y
Basic Information | |
---|---|
Species | Panicum virgatum |
Cazyme ID | Pavirv00053973m |
Family | AA2 |
Protein Properties | Length: 173 Molecular Weight: 18794.4 Isoelectric Point: 8.6512 |
Chromosome | Chromosome/Scaffold: 0216861 Start: 47 End: 1312 |
Description | ascorbate peroxidase 3 |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 31 | 101 | 6.2e-23 |
ASKGCAPIMLRLAWHDAGTYDKKTKTGGPNGSVRFPQEYSHAANAGIKIAIDLLEPIKQKHPKITYADLYQ |
Full Sequence |
---|
Protein Sequence Length: 173 Download |
AAAMSAAAPV VDAEYMAEIE RARRDLRALI ASKGCAPIML RLAWHDAGTY DKKTKTGGPN 60 GSVRFPQEYS HAANAGIKIA IDLLEPIKQK HPKITYADLY QDSSVCPEEG RLPDAKQGAS 120 HLRDVFYRMG LSDKDIVALS GGHTLGKARL DRSGFDGAWT KDPLKFDNSY FV* 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam00141 | peroxidase | 4.0e-33 | 22 | 144 | 155 | + Peroxidase. | ||
PLN02364 | PLN02364 | 2.0e-64 | 9 | 171 | 186 | + L-ascorbate peroxidase 1 | ||
PLN02879 | PLN02879 | 4.0e-69 | 9 | 171 | 185 | + L-ascorbate peroxidase | ||
cd00691 | ascorbate_peroxidase | 5.0e-101 | 9 | 172 | 190 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
PLN02608 | PLN02608 | 1.0e-120 | 9 | 172 | 186 | + L-ascorbate peroxidase |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACR37850.1 | 0 | 7 | 172 | 2 | 189 | unknown [Zea mays] |
RefSeq | NP_001052271.1 | 0 | 6 | 172 | 2 | 190 | Os04g0223300 [Oryza sativa (japonica cultivar-group)] |
RefSeq | NP_001148710.1 | 0 | 7 | 172 | 2 | 189 | APx3 - Peroxisomal Ascorbate Peroxidase [Zea mays] |
Swiss-Prot | Q01MI9 | 0 | 6 | 172 | 2 | 190 | APX3_ORYSI RecName: Full=Probable L-ascorbate peroxidase 3; AltName: Full=OsAPx03 |
RefSeq | XP_002446119.1 | 0 | 7 | 172 | 2 | 189 | hypothetical protein SORBIDRAFT_06g001970 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2xj6_A | 0 | 9 | 172 | 5 | 191 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2xih_A | 0 | 9 | 172 | 5 | 191 | A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants |
PDB | 2xif_A | 0 | 9 | 172 | 5 | 191 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
PDB | 2xi6_A | 0 | 9 | 172 | 5 | 191 | A Chain A, The Structure Of Ascorbate Peroxidase Compound Ii |
PDB | 1apx_D | 0 | 9 | 172 | 5 | 191 | A Chain A, Crystal Structure Of Recombinant Ascorbate Peroxidase |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
ascorbate glutathione cycle | RXN-3521 | - | L-ascorbate peroxidase |
L-ascorbate degradation III | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
L-ascorbate degradation V | RXN-12440 | EC-1.11.1.11 | L-ascorbate peroxidase |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
FE624699 | 186 | 9 | 172 | 0 |
GT817436 | 186 | 9 | 172 | 0 |
JG821429 | 184 | 9 | 170 | 0 |
DR972292 | 186 | 9 | 172 | 0 |
CF440677 | 186 | 9 | 172 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|