y
Basic Information | |
---|---|
Species | Picea abies |
Cazyme ID | MA_10175544g0010 |
Family | AA2 |
Protein Properties | Length: 166 Molecular Weight: 17863.5 Isoelectric Point: 9.0284 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 32 | 161 | 3.4e-33 |
VKQRIDFYLKQDITQAAGLLRLHFHDCFVQGCDGSVLLAGSTSGPSEQGAPPNLSLRAKAFEIINDIKSRVDKACKVVVSCADVTALAAKESVRAAGGPQ YRIPLGRRDSLKFATQNVTLANLPAPSSKV |
Full Sequence |
---|
Protein Sequence Length: 166 Download |
ENVLTLNSDP PLVNGLSWTF YKSSCPKLES IVKQRIDFYL KQDITQAAGL LRLHFHDCFV 60 QGCDGSVLLA GSTSGPSEQG APPNLSLRAK AFEIINDIKS RVDKACKVVV SCADVTALAA 120 KESVRAAGGP QYRIPLGRRD SLKFATQNVT LANLPAPSSK VLQSSF 180 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
cd00314 | plant_peroxidase_like | 3.0e-13 | 47 | 166 | 133 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
PLN03030 | PLN03030 | 2.0e-37 | 20 | 161 | 146 | + cationic peroxidase; Provisional | ||
pfam00141 | peroxidase | 2.0e-45 | 32 | 163 | 132 | + Peroxidase. | ||
cd00693 | secretory_peroxidase | 7.0e-73 | 15 | 166 | 154 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK21712.1 | 0 | 4 | 161 | 30 | 187 | unknown [Picea sitchensis] |
GenBank | ABK22083.1 | 0 | 4 | 161 | 30 | 187 | unknown [Picea sitchensis] |
GenBank | ABK26929.1 | 0 | 4 | 161 | 30 | 187 | unknown [Picea sitchensis] |
GenBank | ACM44039.1 | 0 | 9 | 161 | 35 | 187 | peroxidase [Ginkgo biloba] |
EMBL | CAD92856.1 | 0 | 1 | 161 | 21 | 181 | peroxidase [Picea abies] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1bgp_A | 0 | 8 | 161 | 1 | 155 | A Chain A, Crystal Structure Of Barley Grain Peroxidase 1 |
PDB | 3atj_B | 2e-38 | 16 | 157 | 3 | 142 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |
PDB | 3atj_A | 2e-38 | 16 | 157 | 3 | 142 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |
PDB | 1gwt_A | 2e-38 | 16 | 157 | 3 | 142 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |
PDB | 1gx2_B | 2e-38 | 16 | 157 | 3 | 142 | A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EX338434 | 161 | 1 | 161 | 0 |
EX341252 | 161 | 1 | 161 | 0 |
EX332191 | 161 | 1 | 161 | 0 |
EX336999 | 161 | 1 | 161 | 0 |
DR096972 | 161 | 1 | 161 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|