# hmmscan :: search sequence(s) against a profile database # HMMER 3.3.2 (Nov 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: /array2/siva/dbcansub_update/cazy2025/match_results/dbsub_data_2025/merged_clusters/AA9/fasta_for_each_cluster/cluster_96.txt # target HMM database: merged_hmms/AA9.hmm # per-dom hits tabular output: hmmscan_out/domain_result/AA9/AA9_cluster_96.out.dm # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: 681377|Lasov1_GeneCatalog_proteins_20171021.aa.fasta|AA9 [L=317] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-57 178.9 0.0 7.5e-57 178.6 0.0 1.1 1 AA9.hmm Domain annotation for each model (and alignments): >> AA9.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 178.6 0.0 7.5e-57 7.5e-57 3 219 .. 13 255 .. 11 256 .. 0.88 Alignments for each domain: == domain 1 score: 178.6 bits; conditional E-value: 7.5e-57 AA9.hmm 3 lllalaslvsAHgtvqelivngkk......egstavrkpknisrqsn....gf 45 ++ +l++++ H+ + ++++gk+ av+ +++++ ++ gf 681377|Lasov1_GeneCatalog_proteins_20171021.aa.fasta|AA9 13 SISLLIPSALSHSLLVGVVISGKNyhgydpR-PGAVNFADRVGWLTTaadqGF 64 56788999**************887776431.445666677777776888899 PP AA9.hmm 46 spvtdvtspdirCnkgasaaaapatlkvaAGdkvtfewktewpeshpGpvlvY 98 + ++ +++pdi C++g+++ pa ++v+ Gd+++++w + wpe h Gpvl Y 681377|Lasov1_GeneCatalog_proteins_20171021.aa.fasta|AA9 65 VSPAGYDTPDIVCHRGGTP--PPAHAPVRSGDRIKVQW-NGWPEGHRGPVLSY 114 ***************9998..599**************.58************ PP AA9.hmm 99 lakv......pegsdaatvdgsgaeWfKiaeegl.....ssessktwatdkli 140 la++ +g+++a+v+++ + W+Ki+e + ++ +++ wa+++l 681377|Lasov1_GeneCatalog_proteins_20171021.aa.fasta|AA9 115 LAPCdaattaAAGDGCASVNKTRLAWTKIDEGAPglflpDTPPPGDWASNHLA 167 ****66655546799****************999*****8889********** PP AA9.hmm 141 anngkvtvtiPsslppGeYLlRhEiiALhsassaggaqfYpsCaqlkVtgggs 193 nn++++v +P +l+pG Y+lRhEiiALh+a+++ggaq+Yp C++l+V+g 681377|Lasov1_GeneCatalog_proteins_20171021.aa.fasta|AA9 168 TNNNSWEVGLPLGLAPGPYVLRHEIIALHYAAQPGGAQNYPLCVNLWVEGPAA 220 ***************************************************77 PP AA9.hmm 194 aspsat.........vsfpgaykatdpgilvniya 219 s+t + + +ykatdpgil+ni + 681377|Lasov1_GeneCatalog_proteins_20171021.aa.fasta|AA9 221 LDNSKTtqpfdlaagIPAMRMYKATDPGILINISQ 255 444444467899977888899***********986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (317 residues searched) Target model(s): 1 (220 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 50.48 // Query: 627198|Lasmin1_GeneCatalog_proteins_20170616.aa.fasta|AA9 [L=287] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-57 181.4 0.0 1.2e-57 181.2 0.0 1.1 1 AA9.hmm Domain annotation for each model (and alignments): >> AA9.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 181.2 0.0 1.2e-57 1.2e-57 11 219 .. 