQ+W+ AEK46158.1|CBM13|GH30_5 606 AAQWTLSTTGDGTWTFVNAATGQLLDVTGEsrADGARIGLYKPTNGPNQRWQ 657 678*************************878********************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (661 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 145.40 // Query: QWB24300.1|CBM13|GH30_5 [L=685] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-17 49.5 2.2 3.3e-17 49.5 2.2 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -5.6 3.4 1 1 121 137 .. 147 163 .. 137 171 .. 0.63 2 ! 49.5 2.2 3.3e-17 3.3e-17 5 137 .. 546 683 .. 542 685 .] 0.80 Alignments for each domain: == domain 1 score: -5.6 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlksd 137 w n + Q+W v + + QWB24300.1|CBM13|GH30_5 147 WNKNADKTQRWWVDRIK 163 44444555666555544 PP == domain 2 score: 49.5 bits; conditional E-value: 3.3e-17 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.gan.QqWtltsdg......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +tyrl++++sgk l + +++g+++++++ + + + Q W++++ ++ ++ s+k L v ++++++ ++ g QWB24300.1|CBM13|GH30_5 546 HTYRLTGAQSGKDL-TLADNGTGLVIRSANAsDPSgQEWKVEQIRgsdnrkRYVFTETASDKRLAV------RNGALVAEPDEGRr 624 689*********88.455899996667656345555******654456677788888887788886......45567777776767 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 ++ W +++g+g+++++n+a+g+ dv+g+ +dg+ v +w+ n+g+nQ+W++++++ QWB24300.1|CBM13|GH30_5 625 dKATEWIMSTTGDGTWTLVNAATGQLPDVSGQstNDGASVGVWQPNSGSNQRWKLTDVT 683 66779*************************999777*****************999876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (685 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 148.15 // Query: QCD57104.1|CBM13|GH30_5 [L=685] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-18 51.4 1.4 8.8e-18 51.4 1.4 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -5.0 2.9 1 1 121 138 .. 147 164 .. 137 172 .. 0.64 2 ! 51.4 1.4 8.8e-18 8.8e-18 5 136 .. 546 682 .. 541 685 .] 0.76 Alignments for each domain: == domain 1 score: -5.0 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlksdl 138 w n + Q+W v + ++ QCD57104.1|CBM13|GH30_5 147 WNKNADKTQRWWVDRIKK 164 444455556665555444 PP == domain 2 score: 51.4 bits; conditional E-value: 8.8e-18 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdcc.n.ganQqWtltsdgtirlenhqsgkcLd.va.assta.agaevqqytcngg..an 83 +tyrl++v+sgk l + + +g+++++ + + + a+QqW+++ +ir e +++ +L+ + a +++++ ++ g a+ QCD57104.1|CBM13|GH30_5 546 HTYRLTGVQSGKDL-TIAGNGTGLVIKTPNaTdPAGQQWRVE---QIRGEDNRKRYVLTeTGaDKRLAiRDGALVAEPDEGRrdAA 627 689*********88.344889996666656344566******...45544554445777322222223666677777776668778 PP CBM13.hmm 84 QqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 qW +++g+g+++++n+a+g+ dv g+ +dg+ v +w+ n+ganQ+W+v+++ QCD57104.1|CBM13|GH30_5 628 AQWIASTTGDGTWTLVNAATGQLPDVGGQstNDGASVGVWQPNSGANQRWKVTEV 682 89***999*******************989777*****************99986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (685 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 150.60 // Query: QJT05993.1|CBM13|GH30_5 [L=675] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-20 60.1 14.2 1.1e-17 51.0 8.0 3.0 4 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.8 1.2 0.74 0.74 124 136 .. 142 154 .. 137 163 .. 0.53 2 ? -3.0 0.1 0.4 0.4 144 174 .. 274 304 .. 265 312 .. 0.71 3 ! 21.5 0.4 1.3e-08 1.3e-08 46 107 .. 536 599 .. 493 613 .. 0.72 4 ! 51.0 8.0 1.1e-17 1.1e-17 5 136 .. 538 673 .. 535 675 .] 