CAZyme Information: MGYG000004902_00834

Basic Information

• Species: An23 sp900545755
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Synergistaceae; An23; An23 sp900545755
• CAZyme ID: MGYG000004902_00834
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
266		29849.14	8.7242

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004902	2322562	MAG	Spain	Europe

• Gene Location: Start: 666; End: 1466 Strand: -

Full Sequence      

MLAFDKFSSDSLRGARFFVIAAAAAVLLYLVPLGAYPLMEPDEGRYAEIPREMVESGDFV
TPRLNYVKYFEKPPLLYWANTANFAIFGQNEFAARLFPALCALAGAATTAVFGASLYGRR
AGFIAGAVTATSLLYFAIGTINITDMPLTFFLTLAFASFYTARTSGRKRWYLLFYLASAL
AVLTKGLVGVLLPGLVIFVYILATREWRLFIEPIYLPGLILFFAAAVPWFWLVCRENRDF
FHFFFNISCCNHTVLVFFALHFFPPP

Enzyme Prediction     

No EC number prediction in MGYG000004902_00834.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	14	245	3.1e-86	0.42407407407407405

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	9.29e-44	11	246	3	238	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	4.69e-41	15	245	5	239	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.43e-20	72	231	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.08e-13	15	210	2	208	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	1.59e-04	74	185	67	177	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANZ46074.1	8.95e-114	17	245	11	239
QTX31752.1	1.40e-75	26	245	16	234
QVL35575.1	1.40e-75	26	245	16	234
SNV04445.1	2.10e-68	12	245	6	240
AJE04087.1	3.84e-66	7	245	8	249

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	4.43e-39	8	245	17	266	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4SQX1	9.16e-32	26	248	13	239	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A0KGY4	7.80e-30	26	248	13	239	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A8FRR0	2.49e-28	19	248	10	242	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
A4WAM1	4.85e-28	12	248	1	241	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Enterobacter sp. (strain 638) OX=399742 GN=arnT PE=3 SV=1
B4TBG8	5.80e-27	12	248	2	242	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
17	39
92	114
121	143
147	166
179	201
211	233
240	262