2 235 .. 1 236 [. 0.87 Alignments for each domain: == domain 1 score: 181.2 bits; conditional E-value: 1.2e-57 AA9.hmm 11 vsAHgtvqelivngkk......egstavrkpknisrqsn....gfspvtdvt 52 + H+ + ++++gk+ av+ +++++ ++ gf+ +++++ 627198|Lasmin1_GeneCatalog_proteins_20170616.aa.fasta|AA9 2 ALSHSLLVGVVISGKNyhgydpR-PGAVNFADRVGWLTTaadqGFVSPASYN 52 56799999999999877665431.445566667777666788899******* PP AA9.hmm 53 spdirCnkgasaaaapatlkvaAGdkvtfewktewpeshpGpvlvYlakv.. 102 +pdi C++g+++ pa ++v++Gd+++++w + wpe h Gpvl Yla++ 627198|Lasmin1_GeneCatalog_proteins_20170616.aa.fasta|AA9 53 TPDIVCHRGGTP--PPAHVPVRPGDRIKVQW-NGWPEGHRGPVLSYLAPCda 101 ********9998..599**************.58****************66 PP AA9.hmm 103 ...pegsdaatvdgsgaeWfKiaeegl.....ssessktwatdklianngkv 146 +g+++a+v+++ + W+Ki+e + ++ +++ wa+++l ann+++ 627198|Lasmin1_GeneCatalog_proteins_20170616.aa.fasta|AA9 102 aaaATGDGCASVSKTRLAWTKIDEGAPglflpDTPPPGDWASNHLAANNNSW 153 65556899****************999*****8889**************** PP AA9.hmm 147 tvtiPsslppGeYLlRhEiiALhsassaggaqfYpsCaqlkVtgggs.asps 197 +v +P +l+pG Y+lRhEiiALh+a+++ggaq+Yp C++l+V+g ++ + 627198|Lasmin1_GeneCatalog_proteins_20170616.aa.fasta|AA9 154 EVGLPLGLAPGPYVLRHEIIALHYAAQPGGAQNYPLCVNLWVQGAAApGNSK 205 *******************************************995533333 PP AA9.hmm 198 at........vsfpgaykatdpgilvniya 219 +t + ++++yk+tdpgil+ni + 627198|Lasmin1_GeneCatalog_proteins_20170616.aa.fasta|AA9 206 TTrpfdlaagIPATQMYKDTDPGILINISQ 235 3356789999999**************986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (287 residues searched) Target model(s): 1 (220 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 61.31 // Query: 354392|Podbra1_GeneCatalog_proteins_20220222.aa.fasta|AA9 [L=320] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4e-63 199.1 0.0 5.1e-63 198.7 0.0 1.1 1 AA9.hmm Domain annotation for each model (and alignments): >> AA9.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 198.7 0.0 5.1e-63 5.1e-63 2 218 .. 9 247 .. 8 249 .. 0.89 Alignments for each domain: == domain 1 score: 198.7 bits; conditional E-value: 5.1e-63 AA9.hmm 2 alllalaslvsAHgtvqelivngkk.....egstavrkpknisrqsn....g 44 +ll ++as++ AH+++ +++vng+ + ++ + ++i+++s+ g 354392|Podbra1_GeneCatalog_proteins_20220222.aa.fasta|AA9 9 LLLGTAASTALAHSHLAHILVNGVLyngfdPRPNVGNYDNRIGWSSSntddG 60 6788999****************88777652255666677888887778889 PP AA9.hmm 45 fspvtdvtspdirCnkgasaaaapatlkvaAGdkvtfewktewpeshpGpvl 96 ++ ++d+ sp+i+C+k++++ a ++v+AG+kv+++w + wp h+Gpvl 354392|Podbra1_GeneCatalog_proteins_20220222.aa.fasta|AA9 61 YVGPADYASPEIICHKSGAP--PLAHAPVKAGEKVHVQW-NGWPIGHVGPVL 109 9999************8877..46889************.58********** PP AA9.hmm 97 