0.81 Alignments for each domain: == domain 1 score: -3.8 bits; conditional E-value: 0.74 CBM13.hmm 124 ngganQqWsvlks 136 + +a Q+W v + QJT05993.1|CBM13|GH30_5 142 DADATQRWWVDRI 154 3344555544444 PP == domain 2 score: -3.0 bits; conditional E-value: 0.4 CBM13.hmm 144 aekvipdgnnnilntqlpnivvlskNlesal 174 + +++ + n +i+ t+ ++ sk l +++ QJT05993.1|CBM13|GH30_5 274 QISAMDETNPSIFATNWNSYSQASKDLVDQM 304 4455566777899999999999998888886 PP == domain 3 score: 21.5 bits; conditional E-value: 1.3e-08 CBM13.hmm 46 dg.tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvg.....sgyykirnrasgkcL 107 +g +++l+ +qsgk+++v a+g+++++ + ng+++QqW+l+ + y++ n a g L QJT05993.1|CBM13|GH30_5 536 KGhSYTLTGVQSGKAVTV----GANGTNLVIGSANGTTAQQWQLDARYgktgaRQHYVFANPAEGERL 599 345788888888888886....3788888888888888888888655323222335666665555555 PP == domain 4 score: 51.0 bits; conditional E-value: 1.1e-17 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 ++y+l++v+sgk + + +a+g+n+++ + +++++QqW+l++ ++ + n g L v ++ +v + +++g+ QJT05993.1|CBM13|GH30_5 538 HSYTLTGVQSGKAV-TVGANGTNLVIGSANGTTAQQWQLDARYgktgarqHYVFANPAEGERLAV-----RDNVPV-VEPDTGKrd 616 5799********99.55599***77777455677******5523556887889999888889987.....355555.444456666 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlks 136 ++ W +++g+g+++++n+a+g+ L+v g+ ++ g+ v++w+ n+g+nQ+W+v+++ QJT05993.1|CBM13|GH30_5 617 PATEWIMSTTGDGTWTLVNVATGRLLEVGGQaTNeGAAVTTWQANSGSNQRWRVTDV 673 8899*************************9996669****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (675 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 48.64 // Query: ANB04641.1|CBM13|GH30_5 [L=682] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-18 53.7 1.0 1.7e-18 53.7 1.0 2.4 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.6 0.4 0.4 124 136 .. 145 157 .. 140 177 .. 0.62 2 ! 53.7 1.0 1.7e-18 1.7e-18 5 137 .. 541 677 .. 537 681 .. 0.77 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.4 CBM13.hmm 124 ngganQqWsvlks 136 + +a Q+W v++ ANB04641.1|CBM13|GH30_5 145 DADATQRWWVERI 157 2244455544443 PP == domain 2 score: 53.7 bits; conditional E-value: 1.7e-18 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccngan.QqWtltsdgtirlenhqsgkcLdvaassta.agaevqqytc.......ngg 81 +ty+l++v+sgk + + +++g+ ++l + + a+ Q+W+l+++ ++sg +Ld +++ +g+++ + ++ +g+ ANB04641.1|CBM13|GH30_5 541 HTYTLTGVQSGKAV-TVGENGTDLVLGTEAG-AGaQRWRLSAVR------QDSG-VLDRHVFTNPqDGTRLAVRDDvpvaepdTGK 617 689*********99.5559999999999445.555******554......2233.7775555544577777777764444443455 PP CBM13.hmm 82 ..anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlksd 137 + W +++g+g+++++n+ +g+ L+v g+ ++ g+ v++w+ n+ganQ+W+v++++ ANB04641.1|CBM13|GH30_5 618 rdRAAEWIMSTTGDGTWTLVNAGTGRLLEVGGQaTHeGAAVTTWPPNSGANQRWTVTDVT 677 544678***************999*******9885569*****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (682 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 54.44 // Query: CBG74853.1|CBM13|GH30_5 [L=1049] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-20 60.0 0.0 2e-20 60.0 0.0 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.6 4.8 1 1 121 140 .. 130 149 .. 120 158 .. 0.66 2 ! 60.0 0.0 2e-20 2e-20 6 156 .. 525 681 .. 520 693 .. 0.82 Alignments for each domain: == domain 1 score: -4.6 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlksdlki 140 wd+n ++ Q+W v ++++ki CBG74853.1|CBM13|GH30_5 130 WDWNADQGQRWWVDQVKDKI 149 66666666666555555544 PP == domain 2 score: 60.0 bits; conditional E-value: 2e-20 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 +yrl++ +sgk + +g++v+l++ + +++ Q W++++ + +++l+n+++g L v ++ +v + g CBG74853.1|CBM13|GH30_5 525 VYRLQGTQSGKSF-APSPDGTGVVLRTTDAASArQLWSVEQLTsgtgnreRYTLTNADTGGRLAVR-----DNQAVLEEAGAGEvp 604 699999*****99.45578999**9995555555******766667788999*****965588872.....344454444446688 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgnnnil 156 a+ qW +++g+g+++++n+a+g+ Ldv g+ adg++v +++ +++anQ W+v+++++ ++++ae++++ g + +l CBG74853.1|CBM13|GH30_5 605 AAAQWLMSTTGDGSWTLVNAATGRLLDVIGQssADGAKVSTYTPTSAANQLWAVSDETVLSTERAEAFTVPGLRPKL 681 8899*************************889999*******************************99998877666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1049 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 175.50 // Query: QFX85683.1|CBM13|GH30_5 [L=679] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-16 47.0 1.1 1.9e-16 47.0 1.1 2.7 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.1 0.7 0.44 0.44 124 136 .. 