CAZyme Information: MGYG000004901_01479

Basic Information

• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio
• CAZyme ID: MGYG000004901_01479
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		40914.23	7.5213

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004901	2471011	MAG	China	Asia

• Gene Location: Start: 955; End: 2037 Strand: -

Full Sequence      

MARVLYGIHGTGHGHAMRGLTIARRLSRHEFLFVADDDAPKILEPEFPVRRLPNLGTVFK
NYKVDMAATISRALPLLWHRQRYIDQVSRLIDEFQPDVCMTDLEYFVPRAAEKAGLPCLT
LDHQHIITCCQHNLPPNMWWDTFVQGLTPRYLFRPTAENLIISFYSPPVLPQYKARVAPP
ILRDSVLALNPRDDGHVLVYQSNSTHRKLVDFLRAATRKTCYVFGYDRTEGQEDNVIFMR
KSEEGFLRLLEGCSYVIQGGGHTLMGEALHLGKPILTLPLKAMVEQRFNALYIERLNYGM
QADMHTLEPELLQRFEANLPAYKAAIAAGCFCGNETVFGLVDHFIRNGSLPVHGNPAVQE

Enzyme Prediction     

No EC number prediction in MGYG000004901_01479.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13528	Glyco_trans_1_3	1.28e-70	2	320	1	321	Glycosyl transferase family 1.
TIGR00661	MJ1255	1.49e-42	3	323	1	316	conserved hypothetical protein. This model represents nearly the full length of MJ1255 from Methanococcus jannaschii and of an unpublished protein from Vibrio cholerae, as well as the C-terminal half of a protein from Methanobacterium thermoautotrophicum. A small region (~50 amino acids) within the domain appears related to a family of sugar transferases. [Hypothetical proteins, Conserved]
COG1819	YjiC	1.26e-14	1	348	1	402	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03785	GT28_MurG	3.10e-09	10	328	8	337	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
cd03784	GT1_Gtf-like	6.18e-08	12	314	10	367	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO41021.1	1.00e-271	1	360	1	360
QCC86244.1	6.95e-263	1	360	1	360
VZH35359.1	1.19e-249	1	360	18	377
SPD37011.1	1.65e-245	1	360	1	360
ATD81362.1	1.65e-245	1	360	1	360

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58652	2.89e-06	3	346	2	367	Uncharacterized glycosyltransferase MJ1255 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1255 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004901_01479.