CAZyme Information: MGYG000004899_02666

Basic Information

• Species: Bacteroides sp900555635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900555635
• CAZyme ID: MGYG000004899_02666
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293	MGYG000004899_14|CGC2	33441.02	6.4074

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004899	5396709	MAG	China	Asia

• Gene Location: Start: 109602; End: 110483 Strand: +

Full Sequence      

MKRITLLIVLLWQVCLAFAQWGPQSKVESHTFHSKVLGSDREYTIYFPKSYAVEQDRKYP
ILYLLHGMSDTDKAWFWRGHAGEVMDQLVASGEAVEMIIVSPNAGGSFDEGHWNGYFDMP
GWKYETFFYTEFLPYIESTYRIIGDKAHRAVAGLSMGGGGATSYGQKHTELFSSVYAISA
LMTIPQRGAAQPSKPGDKLAILTQSVIDNSCVKYVEEADDERKKQLRSVNWFVDCGDDDF
LLDRNIEFFQAMRRLQIPCEFRVRDGGHTWEYFHSALYTCLPFVSRNFGKVIP

Enzyme Prediction     

No EC number prediction in MGYG000004899_02666.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	34	285	4e-54	0.9823788546255506

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	1.10e-26	1	290	2	314	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	1.10e-26	34	283	1	245	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	2.27e-20	30	277	71	288	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG2819	YbbA	4.58e-10	26	287	8	261	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
PLN02442	PLN02442	2.26e-09	33	179	24	175	S-formylglutathione hydrolase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT65236.1	1.74e-31	23	282	144	394
QMW04372.1	1.84e-31	23	286	130	381
QQA30430.1	2.42e-31	23	282	144	394
AVM58192.1	2.42e-31	23	282	144	394
QUT61959.1	2.42e-31	23	282	144	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	5.50e-143	19	290	4	274	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	6.01e-25	23	286	128	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JJF_A	4.95e-23	23	180	28	178	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	1.32e-22	23	180	28	178	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
6RZO_A	6.18e-19	23	179	113	267	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	4.33e-21	23	180	47	197	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	4.38e-17	20	158	424	566	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	8.72e-12	27	158	500	632	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	1.42e-11	31	231	147	361	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P9WM38	1.06e-08	30	271	177	428	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000207	0.999153	0.000156	0.000156	0.000147	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004899_02666.