145 157 .. 140 171 .. 0.57 2 ! 47.0 1.1 1.9e-16 1.9e-16 5 136 .. 541 676 .. 538 679 .] 0.80 Alignments for each domain: == domain 1 score: -3.1 bits; conditional E-value: 0.44 CBM13.hmm 124 ngganQqWsvlks 136 + +a Q+W v++ QFX85683.1|CBM13|GH30_5 145 DADATQRWWVERI 157 2244455544444 PP == domain 2 score: 47.0 bits; conditional E-value: 1.9e-16 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 +ty+l++v+sgk + + +g+n++l + ++++ +W+l+++ ++ + + q+g L v + +v + +++gg QFX85683.1|CBM13|GH30_5 541 HTYTLTGVQSGKAV-TVSGDGTNLVLGTGADASAERWRLSAVRhdggvrdRYVFSRPQDGTRLAV-----RDDVPV-AEPDTGGrd 619 589*********99.4448899999998445555******6655558988888888888888986.....344444.555667765 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg.ad.gtpvqqwdcngganQqWsvlks 136 + W +++g+g+++++n+a+g+ L+v g+ ++ g+ v++w+ n+ganQ+W+++++ QFX85683.1|CBM13|GH30_5 620 RAAEWIASTTGDGTWTLVNAATGRLLEVGGQaTHaGAAVTTWPPNSGANQRWTLTDV 676 5678***999*******************9885559****************99876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (679 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 51.97 // Query: QSZ50311.1|CBM13|GH30_5 [L=1161] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.7e-11 28.7 2.3 7.7e-11 28.7 2.3 3.6 4 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.4 0.14 0.14 80 135 .. 159 169 .. 126 184 .. 0.61 2 ? 1.8 0.0 0.014 0.014 23 102 .. 442 481 .. 430 506 .. 0.45 3 ! 28.7 2.3 7.7e-11 7.7e-11 6 137 .. 590 747 .. 585 761 .. 0.67 4 ? -2.7 0.3 0.35 0.35 71 134 .. 931 949 .. 920 995 .. 0.61 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.14 CBM13.hmm 80 gganQqWrlesvgsgyykirnrasgkcLdvkggadgtpvqqwdcngganQqWsvlk 135 ++nQ+W++e + QSZ50311.1|CBM13|GH30_5 159 ADKNQRWWVE---------------------------------------------R 169 2245555543.............................................3 PP == domain 2 score: 1.8 bits; conditional E-value: 0.014 CBM13.hmm 23 aaganvqlwdccnganQqWtltsdgtirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesv..g...sgyykirnra 102 + +ga++ q +c +nQ+++ + + g + i+n + QSZ50311.1|CBM13|GH30_5 442 N---------------------------------------------DGASLEQAKCKVLTNQKYNTTRNftHyirPGDFLIQNDN 481 2.............................................444444444433344444443332202223333333322 PP == domain 3 score: 28.7 bits; conditional E-value: 7.7e-11 CBM13.hmm 6 tyrlvnvnsgkcl.ggstaaga...n.vqlwdccnganQqWtltsdg.........tirlenhqsgkcLdv.......aasstaag 70 +y+l + +sgk+l g ++g+ + + + + + a Q Wt+++++ ++ l+n++ g++L+ ++s +a+ QSZ50311.1|CBM13|GH30_5 590 SYHLSGEASGKYLtGR--SNGSasiEeMGTDA-AGVAPQIWTFNAVStedefandrRWVLTNKD-GRVLTGnggvlngSQSGAASL 671 68999999*****522..33331122233333.2334488888855555556665577777776.467776344331123333477 PP CBM13.hmm 71 aevqqytcngganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngga.......nQqWsvlksd 137 +++++ + +++ qW +++++++++ ++n+ +L+v+g+ a gt v + + +g++ Q W++++ + QSZ50311.1|CBM13|GH30_5 672 STLTLEQAKAAPSAQWIVTTENGKQWSLVNAGAAIALQVSGNqtAAGTSVALASSTGTTatalanpHQAWAFTDIA 747 777888876668999***9998999*****7779******999888********9886635555555667776655 PP == domain 4 score: -2.7 bits; conditional E-value: 0.35 CBM13.hmm 71 aevqqytcngganQqWrlesvgsgyykirnrasgkcLdvkggadgtpvqqwdcngganQqWsvl 134 + + tc + +a+ +Ws++ QSZ50311.1|CBM13|GH30_5 931 SYIAKNTC---------------------------------------------DANASTRWSNW 949 44444444.............................................44444444443 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1161 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 147.96 // Query: QDP74800.1|CBM13|GH30_5 [L=1199] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-16 47.2 1.5 2.4e-16 46.7 0.0 2.0 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.7 2.2 1 1 121 135 .. 