vYlakv.pegsdaatvdgsgaeWfKiaeegl.........ssessktwatdk 138 +Y+a++ ++++++ +v +++++W+K++++++ +++ ++watd 354392|Podbra1_GeneCatalog_proteins_20220222.aa.fasta|AA9 110 AYIAPClNTANGCGSVAKTNLRWTKLDDSNPvllpgapgtWGSPAGKWATDV 161 ******888899***************************966799******* PP AA9.hmm 139 lianngkvtvtiPsslppGeYLlRhEiiALhsassaggaqfYpsCaqlkVtg 190 +ia+n++++v+iP +l+pG Y+lRhEiiALh a ++ggaq+Yp C++l+V+ 354392|Podbra1_GeneCatalog_proteins_20220222.aa.fasta|AA9 162 MIAQNNSWQVEIPHGLKPGPYVLRHEIIALHFARDKGGAQNYPVCMNLWVEP 213 ***************************************************9 PP AA9.hmm 191 ggsaspsat......vsfpgaykatdpgilvniy 218 s+ +++ +++ g+yk+td+gil+++ 354392|Podbra1_GeneCatalog_proteins_20220222.aa.fasta|AA9 214 PASSATAPQpfkldnFDARGFYKDTDKGILIDVS 247 876444444457888****************986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (320 residues searched) Target model(s): 1 (220 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 62.34 // Query: 497784|Poddi1_GeneCatalog_proteins_20171014.aa.fasta|AA9 [L=310] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-60 191.0 0.0 1.6e-60 190.6 0.0 1.1 1 AA9.hmm Domain annotation for each model (and alignments): >> AA9.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 190.6 0.0 1.6e-60 1.6e-60 5 219 .. 13 247 .. 8 248 .. 0.90 Alignments for each domain: == domain 1 score: 190.6 bits; conditional E-value: 1.6e-60 AA9.hmm 5 lalaslvsAHgtvqelivngkk.....egstavrkpknisrqsn....gfspv 48 l + +++ AH+ + +i+ngk+ + av+ +++++ ++ g++ 497784|Poddi1_GeneCatalog_proteins_20171014.aa.fasta|AA9 13 LSILPSALAHSLLVGVIINGKNyhgydPRPGAVNPADRVGWLTTaedqGYVSA 65 677899**************888776522555677788888777888899999 PP AA9.hmm 49 tdvtspdirCnkgasaaaapatlkvaAGdkvtfewktewpeshpGpvlvYlak 101 ++++pdi C++g+++ a ++v+AGdkv+++w + wp+ h+Gpv+ Y+a+ 497784|Poddi1_GeneCatalog_proteins_20171014.aa.fasta|AA9 66 LNYSTPDIVCHRGGKS--PVAHAPVRAGDKVHVQW-NGWPAGHQGPVISYVAP 115 9***********8887..47899************.58*************** PP AA9.hmm 102 v..pegsdaatvdgsgaeWfKiaeegl......ssessktwatdklianngkv 146 + +g++++++d+++++W+Ki++ + +s +++ wa+++l +nn+++ 497784|Poddi1_GeneCatalog_proteins_20171014.aa.fasta|AA9 116 CksTKGDGCTSADKNTLSWTKIENGEPglfnplTSPPPGDWASNHLANNNNSW 168 *6656899****************99999****8899**************** PP AA9.hmm 147 tvtiPsslppGeYLlRhEiiALhsassaggaqfYpsCaqlkVtgggsaspsat 199 v iP++l+pG Y+lRhEiiALh a++ ggaq+Yp C++l+V+ ++p + 497784|Poddi1_GeneCatalog_proteins_20171014.aa.fasta|AA9 169 LVGIPTGLKPGPYVLRHEIIALHFAAELGGAQNYPLCINLWVEAPAPGVPVKP 221 ********************************************988888764 PP AA9.hmm 200 ......vsfpgaykatdpgilvniya 219 + ++++yk+tdpgil++iy+ 497784|Poddi1_GeneCatalog_proteins_20171014.aa.fasta|AA9 222 fnlaagIPATKMYKSTDPGILIDIYK 