y
Basic Information | |
---|---|
Species | Manihot esculenta |
Cazyme ID | cassava4.1_018585m |
Family | GT1 |
Protein Properties | Length: 145 Molecular Weight: 15981.5 Isoelectric Point: 5.285 |
Chromosome | Chromosome/Scaffold: 02817 Start: 57618 End: 58212 |
Description | UDP-Glycosyltransferase superfamily protein |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
GT1 | 13 | 119 | 3.2e-33 |
GKVIGWAPQVAVLAHPAIGGFVSHCGWNSVLESLWFGVPIATWPMYAEQQFNAFEMVVELGLGVEIDMGYRKESGKIVNSDKIERAIRNLMENSDEKRKK VKEMREK |
Full Sequence |
---|
Protein Sequence Length: 145 Download |
MPEGFLERTV AVGKVIGWAP QVAVLAHPAI GGFVSHCGWN SVLESLWFGV PIATWPMYAE 60 QQFNAFEMVV ELGLGVEIDM GYRKESGKIV NSDKIERAIR NLMENSDEKR KKVKEMREKS 120 KMALIDGGSS FISLGDFIKD AMEG* 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02534 | PLN02534 | 3.0e-30 | 3 | 143 | 153 | + UDP-glycosyltransferase | ||
PLN00164 | PLN00164 | 9.0e-46 | 1 | 134 | 139 | + glucosyltransferase; Provisional | ||
PLN02207 | PLN02207 | 4.0e-50 | 1 | 142 | 143 | + UDP-glycosyltransferase | ||
PLN02167 | PLN02167 | 1.0e-64 | 1 | 144 | 144 | + UDP-glycosyltransferase family protein | ||
PLN02554 | PLN02554 | 2.0e-65 | 1 | 143 | 147 | + UDP-glycosyltransferase family protein |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0008152 | metabolic process |
GO:0016758 | transferase activity, transferring hexosyl groups |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACZ44836.1 | 0 | 1 | 138 | 331 | 468 | glycosyltransferase [Pyrus communis] |
Swiss-Prot | Q40284 | 0 | 1 | 143 | 307 | 449 | UFOG1_MANES RecName: Full=Anthocyanidin 3-O-glucosyltransferase 1; AltName: Full=Flavonol 3-O-glucosyltransferase 1; AltName: Full=UDP-glucose flavonoid 3-O-glucosyltransferase 1 |
Swiss-Prot | Q40285 | 0 | 1 | 144 | 203 | 346 | UFOG2_MANES RecName: Full=Anthocyanidin 3-O-glucosyltransferase 2; AltName: Full=Flavonol 3-O-glucosyltransferase 2; AltName: Full=UDP-glucose flavonoid 3-O-glucosyltransferase 2 |
RefSeq | XP_002520574.1 | 0 | 1 | 144 | 324 | 467 | UDP-glucosyltransferase, putative [Ricinus communis] |
RefSeq | XP_002520576.1 | 0 | 1 | 144 | 324 | 467 | UDP-glucosyltransferase, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2acw_B | 0 | 1 | 140 | 320 | 460 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
PDB | 2acw_A | 0 | 1 | 140 | 320 | 460 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
PDB | 2acv_B | 0 | 1 | 140 | 320 | 460 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
PDB | 2acv_A | 0 | 1 | 140 | 320 | 460 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
PDB | 2vg8_A | 1e-29 | 1 | 134 | 328 | 460 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
anthocyanin biosynthesis (delphinidin 3-O-glucoside) | RXN-7815 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside) | PELUDP-RXN | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside) | RXN1F-775 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
superpathway of anthocyanin biosynthesis (from cyanidin and cyanidin 3-O-glucoside) | RXN1F-775 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DV458724 | 145 | 1 | 145 | 0 |
CX296211 | 148 | 1 | 144 | 0 |
EY696422 | 148 | 1 | 144 | 0 |
EY660649 | 147 | 1 | 143 | 0 |
CN185680 | 148 | 1 | 144 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|