178 192 .. 168 206 .. 0.64 2 ! 46.7 0.0 2.4e-16 2.4e-16 6 152 .. 583 740 .. 578 750 .. 0.82 Alignments for each domain: == domain 1 score: -4.7 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlk 135 wd + +a Q+W v + QDP74800.1|CBM13|GH30_5 178 WDEDADATQRWWVDR 192 554445556664433 PP == domain 2 score: 46.7 bits; conditional E-value: 2.4e-16 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg..........tirlenhqsgkcLdvaassta..agaevqqytc 78 yrl +v+ ++ l + a+g++v++++ + a+Q W+lt+ g ++ ++n+ +g+ L vaa ++a a+ + + QDP74800.1|CBM13|GH30_5 583 AYRLDGVQADRSL-APSASGTGVVIRT-DApVAEQAWELTALGapegsgthrtRYAVTNAATGRQLAVAADTSAvlRDAPADVAD- 665 6889999999999.5558888988888.655788******777777788888889999999888898875554555555555555. PP CBM13.hmm 79 ngg.anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgn 152 + + qW l+++g+g+++++n++s+ L+v g+ adg+pv ++ n+g nQ+W+v ++++ ++ ++++++ g+ QDP74800.1|CBM13|GH30_5 666 --TpLAAQWILSTTGDGTFTLVNASSKTLLEVGGQatADGSPVGTYLANSGVNQRWRVVDETVLGTEPVQAFTTPGT 740 ..235678***************999*******889999***********************999999998888776 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1199 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 189.43 // Query: ACL39711.1|CBM13|GH30_5 [L=1170] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-11 31.6 0.2 1e-11 31.6 0.2 2.7 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.1 0.9 0.11 0.11 124 135 .. 167 178 .. 132 194 .. 0.57 2 ! 31.6 0.2 1e-11 1e-11 6 139 .. 599 758 .. 594 917 .. 0.76 Alignments for each domain: == domain 1 score: -1.1 bits; conditional E-value: 0.11 CBM13.hmm 124 ngganQqWsvlk 135 + ++nQ+W v++ ACL39711.1|CBM13|GH30_5 167 DADQNQRWWVER 178 224444444333 PP == domain 2 score: 31.6 bits; conditional E-value: 1e-11 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvq.lwdccn.gan.QqWtltsdg.........tirlenhqsgkcLdv.......aasstaagae 72 +y+l + +sgk+l + +ga++q l + + g + Q Wt+++++ ++ ++ + +g++L+ ++s +a+ a+ ACL39711.1|CBM13|GH30_5 599 SYHLSGEASGKYLTAGSGSGASIQdLGT-DAaGVApQIWTFNAVTsgdefakdrRWVVTGK-DGRVLTGnggvlngSQSGAASLAS 682 68999999*****444455554443333.32234449999995545566666432222222.355666433333114444458999 PP CBM13.hmm 73 vqqytcngganQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngga.......nQqWsvlksdlk 139 +++ + +++ qW ++++++++++++n+a +L+v+g+ a gt v + + +g++ Q W++++ ++ ACL39711.1|CBM13|GH30_5 683 LTLEQAKATPAAQWMVTTENGKQWTLVNAAAAIALQVSGNqtATGTSVALASSTGTTatalaspHQAWAFTDIADL 758 9999987778899***9998999*****999*******999888********999553666666677777766544 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1170 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 125.51 // Query: QNP68393.1|CBM13|GH30_5 [L=678] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-16 46.7 3.6 7.3e-12 32.1 0.4 2.7 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.1 1.2 0.91 0.91 124 136 .. 146 158 .. 141 168 .. 0.52 2 ! 24.2 0.2 1.9e-09 1.9e-09 42 112 .. 536 608 .. 492 620 .. 0.74 3 ! 32.1 0.4 7.3e-12 7.3e-12 79 134 .. 616 675 .. 599 678 .] 0.82 Alignments for each domain: == domain 1 score: -4.1 bits; conditional E-value: 0.91 CBM13.hmm 124 ngganQqWsvlks 136 ++ Q+W v + QNP68393.1|CBM13|GH30_5 146 KADQTQRWWVDRI 158 2233455544444 PP == domain 2 score: 24.2 bits; conditional E-value: 1.9e-09 CBM13.hmm 42 tltsdg.tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrlesvg....sg.yykirnrasgkcLdvkgg 112 +l s+g +++l+ +qs+k+++va a+g+ +++ + +g+ +QqWrle+v ++ y++ n a gk L v ++ QNP68393.1|CBM13|GH30_5 536 SLFSKGkAYTLTGVQSNKAVTVA----ANGTGLTINSASGAVAQQWRLEQVYgttgNRlRYVFANPAEGKRLAVRNN 608 44555669*******99****83....89*********99999******9954533334699999999999999864 PP == domain 3 score: 32.1 bits; conditional E-value: 7.3e-12 CBM13.hmm 79 ngg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvl 134 +g ++ W l+++g+g+++++n+++g+ L+v g+ + g+ v++w n+ganQ+W++ QNP68393.1|CBM13|GH30_5 616 TGRrdPATEWILSTTGDGTWTLVNAETGRLLEVGGQstEEGAAVTTWLANSGANQRWRIA 675 444446789***************999*******889666*****************876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (678 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 48.18 // Query: QDN62376.1|CBM13|GH30_5 [L=688] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-19 56.3 5.6 2.7e-19 56.3 5.6 2.9 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 2.3 0.79 0.79 121 139 .. 