247 567777999****************7 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (310 residues searched) Target model(s): 1 (220 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 57.94 // Query: 210718|Podan3_GeneCatalog_proteins_20171013.aa.fasta|AA9 [L=317] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-63 200.7 0.0 1.7e-63 200.3 0.0 1.1 1 AA9.hmm Domain annotation for each model (and alignments): >> AA9.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 200.3 0.0 1.7e-63 1.7e-63 2 218 .. 9 247 .. 8 249 .. 0.93 Alignments for each domain: == domain 1 score: 200.3 bits; conditional E-value: 1.7e-63 AA9.hmm 2 alllalaslvsAHgtvqelivngkk....eg.stavrkpknisrqsn....gf 45 +ll a+as++ AH+++ +++vng+ + + ++ p++++++s+ g+ 210718|Podan3_GeneCatalog_proteins_20171013.aa.fasta|AA9 9 LLLGAAASQALAHSHLAHILVNGVLyngfDPrPNIANFPNRVGWSSSnaddGY 61 78899******************887766226788899******999999999 PP AA9.hmm 46 spvtdvtspdirCnkgasaaaapatlkvaAGdkvtfewktewpeshpGpvlvY 98 + ++++ s++i+C+k++++ +a ++v+AG+kv+++w + wp h+Gpvl+Y 210718|Podan3_GeneCatalog_proteins_20171013.aa.fasta|AA9 62 VGPAEYASAEIICHKSGAP--PSAHAPVRAGEKVHIQW-NGWPIGHVGPVLAY 111 9999***********8887..58999************.58************ PP AA9.hmm 99 lakv.pegsdaatvdgsgaeWfKiaeegl.........ssessktwatdklia 141 +a++ ++++++ +v++++++W+K++++ + +++ ++watd +ia 210718|Podan3_GeneCatalog_proteins_20171013.aa.fasta|AA9 112 IAPClNTADGCGSVSKTNLRWTKLDDSDPvlvpgepgtWGSPAGKWATDVMIA 164 ****98899***************************9966799********** PP AA9.hmm 142 nngkvtvtiPsslppGeYLlRhEiiALhsassaggaqfYpsCaqlkVtgggsa 194 +n++++v+iP++l+pG Y+lRhEiiALh a+++ggaq+Yp C++l+V+ a 210718|Podan3_GeneCatalog_proteins_20171013.aa.fasta|AA9 165 RNNSWQVEIPRGLKPGPYVLRHEIIALHFAKNKGGAQNYPVCMNLWVEAPVPA 217 **************************************************999 PP AA9.hmm 195 spsat......vsfpgaykatdpgilvniy 218 +p ++ +++ g+yk+td+gil+++ 210718|Podan3_GeneCatalog_proteins_20171013.aa.fasta|AA9 218 VPVPQpfkldsFDARGFYKETDEGILIDVS 247 88887778999****************986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (317 residues searched) Target model(s): 1 (220 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 59.40 // Query: 305573|Apiver1_GeneCatalog_proteins_20220223.aa.fasta|AA9 [L=318] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-62 197.6 0.0 1.5e-62 197.2 0.0 1.1 1 AA9.hmm Domain annotation for each model (and alignments): >> AA9.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 197.2 0.0 1.5e-62 1.5e-62 2 218 .. 9 245 .. 8 247 .. 