144 162 .. 128 170 .. 0.69 2 ? -2.5 0.0 0.29 0.29 137 177 .. 422 462 .. 417 470 .. 0.76 3 ! 56.3 5.6 2.7e-19 2.7e-19 5 137 .. 543 683 .. 539 687 .. 0.78 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 0.79 CBM13.hmm 121 wdcngganQqWsvlksdlk 139 w n +a Q+W v + +++ QDN62376.1|CBM13|GH30_5 144 WNPNADATQRWWVDRIKKD 162 5555566677755555544 PP == domain 2 score: -2.5 bits; conditional E-value: 0.29 CBM13.hmm 137 dlkikliaekvipdgnnnilntqlpnivvlskNlesalivg 177 + ++++ ++++i g++ i ++ + sk ++a +v QDN62376.1|CBM13|GH30_5 422 KFDTARNFTHYIKPGDRLIKTDDTSSAAAVSKSGNGATVVH 462 55677888899999999999999999988888888887665 PP == domain 3 score: 56.3 bits; conditional E-value: 2.7e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan..vqlwdccn..ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 +ty l++v+sgk l +++g + +++++ + ++Q+W+l++ + ++ ++n gk L v +ga+v + + QDN62376.1|CBM13|GH30_5 543 HTYSLTGVQSGKALT-VADDGGKlvIKTASTDAatVTGQRWQLRQISgqtgnrqRYVFTNPVEGKRLAV-----RDGAPVLEAD-T 621 6899**********3.3345554224444433343467******6655666878888888888899997.....5888885555.4 PP CBM13.hmm 80 gg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 g ++ qW +++g+g+++++n+a+g+ L+v g+ adg+ v++w+ n+g+nQ+W+v++++ QDN62376.1|CBM13|GH30_5 622 GPrdTATQWIMSTTGDGTWTLVNAATGRLLEVGGQatADGSAVTIWTPNSGSNQRWTVSDVT 683 55667789*************************889999*****************998876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (688 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 51.83 // Query: BCL21814.1|CBM13|GH30_5 [L=535] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-17 49.8 5.9 9e-17 48.1 5.9 1.9 1 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 48.1 5.9 9e-17 9e-17 5 136 .. 396 532 .. 392 535 .] 0.76 Alignments for each domain: == domain 1 score: 48.1 bits; conditional E-value: 9e-17 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.gan.QqWtltsdg......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +tyrl++v+sgk l + + +g+++++++ ++ + + QqW++++ ++ l+ +k L v +++++ ++ g BCL21814.1|CBM13|GH30_5 396 HTYRLTGVQSGKDL-TIAGNGTGLVIRTRNTtDPSgQQWRVEQIRgegnrkRYVLTETGADKRLAV------RDGALVAEPDEGRr 474 689*********88.344888885556645445555******554344555555555553456654......55667777766667 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 a+ qW +s+g+g+++++n+a+g+ dv g+ +dg+ v +w+ n+g+nQ+W+v+++ BCL21814.1|CBM13|GH30_5 475 dAAAQWIASSTGDGSWTLVNAATGQLPDVGGQstNDGASVGVWQPNSGSNQRWKVTEV 532 77889*************************989777*****************99986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (535 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 47.55 // Query: SDT81423.1|CBM13|GH30_5 [L=681] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-16 45.2 8.3 8.1e-13 35.2 0.5 2.8 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.5 0.38 0.38 124 136 .. 145 157 .. 140 172 .. 0.58 2 ! 14.0 0.0 2.5e-06 2.5e-06 47 94 .. 540 587 .. 531 608 .. 0.79 3 ! 35.2 0.5 8.1e-13 8.1e-13 84 136 .. 624 678 .. 611 680 .. 0.88 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.38 CBM13.hmm 124 ngganQqWsvlks 136 + +a Q+W v++ SDT81423.1|CBM13|GH30_5 145 DADATQRWWVERI 157 2244455544444 PP == domain 2 score: 14.0 bits; conditional E-value: 2.5e-06 CBM13.hmm 47 g.tirlenhqsgkcLdvaasstaagaevqqytcngg..anQqWrlesvg.sg 94 g t++l+ +qsgk+++v +a+g+++++ t +g+ ++ qWrl+ v +g SDT81423.1|CBM13|GH30_5 540 GhTYTLTGVQSGKAVTV----AADGTNLVLGTGTGTdpSARQWRLSAVRhDG 587 3589999999999**98....389999*99999888877889*998875544 PP == domain 3 score: 35.2 bits; conditional E-value: 8.1e-13 CBM13.hmm 84 QqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 W +s+g+g+++++n+ +g+ L+v g+ dg+ v++w+ n+ganQ+W+++++ SDT81423.1|CBM13|GH30_5 624 AEWLASSTGDGTWTLVNAGTGRLLEVGGQatHDGAAVTTWPPNSGANQRWTLTDV 678 57***************999*******989777*****************99875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (681 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 53.37 // Query: QDO03132.1|CBM13|GH30_5 [L=688] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-19 57.7 5.8 1e-19 57.7 5.8 2.9 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.6 2.2 0.63 0.63 121 138 .. 144 161 .. 113 171 .. 0.73 2 ? -2.5 0.0 0.29 0.29 137 177 .. 422 462 .. 417 470 .. 0.76 3 ! 57.7 5.8 1e-19 1e-19 5 137 .. 543 683 .. 539 687 .. 0.78 Alignments for each domain: == domain 1 score: -3.6 bits; conditional E-value: 0.63 CBM13.hmm 121 wdcngganQqWsvlksdl 138 w n +a Q+W v + ++ QDO03132.1|CBM13|GH30_5 144 WNPNADATQRWWVDRIKK 161 455556666765555554 PP == domain 2 score: -2.5 bits; conditional E-value: 0.29 CBM13.hmm 137 dlkikliaekvipdgnnnilntqlpnivvlskNlesalivg 177 + ++++ ++++i g++ i ++ + sk ++a +v QDO03132.1|CBM13|GH30_5 422 KFDTARNFTHYIKPGDRLIKTDDTSSAAAVSKSGNGATVVH 462 55677888899999999999999999988888888887665 PP == domain 3 score: 57.7 bits; conditional E-value: 1e-19 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan..vqlwdccn..ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 +ty l++v+sgk l +++g + +++++ + ++Q+W+l++ + ++ ++n gk L v +ga+v + + QDO03132.1|CBM13|GH30_5 543 HTYSLTGVQSGKALT-VADDGGKlvIKTASTDAatVTGQRWQLRQISgqtgnrqRYVFTNPVEGKRLAV-----RDGAPVLEAD-T 621 6899**********3.3345554224444433343467******6655666878888888888899997.....5888885555.4 PP CBM13.hmm 80 gg..anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 g ++ qW +++g+g+++++n+a+gk L+v g+ adg+ v++w+ n+g+nQ+W+v++++ QDO03132.1|CBM13|GH30_5 622 GPrdTATQWIMSTTGDGTWTLVNAATGKLLEVGGQatADGSAVTIWTPNSGSNQRWTVSDVT 683 55667789*************************889999*****************998876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (688 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 52.16 // Query: QIZ08096.1|CBM13|GH30_5 [L=1060] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-18 54.3 18.5 1e-12 34.8 6.2 3.9 4 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.3 3.8 0.02 0.02 121 157 .. 157 193 .. 146 209 .. 0.77 2 ? -1.7 0.0 0.17 0.17 49 84 .. 437 467 .. 396 482 .. 0.65 3 ! 34.8 6.2 1e-12 1e-12 45 135 .. 539 626 .. 525 628 .. 0.76 4 ! 34.6 4.4 1.2e-12 1.2e-12 5 99 .. 589 680 .. 585 702 .. 0.63 Alignments for each domain: == domain 1 score: 1.3 bits; conditional E-value: 0.02 CBM13.hmm 121 wdcngganQqWsvlksdlkikliaekvipdgnnniln 157 w +n +anQ+W +++++ + ++++e++ + + + QIZ08096.1|CBM13|GH30_5 157 WNWNADANQRWWLTAAKSRGADTFEAFSNSAPYFMTQ 193 8888899999999998888888888887776665555 PP == domain 2 score: -1.7 bits; conditional E-value: 0.17 CBM13.hmm 49 irlenhqs.gkcLdvaasstaagaevqqytcngganQ 84 ++ +n+q+ + d + + + v++yt+ ++a Q QIZ08096.1|CBM13|GH30_5 437 FINTNNQNtLAAID-----AKDDSVVVVYTN-SSAEQ 467 33333443111222.....124455555553.44444 PP == domain 3 score: 34.8 bits; conditional E-value: 1e-12 CBM13.hmm 45 sdgtirlenhqsgkcLdvaasstaagaevqqytcn.gganQqWrlesvgsg.....yykirnrasgkcLdvkggadgtpvqqwdcn 124 +++ +++ n +sgk+Ld+ t++ ++++q++++ ++a+QqW l++v +g yki+ +sgk+++v+ +g+ v q + QIZ08096.1|CBM13|GH30_5 539 NHDKYKISNLNSGKVLDI----TQD-GKIVQKSYDrDKASQQWSLQKVTNGysskeLYKIVDTNSGKVIGVE---NGSAVEQTYQ- 615 4457*************6....344.556666654166********99744444446*****9*********...6877777664. PP CBM13.hmm 125 gganQqWsvlk 135 ++ +Q+W++++ QIZ08096.1|CBM13|GH30_5 616 NTVSQKWMLST 626 5677***8765 PP == domain 4 score: 34.6 