0.90 Alignments for each domain: == domain 1 score: 197.2 bits; conditional E-value: 1.5e-62 AA9.hmm 2 alllalaslvsAHgtvqelivngkk.....egstavrkpknisrqsn....g 44 +ll ++as+v AH+++ +++vng+ + +++ p++++++s+ g 305573|Apiver1_GeneCatalog_proteins_20220223.aa.fasta|AA9 9 LLLGTAASTVLAHSHLAHILVNGVLyngfdPRPGVANYPNRVGWSSSnsddG 60 678899*****************88777652255667899999998888999 PP AA9.hmm 45 fspvtdvtspdirCnkgasaaaapatlkvaAGdkvtfewktewpeshpGpvl 96 ++ ++d+ sp+i+C+k++++ a ++v+AG+kv+++w + wp h+Gpvl 305573|Apiver1_GeneCatalog_proteins_20220223.aa.fasta|AA9 61 YVGPADYASPEIICHKSGAP--PLAHAPVKAGEKVHVQW-NGWPIGHVGPVL 109 999*************8877..46889************.58********** PP AA9.hmm 97 vYlakv.pegsdaatvdgsgaeWfKiaeegl.........ssessktwatdk 138 +Y+a++ ++++++ +v +++++W+K++++++ +++ ++watd 305573|Apiver1_GeneCatalog_proteins_20220223.aa.fasta|AA9 110 AYIAPClNTADGCGSVAKNNLRWTKLDDSNPvllpgqpgnWGSPAGKWATDI 161 ******98899***************************9966799******* PP AA9.hmm 139 lianngkvtvtiPsslppGeYLlRhEiiALhsassaggaqfYpsCaqlkVtg 190 +ia+n++++v+iP++l+pG Y+lRhEiiALh a+++ggaq+Yp C++l+V++ 305573|Apiver1_GeneCatalog_proteins_20220223.aa.fasta|AA9 162 MIAQNNSWQVEIPRGLKPGPYVLRHEIIALHFAKNKGGAQNYPVCMNLWVES 213 ***************************************************9 PP AA9.hmm 191 ggsaspsat....vsfpgaykatdpgilvniy 218 + +a +++ ++yk+td+gil+++ 305573|Apiver1_GeneCatalog_proteins_20220223.aa.fasta|AA9 214 PVEPALQAFelddFDARNFYKDTDKGILIDVS 245 9774444434667****************986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (318 residues searched) Target model(s): 1 (220 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 59.00 // Query: 331065|Apibac1_GeneCatalog_proteins_20170729.aa.fasta|AA9 [L=321] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-64 203.4 0.0 2.5e-64 203.0 0.0 1.1 1 AA9.hmm Domain annotation for each model (and alignments): >> AA9.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 203.0 0.0 2.5e-64 2.5e-64 2 218 .. 9 248 .. 8 250 .. 0.92 Alignments for each domain: == domain 1 score: 203.0 bits; conditional E-value: 2.5e-64 AA9.hmm 2 alllalaslvsAHgtvqelivngkk....eg.stavrkpknisrqsn....g 44 +ll ++as++ AH+++ +++vng+ + ++ p++++++sn g 331065|Apibac1_GeneCatalog_proteins_20170729.aa.fasta|AA9 9 LLLGTAASTALAHSHLAHILVNGVLyngfDPrPGIINYPNRVGWSSNntddG 60 6788999****************887665225778999*********99999 PP AA9.hmm 45 fspvtdvtspdirCnkgasaaaapatlkvaAGdkvtfewktewpeshpGpvl 96 ++ ++d+ sp+i+C+k++++ a ++v+AGdkv+++w + wp h+Gpvl 331065|Apibac1_GeneCatalog_proteins_20170729.aa.fasta|AA9 61 YVGPADYASPEIICHKSGAP--PLAHAPVRAGDKVHVQW-NGWPIGHVGPVL 109 9999************8877..46889************.58********** PP AA9.hmm 97 vYlakv.pegsdaatvdgsgaeWfKiaeegl..........ssessktwatd 137 +Y+a++ ++++++ +v +++++W+K++++++ +++ ++watd 331065|Apibac1_GeneCatalog_proteins_20170729.aa.fasta|AA9 110 AYIAPClNTADGCGSVAKTNLRWTKLDDSNPvllpnepgnnWGSPAGKWATD 161 ******98899***************************999567899***** PP AA9.hmm 138 klianngkvtvtiPsslppGeYLlRhEiiALhsassaggaqfYpsCaqlkVt 189 +ia+n++++v+iP++l+pG Y+lRhEiiALh a+++ggaq+Yp C++l+V+ 331065|Apibac1_GeneCatalog_proteins_20170729.aa.fasta|AA9 162 VMIAQNNSWQVEIPRGLKPGPYVLRHEIIALHFAKNKGGAQNYPVCMNLWVE 213 **************************************************** PP AA9.hmm 190 gggsaspsat......vsfpgaykatdpgilvniy 218 ++p+++ ++++ +yk+td+gilv++ 331065|Apibac1_GeneCatalog_proteins_20170729.aa.fasta|AA9 214 PPAVGQPAPQpftldnFDATSFYKDTDKGILVDVS 248 9977777765668899****************986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (321 residues searched) Target model(s): 1 (220 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 62.93 // Query: 397244|Cersam1_GeneCatalog_proteins_20220222.aa.fasta|AA9 [L=318] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-64 203.3 0.0 2.8e-64 202.9 0.0 1.2 1 AA9.hmm Domain annotation for each model (and alignments): >> AA9.hmm # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 202.9 0.0 2.8e-64 2.8e-64 2 218 .. 9 247 .. 8 249 .. 0.93 Alignments for each domain: == domain 1 score: 202.9 bits; conditional E-value: 2.8e-64 AA9.hmm 2 alllalaslvsAHgtvqelivngkk....eg.stavrkpknisrqsn....g 44 +ll ++as+v AH+++ +++vng+ + + ++ p++++++s+ g 397244|Cersam1_GeneCatalog_proteins_20220222.aa.fasta|AA9 9 LLLGTAASKVLAHSHLAHILVNGVLyngfDPrPNIANFPNRVGWSSSntddG 60 678899*****************887766226778899******99999999 PP AA9.hmm 45 fspvtdvtspdirCnkgasaaaapatlkvaAGdkvtfewktewpeshpGpvl 96 ++ ++d+ sp+i+C+k++++ a ++v+AG+kv+++w + wp h+Gpvl 397244|Cersam1_GeneCatalog_proteins_20220222.aa.fasta|AA9 61 YVGPADYASPEIICHKSGAP--PLAHAPVKAGEKVHVQW-NGWPIGHVGPVL 109 9999************8877..46889************.58********** PP AA9.hmm 97 vYlakv.pegsdaatvdgsgaeWfKiaeegl.........ssessktwatdk 138 +Y+a++ ++ +++ +v +++++W+K++++++ +++ ++watd 397244|Cersam1_GeneCatalog_proteins_20220222.aa.fasta|AA9 110 AYIAPClNTPNGCGSVAKTNLRWTKLDDSNPvlvpgapgnWGSPAGKWATDV 161 ******977799***************************966799******* PP AA9.hmm 139 lianngkvtvtiPsslppGeYLlRhEiiALhsassaggaqfYpsCaqlkVtg 190 +ia+n++++v+iP++l+pG Y+lRhEiiALh a+++ggaq+Yp C++l+V+ 397244|Cersam1_GeneCatalog_proteins_20220222.aa.fasta|AA9 162 MIAQNNSWQVEIPRGLKPGPYVLRHEIIALHFAKDKGGAQNYPVCMNLWVEA 213 **************************************************** PP AA9.hmm 191 ggsaspsat......vsfpgaykatdpgilvniy 218 s++p+++ +++ +yk+td+gil+++ 397244|Cersam1_GeneCatalog_proteins_20220222.aa.fasta|AA9 214 PASSVPAPQpfkldsFDARAFYKDTDKGILIDVS 247 ******998889999****************986 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (318 residues searched) Target model(s): 1 (220 nodes) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 63.78 // [ok]