bits; conditional E-value: 1.2e-12 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccnganQqWtltsdg..tirlenhqsgkcLdvaasstaagaevqqytcngganQqWrl 88 + y++v+ nsgk++ ++g++v + +n+ +Q+W l++ g ++++ n+ +g+ L++ + st a v +++ n g+nQ W++ QIZ08096.1|CBM13|GH30_5 589 ELYKIVDTNSGKVI--GVENGSAVEQTY-QNTVSQKWMLSTSGnqQYTFINAANGQLLEIGGASTKEDAGVDVWSANAGKNQSWKI 671 55677777777766..446666666655.343447777776666677777777667777654444666667777776667777777 PP CBM13.hmm 89 esvgsgyykir 99 ++sg + i+ QIZ08096.1|CBM13|GH30_5 672 --DKSGIVEIE 680 ..444555554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1060 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 63.91 // Query: QOC27273.1|CBM13|GH30_5 [L=1371] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.3e-18 52.1 1.7 5.3e-18 52.1 1.7 1.9 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 0.7 0.79 0.79 124 136 .. 153 165 .. 148 174 .. 0.54 2 ! 52.1 1.7 5.3e-18 5.3e-18 5 145 .. 572 720 .. 568 731 .. 0.73 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 0.79 CBM13.hmm 124 ngganQqWsvlks 136 n +a Q+W +++ QOC27273.1|CBM13|GH30_5 153 NADATQRWWIEAL 165 3344455544444 PP == domain 2 score: 52.1 bits; conditional E-value: 5.3e-18 CBM13.hmm 5 gtyrlvnvnsgkclggst.aaga.nvqlwdcc.ngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcn 79 ty+l + +sgk l t ++ a +++ + + ++a Q+Wt +s + ++ l++ + g+ L ++g+++++ t + QOC27273.1|CBM13|GH30_5 572 ATYQLLGTQSGKAL---TvQNAAlTIRSSATTaDAATaQTWTAVSLSgagtdrqRVLLRSGD-GRYLA------SSGTSLTLATES 647 57999999******...313333334444433234555******876677665444444444.67887......699999999986 PP CBM13.hmm 80 gg.....anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliae 145 ++ qW ++ ++++y + n+as ++Ldv+gg +dgt v +w+ n+ganQ W++ + +++ ++ QOC27273.1|CBM13|GH30_5 648 AEqaaadPAAQWVPNTLDGRSYSFLNVASTRVLDVNGGgtSDGTSVGLWTSNNGANQSWTLAPTAIDTVADVT 720 33444444788**98777889***************888999*****************88777766665554 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1371 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 188.62 // Query: ACZ20395.1|CBM13|GH30_5 [L=1410] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-14 38.2 0.2 9.8e-14 38.2 0.2 2.1 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.9 0.8 0.38 0.38 121 137 .. 155 171 .. 135 186 .. 0.62 2 ! 38.2 0.2 9.8e-14 9.8e-14 5 137 .. 593 734 .. 589 747 .. 0.77 Alignments for each domain: == domain 1 score: -2.9 bits; conditional E-value: 0.38 CBM13.hmm 121 wdcngganQqWsvlksd 137 +d++++ Q+W v+k + ACZ20395.1|CBM13|GH30_5 155 YDWDSDETQRWWVEKLA 171 45555555666554444 PP == domain 2 score: 38.2 bits; conditional E-value: 9.8e-14 CBM13.hmm 5 gtyrlvnvnsgkclggstaagan.vqlwdccn.ganQqWtlt..sdg......tirlenhqsgkcLdvaasstaagaevqqytcng 80 +t++lv+v+sg+ l + +a+ga+ l++ ++ ++Q Wt + ++g ++ le ++ g++L +t +g +++ ++ + ACZ20395.1|CBM13|GH30_5 593 ETFQLVGVGSGRAL-TAGATGASiTDLATTTSaVGSQLWTAHalPQGsgshalRYVLEAAD-GRVLG----ATPSGVALKTQSVAD 672 689***********.445777775778885564566******5533366776677777776.57888....6689********999 PP CBM13.hmm 81 g...anQqWrlesvgsgyykirnras.gkcLdvkgg..adgtpvqqwdcngganQqWsvlksd 137 + ++ W l+++++ ++ + + s + L+v g+ a+ +pv +w+ gga Q+W+v + + ACZ20395.1|CBM13|GH30_5 673 AladPSSWWALSTTDGSTWSFAS-GSrSLSLEVGGQstANNAPVSLWQFGGGAHQRWTVRDTS 734 99755677888776555688877.6758******889999*****************887654 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1410 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 179.99 // Query: QLH25772.1|CBM13|GH30_5 [L=681] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-18 54.4 2.9 1e-18 54.4 2.9 2.2 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.1 0.2 0.89 0.89 81 88 .. 150 157 .. 141 164 .. 0.56 2 ! 54.4 2.9 1e-18 1e-18 5 135 .. 544 679 .. 538 681 .] 0.83 Alignments for each domain: == domain 1 score: -4.1 bits; conditional E-value: 0.89 CBM13.hmm 81 ganQqWrl 88 +a Q+W++ QLH25772.1|CBM13|GH30_5 150 DATQRWWV 157 23445544 PP == domain 2 score: 54.4 bits; conditional E-value: 1e-18 CBM13.hmm 5 gtyrlvnvnsgkclggstaaganvqlwdccn.ganQqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg. 81 +ty+l++v+sgk l + +++g+++++ ++ +++ qW+l++ + ++ ++n gk L v +ga+v + +++g+ QLH25772.1|CBM13|GH30_5 544 HTYQLTGVQSGKAL-TVADDGSKLVIKGADTsARDRQWQLRQISgdtgnrqRYVFTNPVEGKRLAV-----RDGAPV-LEPDHGKr 622 689***********.45588888555654654677******6655667888999999998999*97.....588888.66666777 PP CBM13.hmm 82 .anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlk 135 ++ qW +++g+g+++++n+a+g+ L+v g+ dg+ v++w+ ++ganQ+W+v++ QLH25772.1|CBM13|GH30_5 623 dKATQWIMSTTGDGTWTLVNAATGRLLEVGGQatHDGAAVTIWTPTSGANQRWKVSE 679 67789*************************989777*****************9876 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (681 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 57.71 // Query: QKN70632.1|CBM13|GH30_5 [L=691] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-13 36.5 10.6 1e-12 34.9 0.5 2.7 3 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.1 0.7 0.44 0.44 124 136 .. 145 157 .. 140 171 .. 0.57 2 ! 8.2 0.1 0.00015 0.00015 47 93 .. 540 596 .. 531 624 .. 0.69 3 ! 34.9 0.5 1e-12 1e-12 83 136 .. 633 688 .. 587 690 .. 0.86 Alignments for each domain: == domain 1 score: -3.1 bits; conditional E-value: 0.44 CBM13.hmm 124 ngganQqWsvlks 136 + +a Q+W v++ QKN70632.1|CBM13|GH30_5 145 DADATQRWWVERI 157 2244455544444 PP == domain 2 score: 8.2 bits; conditional E-value: 0.00015 CBM13.hmm 47 g.tirlenhqsgkcLdvaasstaagaevqqytcngga............nQqWrlesvg.s 93 g t++l+ +qsgk+++va a+g+++++ t +g++ + qWrl+ v + QKN70632.1|CBM13|GH30_5 540 GhTYTLTGVQSGKAVTVA----ADGTNLVLGTGTGTGtgtgtgtgtdpsARQWRLSAVRhD 596 347899999999999973....678888888875442233444445555788888777543 PP == domain 3 score: 34.9 bits; conditional E-value: 1e-12 CBM13.hmm 83 nQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlks 136 + W +s+g+g+++++n +g+ L+v g+ dg+ v++w+ n+ganQ+W+++++ QKN70632.1|CBM13|GH30_5 633 AAEWLASSTGDGTWTLVNSGTGRLLEVGGQatHDGAAVTTWPPNSGANQRWTLTDV 688 457***************999*******989777*****************99875 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (691 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 51.17 // Query: QTU50746.1|CBM13|GH30_5 [L=1049] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-21 64.2 0.0 1.1e-21 64.2 0.0 2.3 2 CBM13.hmm Domain annotation for each model (and alignments): >> CBM13.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.6 4.8 1 1 121 140 .. 130 149 .. 120 158 .. 0.66 2 ! 64.2 0.0 1.1e-21 1.1e-21 6 156 .. 525 681 .. 520 693 .. 0.85 Alignments for each domain: == domain 1 score: -4.6 bits; conditional E-value: 1 CBM13.hmm 121 wdcngganQqWsvlksdlki 140 wd+n ++ Q+W v ++++ki QTU50746.1|CBM13|GH30_5 130 WDWNADQGQRWWVDQVKDKI 149 66666666666555555544 PP == domain 2 score: 64.2 bits; conditional E-value: 1.1e-21 CBM13.hmm 6 tyrlvnvnsgkclggstaaganvqlwdccngan.QqWtltsdg.......tirlenhqsgkcLdvaasstaagaevqqytcngg.. 81 +yrl++ +sgk + +g++v+l++ + +++ Q W++++ + +++l+n+++g L v ++ +v +++g QTU50746.1|CBM13|GH30_5 525 VYRLQGTQSGKSF-APSPDGTGVVLRTTDAASArQLWSVEQLTsgtgnreRYTLTNADTGGRLAV-----RDNQAVLEEARTGEvp 604 699999*****99.45578999**9995555555******76666778899*******7568887.....3566677778888899 PP CBM13.hmm 82 anQqWrlesvgsgyykirnrasgkcLdvkgg..adgtpvqqwdcngganQqWsvlksdlkikliaekvipdgnnnil 156 a+ qW +++g+g+++++n+a+g+ Ldv+g+ adg++v +++ +++anQ W+v+++++ ++++ae++++ g + +l QTU50746.1|CBM13|GH30_5 605 AAAQWLMSTTGDGSWTLVNAATGRLLDVTGQssADGAKVSTYTPTSAANQLWAVSDETVLSTERAEAFTVPGLRPKL 681 8899*************************989999*******************************99998877666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1049 residues searched) Target model(s): 1 (188 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 174.46 // [ok]